WO2023079001A1 - Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2 - Google Patents
Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2 Download PDFInfo
- Publication number
- WO2023079001A1 WO2023079001A1 PCT/EP2022/080679 EP2022080679W WO2023079001A1 WO 2023079001 A1 WO2023079001 A1 WO 2023079001A1 EP 2022080679 W EP2022080679 W EP 2022080679W WO 2023079001 A1 WO2023079001 A1 WO 2023079001A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- unit
- cell epitopes
- epitopes
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/215—Coronaviridae, e.g. avian infectious bronchitis virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
- C07K14/08—RNA viruses
- C07K14/165—Coronaviridae, e.g. avian infectious bronchitis virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20051—Methods of production or purification of viral material
- C12N2770/20052—Methods of production or purification of viral material relating to complementing cells and packaging systems for producing virus or viral particles
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/36011—Togaviridae
- C12N2770/36111—Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
- C12N2770/36122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Definitions
- This invention relates to immunogenic constructs, such as polynucleotides, polypeptides and multimeric proteins and to antigenic units and to pharmaceutical compositions/vaccines comprising such immunogenic constructs or antigenic units, which are useful for the prophylactic and therapeutic treatment of diseases caused by severe acute respiratory coronavirus 2 (SARS-CoV-2), as well as methods for producing and using the immunogenic constructs, antigenic units and pharmaceutical compositions/vaccines.
- SARS-CoV-2 severe acute respiratory coronavirus 2
- the coronavirus is an enveloped, positive-sense single-stranded RNA virus that can cause diseases in a wide range of hosts, including humans.
- Four lineages (A-D) are commonly recognized and their genome, about 30kb in length, is the largest found in RNA viruses and encodes more than 20 putative proteins, including four major structural proteins: spike (S), envelope (E), membrane (M), and nucleocapsid (N).
- S spike
- E envelope
- M membrane
- N nucleocapsid
- S spike
- E envelope
- N nucleocapsid
- SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
- RBD viral receptor binding domain
- ACE2 angiotensin-converting enzyme 2
- the most successful vaccine platforms for SARS-CoV-2 are all based on inducing immunity to the spike glycoprotein, and include mRNA platforms, virus like particles with recombinant spike protein or, adenovirus vectors (Khoury et al 2021). These strategies have proven successful at eliciting neutralizing antibody responses against SARS-COV-2, and a number of studies have shown a correlation between virus neutralizing antibody levels and protection from symptomatic infection (Earle et al., 2021; Khoury et al., 2021). Neutralization titer is therefore a potential surrogate marker for protection against COVID- 19. As neutralizing antibodies only explain part of the efficacy observed, similar studies to assess correlation between T cell response and efficacy are ongoing (Alter et al., 2021), possibly accelerating regulatory approval of T cell epitope-based vaccines.
- a first major challenge for vaccine-based control of the pandemic per September 2021 is waning immunity and reduced efficacy of licensed or emergency authorized vaccines over time.
- Several governments have therefore decided to recommend a booster dose at 6-8 months after completed regimen for high-risk population groups.
- a second major challenge is the emergence of new variants of the SARS-COV-2 with the potential for increased transmission and/or reduced sensitivity to neutralizing antibodies generated by vaccines based on the 2020 prototype spike-based vaccines.
- Some of the acquired mutations (such as D614G in spike) enabled SARS-CoV-2 variants with increased transmissibility compared to the prototype Wuhan strain variant or escaping vaccine- or disease induced immune responses (such as E484K in spike), even in fully vaccinated individuals.
- the pandemic is therefore still ongoing and new variants of concern of the SARS-CoV-2 virus keep emerging; with the Delta variant currently dominating globally with greatest transmission capability and the Beta variant showing the greatest reduction in sensitivity to vaccine induced antibodies.
- CD8+ cytotoxic T lymphocytes contribute to virus clearance from intracellular compartments inaccessible to neutralizing antibodies and support the SARS-CoV-2 antibody response by clearing virus-infected cells. They may also play a role in blocking transmission.
- Antigen- specific CD4+ T cells support B cells and CD8+ T cell generation, support of memory generation and indirect or direct cytotoxic activity.
- the present invention relates to vaccines comprising selected SARS-CoV-2 T cell epitopes which elicit a cellular immune response (T cell response) in human individuals to which they have been administered.
- the vaccines are thus useful for the prophylactic and therapeutic treatment of diseases caused by SARS-CoV-2.
- the disclosure relates to an immunogenic construct, the construct being:
- a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- the disclosure relates to an immunogenic construct, the construct being:
- a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a dimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- the disclosure relates to a vector comprising the polynucleotide as defined herein. In yet another aspect, the disclosure relates to a host cell comprising the vector or polynucleotide as defined herein.
- the disclosure relates to a polypeptide encoded by the nucleic acid sequence as defined herein.
- the disclosure relates to a multimeric protein consisting of multiple polypeptides as defined herein. In some embodiments, the disclosure relates to a dimeric protein consisting of two polypeptides as defined herein.
- the disclosure relates to the polynucleotide, the vector, the polypeptide or the multimeric protein as defined herein, for use as a medicament.
- the disclosure relates to a pharmaceutical composition/vaccine comprising the polynucleotide, the vector, the polypeptide or the multimeric protein as defined herein, and a pharmaceutically acceptable carrier.
- the disclosure relates to methods for preparing the pharmaceutical composition/vaccine and the use of the pharmaceutical composition/vaccine for the prophylactic or therapeutic treatment of a disease caused by SARS-CoV-2, such as by administering the pharmaceutical composition/vaccine to a subject in need of such prophylactic or therapeutic treatment.
- the immunogenic construct or pharmaceutical composition/vaccine comprising such construct will, once administered to a subject elicit a rapid, strong and persistent T cell response and thus is useful as a prophylactic and therapeutic treatment of diseases caused by SARS-CoV-2.
- the pharmaceutical composition/vaccine may be administered to a human individual who has been previously vaccinated with a SARS-CoV-2 vaccine that targets the spike protein.
- a human individual who has been previously vaccinated with a SARS-CoV-2 vaccine that targets the spike protein.
- Such individual may not be sufficiently protected against novel/future variants of the spike protein and the T cell vaccine of the invention will strengthen the individual’s immune response to SARS-CoV-2 by boosting existing spike-specific T cell responses that may have been induced by the previous vaccine and add additional T cells specific for the non-spike antigens and thus fully utilizing CD4+/CD8+ T cell immunity in addition to neutralization response elicited by the previous vaccine.
- the pharmaceutical compositon/vaccine may be administered to a human individual who has not yet been vaccinated with a SARS-CoV-2 vaccine and CD4+/CD8+ T cells provide protective immunity during SARS-CoV-2 infection.
- the immunogenic construct of the invention is a vaccibody construct, i.e. a multimeric fusion protein consisting of multiple polypeptides (e.g. a dimeric protein consisting of two polypeptides), each polypeptide comprising a targeting unit, which targets antigen- presenting cells, a multimerization unit and an antigenic unit and which, after administration to a subject, has shown to be efficient in generating an immune response against the antigens or epitopes comprised in the antigenic unit.
- Vaccibody constructs have previously been suggested as vaccines against SARS-CoV-2 infection, see for example PCT/EP2021/061602, the content of which is included herein by reference and G. Norheim et al., bioRvix 2020, doi: https://doi.org/10.1101/2020.12.08.416875.
- the construct disclosed herein may be administered to a subj ect, e g. a human individual, in the form of a polynucleotide (e.g. a DNA plasmid) comprising a nucleotide sequence encoding the polypeptide.
- a polynucleotide e.g. a DNA plasmid
- the polypeptide is expressed which, due to the multimerization unit, such as dimerization unit, forms a multimeric fusion protein, such as a dimer.
- the immunogenic construct of the invention may be used in a vaccine, i.e. a pharmaceutical composition comprising the construct of the invention and a pharmaceutically acceptable carrier, for use in the prophylactic or therapeutic treatment of diseases caused by SARS-CoV-2, by administering the vaccine to a subject, i.e. a human individual.
- a vaccine i.e. a pharmaceutical composition comprising the construct of the invention and a pharmaceutically acceptable carrier, for use in the prophylactic or therapeutic treatment of diseases caused by SARS-CoV-2, by administering the vaccine to a subject, i.e. a human individual.
- the antigenic unit described herein is a further aspect of the disclosure.
- the disclosure refers to (i) a polynucleotide comprising a nucleotide sequence encoding an antigenic unit comprising at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or (ii) a polypeptide encoded by the nucleic acid sequence defined in (i).
- Such antigenic unit in the form of the polynucleotide or polypeptide
- a pharmaceutical composition/vaccine comprising a pharmaceutically acceptable carrier on its own, i.e. without the targeting unit and the multimerization unit being present in the polynucleotide/polypeptide.
- the antigenic unit may be used in the form of a polynucleotide as described herein, e g. a DNA or an RNA, including genomic DNA, cDNA and mRNA, either double stranded or single stranded or used in the form of a polypeptide.
- the polynucleotide may be comprised in a vector suitable for transfecting or transducing a host cell.
- the antigenic unit may be comprised in a vector containing sequences which have shown to increase the stability and translational efficacy of the RNA, e.g. a poly(A) tail.
- the vector may further comprise a sequence encoding a signal peptide or a fragment thereof.
- the RNA or vector may be used as an RNA vaccine, which may be formulated as described herein.
- polypeptide may be used as a peptide vaccine which may be formulated as known in the art, i.e. comprising a pharmaceutical carrier and optionally excipients and/or adjuvants known in the art for use in such peptide vaccines.
- Figure 1 shows an immunogenic construct of the invention which is a polypeptide and described as having an N-terminal start and a C-terminal end.
- the units/elements of the polypeptide - here targeting unit that targets antigen presenting cells (APCs) (TU), dimerization unit (DimU) and antigenic unit - may be arranged in the polypeptide such that the antigenic unit is located at the C-terminal end of the polypeptide ( Figure la) or at the N-terminal start of the polypeptide ( Figure lb). Further details are provided in the section with the title “Immunogenic construct”.
- Figure 2 shows a schematic drawing of a VB10.COV2 construct, an embodiment of the invention as discussed in the Example section of this application.
- Figure 3 shows the T cell response (corrected for PBS negative control) induced with one dose of 25 pg of VB10.COV2 DNA plasmid in C57BL/6-McphlTg(HLA-A2.1)lEnge/J transgenic mice.
- Total number of IFN-y positive spots/lxlO 6 pooled splenocytes harvested 14 days post vaccination from mice (n 4) vaccinated with one dose of 25 pg of VB10.COV2 DNA plasmid and stimulated with 2 pg/ mL peptides/peptide pools composed of peptides corresponding to human HLA-A2.1 epitopes/groups of epitopes present in the respective constructs.
- Figure 4 shows the T cell response (corrected for PBS negative control) induced with one dose of 50 pg of VB10.COV2 DNA plasmid in C57BL/6-McphlTg(HLA-A2.1)lEnge/J transgenic mice.
- Total number of IFN-y positive spots/lxlO 6 pooled splenocytes harvested 14 days post vaccination from mice (n 3) vaccinated with one dose of 50 pg of VB10.COV2 DNA plasmid and stimulated with 4 pg/ mL peptides/peptide pools composed of peptides corresponding to human HLA-A2.1 epitopes/groups of epitopes present in the respective constructs.
- Figure 5 shows the T cell response (corrected for PBS negative control) induced with one dose of 25 pg of VB10.COV2 DNA plasmid in BALB/c mice.
- Total number of IFN- y positive spots/lxlO 6 pooled splenocytes harvested 14 days post vaccination from mice (n 3) vaccinated with 25 pg of VB10.COV2 DNA plasmid and stimulated with 2 pg/ mL peptide pools composed of overlapping 15-mer peptides covering all the epitopes present in the respective constructs.
- FIG. 6 shows the T cell response (corrected for PBS negative control) induced with one dose of 25 pg of VB10.COV2 DNA plasmid in C57BL/6 mice.
- Total number of IFN-y positive spots/lxlO 6 pooled splenocytes harvested 14 days post vaccination from mice (n 3) vaccinated with 25 pg of VB10.COV2 DNA plasmid and stimulated with 2 pg/ml peptide pools composed of overlapping 15-mer peptides covering all the epitopes present in the respective constructs.
- Figure 7 shows the T cell response (corrected for PBS negative control) induced with one dose of 25 pg of VB2210 DNA plasmid in C57BL/6 mice.
- Figure 8 shows the T cell response (corrected for PBS negative control) induced with one or two doses of 1, 5 or 25 pg of VB2210 DNA plasmid in C57BL/6-McphlTg(HLA-A2.1)lEnge/J transgenic mice.
- Total number of IFN-y positive spots/lxlO 6 splenocytes harvested 14 days post first or post second vaccination (second vaccination at day 21) from mice (n 4) vaccinated with one or two doses of 1, 5 or 25 pg VB2210 DNA plasmid and stimulated with 2 pg/ml peptide pools composed of overlapping 15-mer peptides covering all the epitopes/groups of epitopes contained in the construct. Data are presented as an average of total responses ⁇ SEM.
- Figure 9 shows the T cell response (corrected for PBS negative control) induced with one or two doses of 1, 5 or 25 pg of VB2210 DNA plasmid in C57BL/6-McphlTg(HLA-A2 l)lEnge/J transgenic mice.
- Total number of IFN-y positive spots/lxlO 6 splenocytes harvested from mice (n 4) vaccinated with one or two doses of 1, 5 or 25 pg of VB2210 DNA plasmid and stimulated with 4 pg/ml peptide pools composed of peptides covering specific human HLA-A2.1 epitopes contained in the construct.
- Splenocytes were harvested 14 days post single or post second vaccination (second dose at day 21). Data are presented as an average of total responses ⁇ SEM.
- Figure 10 shows the T cell response induced with one or two doses of 1, 5 or 25 pg of VB2210 DNA plasmid in C57BL/6 wildtype mice.
- Splenocytes were harvested 84 days post single dose or 85 days post first dose (if 2 doses were administered). Data are presented as an average of total responses ⁇ SEM.
- Figure 11 shows the populations of CD8+ T cells expressing one or two cytokines obtained from C57BL/6-McphlTg(HLA-A2.1)lEnge/J transgenic mice vaccinated with one or two doses of 25 pg VB2210 DNA plasmid.
- Splenocytes were harvested 14 days after first or second vaccination (second vaccination at day 21) and stimulated with 6 pg/ml of a peptide pool composed of immunogenic peptides identified in the previously carried out ELISpot assays corresponding to multiple HLA-A2.1 epitopes present in the construct.
- Multicolor staining followed by multiparameter functional analysis was performed to assess expression of fFN-y, TNF-a, IL-2, IL-4, IL-17, and FoxP3 in stimulated cells.
- Figure 12a shows the T cell response towards the spike epitopes and Figure 12b shows the sum of T cell responses to N, M, ORF1/3/10 and ORF7 epitopes.
- Figure 13 shows the T cell response (corrected for negative control) induced with two doses of 3 mg of VB 10.2210 DNA plasmid in healthy volunteers.
- Total number of IFN- Y positive spots/lxlO 6 PBMCs before vaccination (baseline) and after 2 vaccinations (peak) from healthy volunteers (n l l) vaccinated with 2 doses of 3 mg VB10.2210 DNA plasmid and stimulated with peptide pools composed of overlapping 15-mer peptides covering all the epitopes present in VB 10.2210 and a selection of minimal peptides are shown.
- Figure 13a shows the T cell response towards the spike epitopes
- Figure 13b shows the T cell response towards the M epitopes
- Figure 13c shows the T cell response towards the N epitopes
- Figure 13d shows the T cell response towards the ORF1/3/10 epitopes
- Figure 13e shows the T cell response towards the ORF7 epitopes.
- Figure 14 shows the T cell response (corrected for negative control) induced after 2 doses of 3 mg of VB10.2210 DNA plasmid in 2 distinct participants.
- Figure 15 shows the phenotype of polyfunctional vaccine- specific T cells in healthy volunteers vaccinated with 2 doses of 3 mg VB10.2210 DNA plasmid.
- PBMCs before first vaccination (baseline) and after 2 vaccinations (peak) were peptide-stimulated for 16 h prior to intracellular staining for phenotype markers (CD4, CD8) and cytokine production (TNF-a and IFN-y) and subjected to multiparameter analysis by flow cytometry.
- Figures 15a and 15b show the negative control (PBMCs only in cell medium with corresponding DMSO concentration to peptide pool) at baseline and peak, respectively.
- Figure 15c shows the gating of CD8+ T cell population and
- Figure 15d shows the TNF-a and IFN-y expression of the CD8+ T cell population stimulated with non-spike epitopes (M, N and ORFs).
- the polynucleotide, polypeptide and the multimeric protein are herein denoted an “immunogenic construct” or just “construct”.
- An “immunogenic construct” is one that elicits an immune response, when administered to a subject in a form suitable for administration and in an amount effective to elicit the immune response (i.e. an immunologically effective amount).
- a “subject” is a human individual.
- a subject may be a patient, i.e. a human individual suffering from a disease caused by SARS-CoV-2 who is in need of a therapeutic treatment.
- the terms “subject” and “individual” are used interchangeably herein.
- the terms “human” and “h” are used interchangeably herein to refer to a human.
- a “treatment” is a prophylactic treatment or therapeutic treatment.
- a “prophylactic treatment” is a treatment administered to a subject who does not display signs or symptoms of, or displays only early signs or symptoms of, a disease caused by SARS-CoV-2, such that treatment is administered for the purpose of preventing or decreasing the risk of developing the disease.
- a prophylactic treatment functions as a preventative treatment against a disease caused by SARS-CoV-2, or as a treatment that inhibits or reduces further development or enhancement of the disease.
- the terms “prophylactic treatment”, “prophylaxis” and “prevention” are used interchangeably herein.
- a “therapeutic treatment” is a treatment administered to a subject who has been tested positive to SARS-CoV2 and/or displays symptoms or signs of a disease caused by SARS-CoV-2, in which treatment is administered to the subject for the purpose of diminishing or eliminating those signs or symptoms.
- nucleotide sequence is a sequence consisting of nucleotides.
- nucleotide sequence and “nucleic acid sequence” are used interchangeably herein.
- the immunogenic construct of the invention can be described as a polypeptide having an N-terminal start and a C-terminal end (illustrated in Figure. 1).
- the elements/units of the polypeptide - targeting unit that targets APCs (TU), multimerization unit, such as dimerization unit (DimU) in Figure 1, and antigenic unit - may be arranged in the polypeptide such that the antigenic unit is located at the C-terminal end of the polypeptide ( Figure la) or at the N-terminal start of the polypeptide ( Figure lb).
- the antigenic unit is located at the C-terminal end of the polypeptide.
- the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes, either as discrete epitopes or grouped together into one or more groups and may comprise linkers (T cell epitope linkers) which separate the discrete T cell epitopes, the T cell epitopes within a group and/or the groups of T cell epitopes from each other.
- a unit linker (UL) may connect the multimerization unit and the antigenic unit.
- the order and orientation of the above-described units and elements is the same in the dimeric protein and the polynucleotide.
- the various units and elements of the construct will be discussed in detail. They are present in the polynucleotide as nucleic acid sequences encoding the units/elements, and in the polypeptide or multimeric protein as amino acids sequences.
- the units/elements of the construct are mainly explained in relation to the polypeptide/multmeric protein, i.e. on the basis of their amino acid sequences.
- the antigenic unit present in the construct of the invention comprises at least 77 T cell epitopes from SARS-CoV-2. These 77 T cell epitopes are listed in Table 1 below according to the SARS-CoV-2 protein they are derived from, with their respective amino acid sequences and sequence identities (SEQ ID NO):
- the antigenic unit comprises the T cell epitope 1, which has the amino acid sequence SEQ ID NO: 1 (i.e. SRTLSYYKLGASQRVAGDS) or an amino acid sequence having at least 73% sequence identity thereto and the T cell epitope 2, which has the amino acid sequence SEQ ID NO: 2 (i.e. PKEITVATSRTLSYYKLGA) or an amino acid sequence having at least 73% sequence identity thereto and the T cell epitope 3, which has the amino acid sequence SEQ ID NO: 3 (i.e. LRIAGHHLGRCDIKDLPKE) or an amino acid sequence having at least 73% sequence identity thereto and so on.
- the 77 SARS-CoV-2 T cell epitopes have amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77, such as at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%.
- the 77 SARS-CoV-2 T cell epitopes have the amino acid sequences of SEQ ID NOs: 1-77.
- the 77 SARS-CoV-2 T cell epitopes have the amino acid SEQ ID NOs: 1-77, wherein in said sequences 6 or less amino acids are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 1-77, such as 5 or less, 4 or less amino acids, 3 or less amino acids, 2 or less amino acids or 1 or less amino acids. In some embodiments, for T cell epitopes having a length of from 8 to 11 amino acids, 3 or less amino acids, preferably 2 or less amino acids or 1 or less amino acids are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 1-77.
- T cell epitopes having a length of from 13 to 14 amino acids 4 or less amino acids, preferably 3 or less amino acids, 2 or less amino acids or 1 or less amino acids are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 1-77.
- for T cell epitopes having a length of from 19 to 20 amino acids 6 or less amino acids, preferably 5 or less, 4 or less amino acids, 3 or less amino acids, 2 or less amino acids or 1 or less amino acids, are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 1-77.
- the 77 SARS-CoV-2 T cell epitopes and any additional SARS-CoV-2 T cell epitopes listed in Tables 2 and 3 below which are or may be comprised in the antigenic unit were selected from a pool of T cell epitopes identified in COVID-19 patients, applying the following criteria:
- T cell epitopes binds to HLA class I alleles, while the other subset binds to HLA class II alleles.
- the T cell epitopes comprised in the antigenic unit there is a higher portion that binds to HLA class I alleles than to HLA class II alleles.
- at least 60% of the T cell epitopes bind to HLA class I alleles, such as at least 65% or at least 66% or at least 67% or at least 68% or at least 69% or at least 70% or at least 71% or at least 72% or at least 73% or at least 74% or at least 75%
- T cell epitopes are predicted to bind to different HLA class I and class II alleles that cover on average 92% of the world population (ranging from 85% for the West Indies to 99% for Europe), thus a vaccine comprising the construct of the invention should be suitable to be used for treatment and prophylaxis world-wide.
- the T cell epitopes are conserved T cell epitopes within a multitude of different SARS CoV-2 strains world-wide. When accounting for the genetic diversity across the SARS-CoV-2 genome, computed using a global collection of samples, the selected epitopes are located in regions with low entropy.
- the inclusion of the at least 77 T cell epitopes into the immunogenic construct will ensure that the risk for immune evasion is low compared to spike-only based vaccines, which are at great risk of mutations in key antibody epitopes on the spike surface protein that impairs neutralization.
- the T cell epitopes disclosed herein are derived from various SARS-CoV-2 virus structural proteins, i.e. the N (nucleocapsid) protein, the S (spike) protein and the M (membrane) protein and various SARS-CoV-2 virus non-structural proteins, i.e. ORFlab, ORF3a, ORF7a, ORF7b and ORFIO.
- SARS-CoV-2 virus structural proteins i.e. the N (nucleocapsid) protein, the S (spike) protein and the M (membrane) protein
- various SARS-CoV-2 virus non-structural proteins i.e. ORFlab, ORF3a, ORF7a, ORF7b and ORFIO.
- the T cell epitopes may be derived from the same part of the protein (e.g. the same subunit) or from different parts of said protein.
- the T cell epitopes are derived from different parts of a certain SARS-
- T cell epitopes are derived from the SI subunit (epitopes 66-71), while 6 T cell epitopes are derived from the S2 subunit (epitopes 72-77).
- some or all of the T cell epitopes disclosed herein are flanked by amino acids sequences also flanking said epitope in the naturally occurring protein the epitope is derived from, e.g. amino acid sequences flanking the epitope in the direction of the N-terminus, the C-terminus or both.
- Such flanking sequences each may comprise 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more or 10 or more amino acids.
- such flanking sequences comprise 1 to 10 amino acids, e.g. 2 to 8 amino acids or 3 to 7 amino acids or 4 to 5 amino acids.
- the antigenic unit comprises all of the at least 77 T cell epitopes and, optionally, one or more additional T cell epitopes selected from those listed in Table 2 and 3, as single, discrete epitopes, which may be separated from each other by T cell epitope linkers.
- the antigenic unit comprises one or more groups comprising at least 2 of the T cell epitopes disclosed herein, e.g. from 2 to 20 epitopes, preferably from 2 to 15 epitopes, such as 2, 3, 4, 5, 6, 7, 8, 8, 10, 11, 12, 13, 14, or 15 epitopes.
- the epitopes may be separated from each other by T cell epitope linkers.
- the groups of epitopes are separated from each other by T cell epitope linker.
- the at least 2 T cell epitopes are derived from the same SARS-CoV-2 protein and more preferably from the same part of the same SARS-CoV-2 protein.
- the antigenic unit may comprise a first group comprising the 4 T cell epitopes derived from the M protein listed in Table 1 (epitopes 1-4), a second group comprising the 6 T cell epitopes which are derived from the SI subunit (epitopes 66-71) and a third group comprising the 6 T cell epitopes that are derived from the S2 subunit (epitopes 72-77).
- the epitopes of the first, second and third group may be separated from each other by T cell epitope linkers and the first, second and third group may be separated from each other by T cell epitope linkers.
- the third group may be split into two groups: a third group comprising 3 T cell epitopes (72-74) and a fourth group comprising 3 T cell epitopes (75-77).
- the T cell epitopes within a group are sequentially arranged.
- the epitopes 1-4 derived from the M protein may be arranged in the order epitope 1 -epitope 2-epitope 3 -epitope 4 in the first group (or any other combination or permutation of said 4 epitopes).
- the epitopes may be separated from each other by T cell epitope linkers.
- the T cell epitopes within a group are aligned to form a continuous sequence of amino acids which corresponds to that of the naturally occurring protein the epitopes are derived from, whereby overlapping sequences are only included once in the continuous sequence and thus in the antigenic unit.
- the epitopes 1-4 from the M protein are aligned and the resulting aligned sequence of epitopes (1-4) is included as a group in the antigenic unit:
- flanking sequences may comprise 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more or 10 or more amino acids.
- flanking sequences comprise 1 to 10 amino acids, e g. 2 to 8 amino acids or 3 to 7 amino acids or 4 to 5 amino acids.
- the above-mentioned sequence of the group of epitopes 1-4 derived from the M protein may comprise the following flanking amino acid (underlined):
- the resulting length of such a group comprising the aligned sequence of at least 2 of the T cell epitopes disclosed herein and optionally flanking amino acid sequences is from about 18 amino acids to about 80 amino acids, e g. about 20 amino acids to about 70 amino acids or about 21 amino acids to about 67 amino acids.
- the antigenic unit comprises the T cell epitopes disclosed herein in the form of one or more discrete T cell epitopes (e g. epitope 21, 85 and/or 119) and one or more groups comprising at least 2 T cell epitopes, preferably at least 2 T cell epitopes from the same SARS-CoV-2 protein, more preferably at least 2 T cell epitopes from the same part of the same SARS-CoV-2 protein.
- the following of the at least 77 SARS-CoV-2 T cell epitopes are grouped together: epitopes 1-4; 5-9 (in another embodiment, this group is split into two groups: a first one with epitopes 5-6 and a second one with epitopes 7-9); epitopes 10- 18 (in another embodiment, this group is split into two groups: a first one with epitopes 10-16 and a second one with epitopes 17-18); epitopes 19-20; epitopes 22-23; epitopes 24-26; epitopes 27-39; epitopes 40-43; epitopes 44-47; epitopes 48-58; epitopes 59-65; epitopes 66-71 and epitopes 72-77 (in another embodiment, this group is split into two groups: a first one with epitopes 72-74 and a second one with epitopes 75-77).
- the antigenic unit does not comprise T cell epitopes derived from the receptor binding domain (RED) of the SARS-CoV-2 spike protein.
- An antigenic unit which only comprises the 77 T cell epitopes listed in Table 1 (or only comprises the 77 T cell epitopes listed in Table 1 and other T cell epitopes which are not derived from the RBD, e.g. one or more of the SARS-CoV-2 T cell epitopes listed in Table 3) would not comprise T cell epitopes derived from RBD.
- the antigenic unit further comprises SARS-CoV-2 T cell epitopes derived from the RBD, preferably one or more of the 19 SARS-CoV-2 T cell epitopes listed in Table 2 with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 78-96.
- the antigenic unit comprises one or more of the 19 SARS-CoV- 2 T cell epitopes listed in Table 2, wherein the epitopes have amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 78-96, such as at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%.
- the epitopes have amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 78-96, such as at least 74%, at least 75%, at least 76%, at least 77%, at
- the 19 SARS-CoV-2 T cell epitopes listed in Table 2 have the amino acid sequences of SEQ ID NOs: 78-96. In some other embodiments, the 19 SARS-CoV-2 T cell epitopes listed in Table 2 have the amino acid SEQ ID NOs: 78-96, wherein in said sequences 6 or less amino acids are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 78-96, such as 5 or less, 4 or less amino acids, 3 or less amino acids, 2 or less amino acids or 1 or less amino acids.
- T cell epitopes having a length of from 8 to 11 amino acids 3 or less amino acids, preferably 2 or less amino acids or 1 or less amino acids are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 78-96.
- 3 or less amino acids preferably 2 or less amino acids or 1 or less amino acids are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 78-96.
- T cell epitopes having a length of from 19 to 20 amino acids 6 or less amino acids, preferably 5 or less, 4 or less amino acids, 3 or less amino acids, 2 or less amino acids or 1 or less amino acids, are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 78-96.
- the antigenic unit comprises 2 or more of the 19 SARS-CoV-2 T cell epitopes listed in Table 2.
- the antigenic unit comprises 2 or more of the T cell epitopes listed in Table 2 and the following epitopes are preferably grouped together: epitopes 78-84 (in another embodiment, this group is split into two groups: a first one with epitopes 78 and 79 and a second one with epitopes 80-84); epitopes 86-96 (in another embodiment, this group is split in two group: a first one with epitopes 86-93 and a second one with epitopes 94-96).
- the antigenic unit comprises all of the 19 RBD derived SARS-CoV-2 T cell epitopes listed in Table 2.
- the antigenic unit of the construct according to the invention comprises at least 96 SARS CoV-2 derived T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-96.
- Vaccines comprising immunogenic constructs of the invention whose antigenic units comprise one or more of the RBD derived T cell epitopes listed in Table 2 are preferably administered as booster vaccines to individuals who have previously been vaccinated with vaccines comprising the RBD antigen or parts thereof, preferably vaccines comprising the RBD antigen or parts thereof which are disclosed in PCT/EP2021/061602 and G. Norheim et al., bioRvix 2020, doi: https://doi.org/10.1101/2020.12.08.416875.
- the antigenic further comprises one or more of the 64 SARS- CoV-2 T cell epitopes listed in Table 3 with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 97-160.
- the antigenic unit comprises one or more of the 64 SARS-CoV-
- the epitopes have amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 97- 160, such as at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%.
- the 64 SARS-CoV-2 T cell epitopes listed in Table 2 have the amino acid SEQ ID NOs: 97-160, wherein in said sequences 6 or less amino acids are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 97-160, such as 5 or less, 4 or less amino acids, 3 or less amino acids, 2 or less amino acids or 1 or less amino acids.
- amino acid sequences SEQ ID NOs: 97-160 such as 5 or less, 4 or less amino acids, 3 or less amino acids, 2 or less amino acids or 1 or less amino acids.
- T cell epitopes having a length of from 8 to 11 amino acids 3 or less amino acids, preferably 2 or less amino acids or 1 or less amino acids are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 97-160.
- T cell epitopes having a length of from 13 to 14 amino acids 4 or less amino acids, preferably 3 or less amino acids, 2 or less amino acids or 1 or less amino acids are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 97-160.
- amino acid sequences SEQ ID NOs: 97-160 compared to the amino acid sequences SEQ ID NOs: 97-160.
- T cell epitopes having a length of from 19 to 20 amino acids 6 or less amino acids, preferably 5 or less,
- amino acids 4 or less amino acids, 3 or less amino acids, 2 or less amino acids or 1 or less amino acids, are deleted, added or substituted by other amino acids, compared to the amino acid sequences SEQ ID NOs: 97-160.
- the antigenic unit comprises 2 or more of the T cell epitopes listed in Table 3. In another embodiment, the antigenic unit comprises 2 or more of the T cell epitopes listed in Table 3 and the following epitopes are preferably grouped together: epitopes 97-102; epitopes 103-109; epitopes 110-111; epitopes 112-113; epitopes 114-118 (in some other embodiments, this group is split in two group: a first one with epitopes 114-115 and a second one with epitopes 116-118); epitopes 120-123; epitopes 124-129; epitopes 130-134; epitopes 135-137; epitopes 138-140; epitopes 141- 146 (in some other embodiments, this group is split in two group: a first one with epitopes 141-143 and a second one with epitopes 144-146); epitopes 147-152 (in some other embodiments, this
- epitopes from Table 1 and Table 3 are grouped together, for example in a group comprising the epitopes 24-26 and 114-118.
- the antigenic unit comprises all of the 64 SARS-CoV- 2 derived T cell epitopes listed in Table 3.
- the antigenic unit of the construct according to the invention comprises at least 141 SARS CoV-2 derived T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77 and 97-160.
- the aforementioned antigenic unit does not comprise T cell epitopes derived from the receptor binding domain (RBD) of the SARS-CoV-2 spike protein.
- the aforementioned antigenic unit comprises in addition one or more of the 19 RBD derived T cell epitopes listed in Table 2.
- the antigenic unit comprises all of the SARS-CoV-2 derived T cell epitopes listed in Table 3 and all of the RBD derived T cell epitopes listed in Table 2.
- the antigenic unit of the construct according to the invention comprises at least 160 SARS CoV-2 derived T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-160.
- the T cell epitopes or groups of T cell epitopes are randomly arranged in the antigenic unit. In some other embodiments, the T cell epitopes are arranged in the antigenic unit in such a way, that the most hydrophobic T cell epitopes are located in the middle or towards the middle of the antigenic unit, while the most hydrophilic T cell epitopes are located at or towards the N-terminal and C-terminal part of the antigenic unit.
- the groups of T cell epitopes having the most hydrophobic sequences are located in the middle or towards the middle of the antigenic unit while the groups of T cell epitopes having the most hydrophilic sequences are located at or towards the N-terminal and C-terminal part of the antigenic unit.
- the most hydrophobic T cell epitopes or group of T cell epitopes may be positioned substantially in the middle of the antigenic unit and the most hydrophilic T cell epitopes or group of T cell epitopes may be positioned towards the N- terminal and C-terminal part of the antigenic unit.
- the term “substantially” in this context refers to antigenic units comprising an even number of T cell epitopes or groups of T cell epitopes, wherein the most hydrophobic T cell epitopes are positioned as close to the middle as possible.
- the T cell epitopes or groups of T cell epitopes may be arranged alternating between a hydrophilic and a hydrophobic T cell epitope/group of T cell epitopes.
- GC rich T cell epitopes or groups of T cell epitopes are arranged in such a way, that GC clusters are avoided.
- GC rich T cell epitopes or groups of T cell epitopes are arranged such that there is at least one non-GC rich T cell epitope/group of T cell epitopes between them.
- the T cell epitopes or groups of T cell epitopes are separated from each other by T cell epitope linkers (hereinafter also “linker”).
- a T cell epitope linker may also be included at the N-terminus or C-terminus of the antigenic unit.
- the T cell epitope linker is designed to be non- immunogenic.
- a T cell epitope linker may be a rigid linker, meaning that that it does not allow the two amino acid sequences that it connects to substantially move freely relative to each other.
- it may be a flexible linker, i.e. a linker that allows the two amino acid sequences that it connects to substantially move freely relative to each other. Both types of linkers are useful.
- the T cell epitope linker is flexible linker, which allows for presenting the T cell epitopes or group of T cell epitopes in an optimal manner to the immune system, even if the antigenic unit comprises a large number of T cell epitopes.
- the T cell epitope linker is a peptide consisting of from 4 to 40 amino acids, e.g. 35, 30, 25 or 20 amino acids, e.g. from 5 to 20 amino acids or 5 to 15 amino acids or 8 to 20 amino acids or 8 to 15 amino acids 10 to 15 amino acids or 8 to 12 amino acids. In some other embodiments, the T cell epitope linker consists of 10 amino acids.
- the T cell epitope linker is a peptide consisting of from 4 to 20 amino acids, e.g. from 5 to 18 amino acids or 6 to 15 amino acids or 7 to 10 amino acids.
- the T cell epitope linker consists of 5 to 7 amino acids or 8 to 12 amino acids, such as 5, 6, 7, 8, 9 or 10 amino acids.
- all T cell epitope linkers comprised in the antigenic unit are identical. If, however, one or more of the T cell epitopes or groups of T cell epitopes comprise a sequence similar to that of the linker, it may be an advantage to substitute the neighboring T cell epitope linker with a linker of a different sequence. Also, if a T cell epitope/linker junction is predicted to constitute an epitope in itself, then it is preferred to use a T cell epitope linker of a different sequence.
- the antigenic unit comprises several different T cell epitope linkers, such as 2, 3, 4 or 5 different T cell epitope linkers.
- the T cell epitope linker is a flexible linker, preferably a flexible linker which comprises small, non-polar (e.g. glycine, alanine or leucine) or polar (e g. serine or threonine) amino acids.
- small, non-polar (e.g. glycine, alanine or leucine) or polar (e g. serine or threonine) amino acids The small size of these amino acids provides flexibility and allows for mobility of the connected amino acid sequences.
- the incorporation of serine or threonine can maintain the stability of the linker in aqueous solutions by forming hydrogen bonds with the water molecules, and therefore reduces the unfavorable interaction between the linker and antigens.
- the flexible linker is a serine (S) and/or glycine (G) rich linker, i.e. a linker comprising several serine and/or several glycine residues.
- n is an integer from 1 to 5, e.g., 1, 2, 3, 4, or 5. In some embodiments, m is 2.
- the T cell epitope linker is a serine (S) and/or glycine (G) rich linker, i.e. a linker comprising several serine and/or several glycine residues.
- GGGGS SEQ ID NO: 186
- GGGSS SEQ ID NO: 187
- GGGSG SEQ ID NO: 188
- GGSGG SEQ ID NO: 189
- SGSSGS SEQ ID NO: 190
- multiple variants thereof such as GGGGSGGGGS (SEQ ID NO: 191), (GGGGS)m (SEQ ID NO: 192), (GGGSS)m (SEQ ID NO: 193), (GGSGG)m (SEQ ID NO: 194), (GGGSG)m (SEQ ID NO: 195) or (SGSSGS)m (SEQ ID NO: 196).
- the serine and/or glycine rich linker further comprises at least one leucine (L) residue, such as at least 1 or at least 2 or at least 3 leucine residues, e g. 1, 2, 3 or 4 leucine residues.
- L leucine
- the T cell epitope linker comprises or consists of LGGGS (SEQ ID NO: 197), GLGGS (SEQ ID NO: 198), GGLGS (SEQ ID NO: 199), GGGLS (SEQ ID NO: 200) or GGGGL (SEQ ID NO: 201).
- the linker comprises or consists of LGGSG (SEQ ID NO: 202), GLGSG (SEQ ID NO: 203), GGLSG (SEQ ID NO: 204), GGGLG (SEQ ID NO: 205) or GGGSL (SEQ ID NO: 206).
- the linker comprises or consists of LGGSS (SEQ ID NO: 207), GLGSS (SEQ ID NO: 208) or GGLSS (SEQ ID NO: 209).
- the T cell epitope linker comprises or consists of LGLGS (SEQ ID NO: 210), GLGLS (SEQ ID NO: 211), GLLGS (SEQ ID NO: 212), LGGLS (SEQ ID NO: 213) or GLGGL (SEQ ID NO: 214).
- the linker comprises or consists of LGLSG (SEQ ID NO: 215), GLLSG (SEQ ID NO: 216), GGLSL (SEQ ID NO: 217), GGLLG (SEQ ID NO: 218) or GLGSL (SEQ ID NO: 219).
- the linker comprises or consists of LGLSS (SEQ ID NO: 220), or GGLLS (SEQ ID NO: 221)
- the T cell epitope linker is serine-glycine linker that has a length of 10 amino acids and comprises 1 or 2 leucine residues.
- the T cell epitope linker comprises or consists of LGGGSGGGGS (SEQ ID NO: 222), GLGGSGGGGS (SEQ ID NO: 223), GGLGSGGGGS (SEQ ID NO: 224), GGGLSGGGGS (SEQ ID NO: 225) or GGGGLGGGGS (SEQ ID NO: 226).
- the linker comprises or consists of LGGSGGGGSG (SEQ ID NO: 227), GLGSGGGGSG (SEQ ID NO: 228), GGLSGGGGSG (SEQ ID NO: 229), GGGLGGGGSG (SEQ ID NO: 230) or GGGSLGGGSG (SEQ ID NO: 231).
- the linker comprises or consists of LGGSSGGGSS (SEQ ID NO: 232), GLGSSGGGSS (SEQ ID NO: 233), GGLSSGGGSS (SEQ ID NO: 234), GGGLSGGGSS (SEQ ID NO: 235) or GGGSLGGGSS (SEQ ID NO: 236).
- the T cell epitope linker comprises or consists of LGGGSLGGGS (SEQ ID NO: 237), GLGGSGLGGS (SEQ ID NO: 238), GGLGSGGLGS (SEQ ID NO: 239), GGGLSGGGLS (SEQ ID NO: 240) or GGGGLGGGGL (SEQ ID NO: 241).
- the linker comprises or consists of LGGSGLGGSG (SEQ ID NO: 242), GLGSGGLGSG (SEQ ID NO: 243), GGLSGGGLSG (SEQ ID NO: 244), GGGLGGGGLG (SEQ ID NO: 245) or GGGSLGGGSL (SEQ ID NO: 246).
- the linker comprises or consists of LGGSSLGGSS (SEQ ID NO: 247), GLGSSGLGSS (SEQ ID NO: 248) or GGLSSGGLSS (SEQ ID NO: 249).
- the T cell epitope linker comprises or consists of GSGGGA (SEQ ID NO: 250), GSGGGAGSGGGA (SEQ ID NO: 251), GSGGGAGSGGGAGSGGGA (SEQ ID NO: 252),
- the linker comprises or consists of SGGGSSGGGS (SEQ ID NO: 255), SSGGGSSGGG (SEQ ID NO: 256), GGSGGGGSGG (SEQ ID NO: 257), GSGSGSGSGS (SEQ ID NO: 258), GGGSSGGGSG (SEQ ID NO: 259), GGGSSS (SEQ ID NO: 260), GGGSSGGGSSGGGSS (SEQ ID NO: 261) or GLGGLAAA (SEQ ID NO: 262).
- the linker is a rigid linker. Such rigid linkers may be useful to efficiently separate (larger) antigens and prevent their interferences with each other.
- the linker comprises or consist of KPEPKP PAPKP (SEQ ID NO: 263), AEAAAKEAAAKA (SEQ ID NO: 264), (EAAAK)m (SEQ ID NO: 265), PSRLEEELRRRLTEP (SEQ ID NO: 266) or SACYCELS (SEQ ID NO: 267).
- the linker comprises or consists of TQKSLSLSPGKGLGGL (SEQ ID NO: 268).
- the inker comprises or consists of SLSLSPGKGLGGL (SEQ ID NO: 269).
- the linker comprises or consists of GGSAGGSGSGSSGGSSGASGTGTAGGTGSGSGTGSG (SEQ ID NO: 270); or GGSGGGSEGGGSEGGGSEGGGSEGGGSEGGGSGGGS (SEQ ID NO: 271) or ELKTPLGDTTHT (SEQ ID NO: 272) or EPKSCDTPPPCPRCP (SEQ ID NO: 273).
- T cell epitope linkers are disclosed in paragraphs [0098]-[0099] and in the recited sequences of WO 2020/176797A1, which is incorporated herein by reference and in paragraphs [0135] to [0139] of US 2019/0022202A1, which is incorporated herein by reference.
- T cell epitopes disclosed herein were identified with the help of advanced bioinformatics workflows.
- the validation of the immunogenicity of in silica predicted T cell epitopes is normally performed using cellular immune response assays that require live T cells and are limited in sensitivity and throughput.
- co-applicant Adaptive Biotechnologies Corporation used its proprietary MIRA® (Multiplexed Assay for Identification of Receptor Antigen-specificity) (Klinger et al., 2015) and blood samples from individuals diagnosed with COVID-19 to map T cell receptors (TCRs) to more than 500 Class I and Class II peptides derived from all 11 open reading frames (ORFs) of SARS-CoV-2.
- Adaptive also used transgene constructs covering these SARS-CoV-2 ORFs.
- hypothesized HLA restrictions for the identified immune-dominant epitopes were determined using meta-analysis of Adaptive’s MIRA data (Snyder et al., 2020). More specifically, for each MIRA experiment run, the number of unique T cell lineages responding to epitopes across the SARS-CoV-2 genome were defined in hundreds of assayed individuals. In addition to these T cell readouts, HLA typing of donor material was performed to 4 digit precision, which allowed for the assessment of putative HLA- restrictions of the measured T cell response by searching for alleles correlated with increased yields of antigen specific TCRs.
- a case-control immune sequencing cohort of several thousand individuals was used to identify shared, public T cell receptors associated with SARS-CoV-2 infection.
- a set of “enhanced sequences” was defined which represented the TCRb sequences enriched in cases and not in controls using Fisher’s exact test.
- These enhanced sequences should comprise receptors that are both highly public and likely to be SARS-CoV-2 specific and have been validated together as a tool for monitoring recent or past infection (Dalai et al., 2021).
- an overlap analysis between these enhanced sequences and the MIRA data was performed to pinpoint the antigen specificity of these SARS-CoV-2 associated receptors.
- the epitopes with the largest number of overlapping enhanced sequences were prioritized for inclusion in the immunogenic constructs and compositions of the invention because of their ability to produce highly public T cell responses, which correspond to HLA prevalence.
- the immunogenic construct and compositions according to the invention therefore comprise a unique and large set of SARS-CoV-2 T cell epitopes which have been validated to induce strong T cell responses in humans.
- T cell vaccine candidates have been developed and tested in various mouse models. These were able to induce specific cellular immunity to the SARS-CoV-2 T cell epitopes in humanized transgenic mice HLA-DR mice (Meyers et al., 2021), HLA-A2.1 mice (Gauttier et al., 2020) and CD34 mice (Somogyi et al., 2020) and in BALB/c mice (Gritstone COVID- 19 Vaccine Technical Information, 2021). Further, several of these T cell vaccine candidates have progressed to clinical development or are close to trial initiation. Compared to these, the immunogenic constructs and vaccines according to the invention have a unique and larger set of SARS-CoV-2 T cell epitopes which also have been previously validated to induce strong T cell responses in humans.
- Preferred antigenic units are those having an amino acid sequence having at least 73% sequence identity with SEQ ID Nos 161-167.
- the antigenic unit comprises an amino acid sequence having at least 73% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167.
- the antigenic unit comprises an amino acid sequence having at least 73% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167, such as at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99%.
- SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167 such as at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%
- the 77 SARS-CoV-2 T cell epitopes have the amino acid sequences of SEQ ID NOs: 1-77.
- the antigenic unit comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167.
- the antigenic unit consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167.
- the construct of the invention comprises a targeting unit that targets antigen presenting cells (APCs), which include dendritic cells (DCs) and subsets thereof.
- APCs antigen presenting cells
- DCs dendritic cells
- targeting unit refers to a unit that delivers the construct as disclosed herein to an antigen-presenting cell for MHC class Il-restricted presentation to CD4+ T cells or for providing cross presentation to CD8+ T cells by MHC class I restriction.
- the construct disclosed herein attracts DCs, neutrophils and other immune cells.
- the construct will not only target the antigenic unit comprised therein to specific cells, but in addition facilitate a response-amplifying effect (adjuvant effect) by recruiting specific immune cells to the administration site of a vaccine comprising the construct.
- adjuvant effect a response-amplifying effect
- the targeting unit is designed to target the construct of the invention to surface molecules expressed on the APCs, such as molecules expressed exclusively on subsets ofDCs.
- Chemokine receptors include C-C motif chemokine receptor 1
- CCR1 C-C motif chemokine receptor 3 (CCR3), C-C motif chemokine receptor 4
- CCR4 C-C motif chemokine receptor 5 (CCR5), C-C motif chemokine receptor 6
- CCR6 C-C motif chemokine receptor 7 (CCR7), C-C motif chemokine receptor 8
- Toll-like receptors include TLR-2, TLR-4 and TLR-5.
- the targeting unit is or comprises a moiety that interacts with these surface molecules.
- the targeting unit comprises or consists of an antibodybinding region, such as the antibody variable domains (VL and VH), with specificity for MHC/HLA, CD 14, CD40, CLEC9A or Toll-like receptors, preferably with specificity for human (h) CD 14, hCD40, hCLEC9A or human Toll-like receptors.
- the targeting unit comprises or consists of a synthetic or natural ligand. Examples include soluble CD40 ligand (CD40L), preferably hCD40L, natural ligands like chemokines, preferably such as in their human forms, e.g.
- chemokine ligand 5 also called C-C motif ligand 5 (CCL5 or RANTES), preferably hCCL5, such as hCCL5 with SEQ ID NO: 43, macrophage inflammatory protein alpha and its isoforms, including mouse CCL3 (or MIP-la), and human isoforms hCCL3, hCCL3Ll, hCCL3L2 and hCCL3L3, chemokine ligand 4 (CCL4) and its isoform CCL4L, preferably hCCL4 and hCCL4L, chemokine ligand 19 (CCL19), preferably hCCL19, chemokine ligand 20 (CCL20), preferably hCCL20, chemokine ligand 21 (CCL21), preferably hCCL21, chemokine motif ligand 1 or 2 (XCL1 or XCL2), preferably hXCLl or hXCL2, and bacterial antigens like for example flag
- the targeting unit has affinity for an MHC class II protein.
- the targeting unit comprises or consists of an antibody-binding region, such as the antibody variable domains (VL and VH), with specificity for MHC class II proteins selected from the group consisting of anti-HLA-DP, anti-HLA-DR and anti-pan HLA class II.
- VL and VH antibody variable domains
- the targeting unit has affinity for a surface molecule selected from the group consisting of CD14, CD40, TLR-2, TLR-4 and TLR-5, preferably affinity for a surface molecule selected from the group consisting of hCD14, hCD40, hTLR-2, hTLR-4 and hTLR-5.
- the targeting unit comprises or consist of an antibody-binding region, such as the antibody variable domains (VL and VH), with specificity for CD14, CD40, TLR-2, TLR-4 or TLR-5, such as anti-CD14, anti-CD40, anti- TLR-2, anti-TLR-4 or anti-TLR-5, preferably with specificity for hCD14, hCD40, hTLR-2, hTLR-4 or hTLR-5, such as anti-hCD14, anti- hCD40, anti-hTLR-2, anti-hTLR-4 or anti-hTLR-5.
- VL and VH antibody variable domains
- the targeting unit comprises or consists of flagellin, which has affinity for TLR-5, such as hTLR-5.
- the targeting unit comprises or consists of an antibody-binding region with specificity for CLEC9A, such as anti-CLEC9A or variants thereof, such as anti-CLEC9A Fv or the targeting unit comprises or consists of a CLEC9 ligand, e.g. a CLEC9 ligand comprising or consisting of the nucleic acid sequence with SEQ ID NO: 274 or an amino acid sequence encoded by said nucleic acid sequence.
- the targeting unit comprises or consists of an antibody-binding region with specificity for hCLEC9A, such as anti-hCLEC9A or variants thereof, such as anti-hCLEC9A Fv or the targeting unit comprises or consists of a human CLEC9 ligand.
- the targeting unit has affinity for a chemokine receptor selected from CCR1, CCR3, CCR5 and CCR7, more preferably for a chemokine receptor selected from CCR1, CCR3 and CCR5.
- the targeting unit has affinity for a chemokine receptor selected from hCCRl, hCCR3, hCCR5 and hCCR7, more preferably for a chemokine receptor selected from hCCRl, hCCR3 and hCCR5.
- the targeting unit has affinity for the chemokine receptor CCR7, preferably for the human chemokine receptor CCR7.
- the targeting unit comprises or consists of CCL19, such as CCL19 comprising or consisting of a nucleotide sequence of SEQ ID NO: 275 or an amino acid sequence encoded by said nucleotide sequence, or CCL21, such as the human forms of CCL19 or CCL21.
- the targeting comprises or consists of chemokine human macrophage inflammatory protein alpha (human MIP-la (hMIP-la) variant, also called LD78P or CCL3L1), which binds to its cognate receptors, including CCR1, CCR3 and CCR5, expressed on the cell surface of APCs.
- chemokine human macrophage inflammatory protein alpha human MIP-la (hMIP-la) variant, also called LD78P or CCL3L1
- the binding of the targeting unit to its cognate receptors leads to internalization of the multimeric protein into the APC and degradation of the protein into small peptides that are loaded onto MHC molecules and presented to CD4+ and CD8+ T cells to induce specific immune responses.
- CD8+ T cells will target and kill cells expressing the same antigens, e.g. cancer cells expression such same antigens
- the targeting unit comprises an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168. In a further preferred embodiment, the targeting unit comprises an amino acid sequence having at least 85% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity. In yet a further preferred embodiment, the targeting unit comprises the amino acid sequence 26 to 93 of SEQ ID NO: 168 or comprises the amino acid sequence 24-93 of SEQ ID NO: 168.
- the targeting unit consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168.
- the targeting unit consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity.
- the targeting unit has the amino acid sequence 26 to 93 of SEQ ID NO: 168 or has the amino acid sequence 24-93 of SEQ ID NO: 168.
- the targeting unit comprises or is anti-pan HLA class II
- the targeting unit comprises an amino acid sequence having at least 80% sequence identity to the amino acid sequence 20-260 of SEQ ID NO: 169.
- the targeting unit comprises an amino acid sequence having at least 85% sequence identity to the amino acid sequence 20-260 of SEQ ID NO: 169, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity.
- the targeting unit has the amino acid sequence 20-260 of SEQ ID NO: 169.
- the targeting unit consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 20-260 of SEQ ID NO: 169. In a further preferred embodiment, the targeting unit consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence 20-260 of SEQ ID NO: 169, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity. In yet another preferred embodiment, the targeting unit consists of the amino acid sequence 20-260 of SEQ ID NO: 169.
- the constructs of the invention comprise a multimerization unit, such as a dimerization unit.
- multimerization unit refers to a sequence of nucleotides or amino acids between the antigenic unit and the targeting unit which, in addition to connecting the antigenic unit and the targeting unit, facilitates multimerization of/joins multiple polypeptides, such as two, three, four or more polypeptides, into a multimeric protein, such as a dimeric protein, a trimeric protein or a tetrameric protein. Furthermore, the multimerization unit also provides flexibility in the multimeric protein to allow optimal binding of the targeting unit to the surface molecules on the APCs, even if they are located at variable distances.
- the multimerization unit may be any unit that fulfils one or more of these requirements.
- the multimerization unit is a trimerization unit, such as a collagen-derived trimerization unit, such as a human collagen-derived trimerization domain, such as human collagen XVIII-derived trimerization domain (see for instance A. Alvarez-Cienfuegos et al., Sci Rep 6, 28643 (2016)) or human collagen XV-derived trimerization domain.
- the multimerization unit is a trimerization unit that comprises or consists of the nucleic acid sequence of SEQ ID NO: 276, or an amino acid sequence encoded by said nucleic acid sequence.
- the trimerization unit is the C-terminal domain of T4 fibritin.
- the multimerization unit is a trimerization unit that comprises or consists of the amino acid sequence of SEQ ID NO: 277.
- the trimerization unit further comprises a hinge region as described below.
- the multimerization unit is a tetramerization unit, such as a domain derived from p53, optionally further comprising a hinge region as described below.
- the multimerization unit is a tetramerization unit that comprises or consists of the nucleic acid sequence of SEQ ID NO: 278, or an amino acid sequence encoded by said nucleic acid sequence, optionally further comprising a hinge region as described below.
- dimerization unit refers to a sequence of nucleotides or amino acids between the antigenic unit and the targeting unit.
- the dimerization unit facilitates dimerization of/joins two polypeptides into a dimeric protein.
- the dimerization unit also provides the flexibility in the dimeric protein to allow optimal binding of the targeting unit to the surface molecules on the APCs, even if they are located at variable distances.
- the dimerization unit may be any unit that fulfils these requirements.
- the construct of the invention comprises a dimerization unit comprising a hinge region.
- the dimerization unit comprises a hinge region and another domain that facilitates dimerization.
- the dimerization unit comprises a hinge region, a dimerization unit linker and another domain that facilitates dimerization, wherein the dimerization unit linker connects the hinge region to the other domain that facilitates dimerization.
- the dimerization unit linker is a glycineserine rich linker, preferably GGGSSGGGSG (SEQ ID NO: 259), i.e. the dimerization unit comprises a glycine-serine rich dimerization unit linker and preferably comprises the dimerization unit linker GGGSSGGGSG.
- the term "hinge region” refers to an amino acid sequence comprised in the dimerization unit that contributes to joining two of the polypeptides, i.e. facilitates the formation of a dimeric protein. Moreover, the hinge region functions as a flexible spacer, allowing the two targeting units of the dimeric protein to bind simultaneously to two surface molecules on APCs, even if they are located at variable distances.
- the term “hinge region” refers to an amino acid sequence comprised in such multimerization unit that contributes to joining more than two polypeptides, e.g. three or four polypeptides and/or functioning as a flexible spacer, allowing the multiple targeting units of the multimeric protein to bind simultaneously to multiple surface molecules on APCs, even if they are located at variable distances.
- the hinge region may be Ig derived, such as derived from IgG, e.g. IgGl or IgG2 or IgG3, such as derived from hlg, such as derived from human IgG, e.g. hlgGl or hIgG2 or hIgG3.
- the hinge region is derived from IgM, such as derived from human IgM.
- the hinge region comprises or consists of the nucleotide sequence with SEQ ID NO: 279 or an amino acid sequence encoded by said nucleic acid sequence.
- the hinge region may contribute to the dimerization through the formation of covalent bond(s), e.g. disulfide bridge(s) between cysteines.
- the hinge region has the ability to form one or more covalent bonds.
- the covalent bond is a disulfide bridge.
- the dimerization unit comprises or consists of a hinge exon hl and hinge exon h4 (human hinge region 1 and human hinge region 4), preferably hinge exon hl and hinge exon h4 from IgG3, more preferably having an amino acid sequence having at least 80 % sequence identity to the amino acid sequence 94-120 of SEQ ID NO: 168.
- the dimerization unit comprises or consists of a hinge exon hl and hinge exon h4 with an amino acid sequence having at least 85% sequence identity to the amino acid sequence 94-120 of SEQ ID NO: 168, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98% or such as at least 99% sequence identity.
- the dimerization unit comprises or consists of a hinge exon hl and hinge exon h4 with the amino acid sequence 94-120 of SEQ ID NO: 168.
- the dimerization unit comprises or consists of the amino acid sequence 94-120 of SEQ ID NO: 168, except that at the most four amino acids have been substituted, deleted or inserted, such as at the most three amino acids, such as at the most two amino acids or such as at the most one amino acid.
- the dimerization unit comprises or consists of a nucleic acid sequence having at least 80% sequence identity to the nucleic acid sequence of SEQ ID NO: 280.
- the dimerization unit comprises or consists of a nucleic acid sequence having at least 85% sequence identity to the nucleic acid sequence of SEQ ID NO: 280, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity.
- the dimerization unit comprises or consists of the nucleic acid sequence of SEQ ID NO: 280.
- the dimerization unit comprises another domain that facilitates dimerization
- said other domain is an immunoglobulin domain, such as an immunoglobulin constant domain (C domain), such as a CHI domain, a CH2 domain or a carboxyterminal C domain (i.e. a CH3 domain), or a sequence that is substantially identical to such C domains or a variant thereof.
- C domain immunoglobulin constant domain
- the other domain that facilitates dimerization is a carboxyterminal C domain derived from IgG, such as from human IgG3. More preferably, the other domain that facilitates dimerization is a carboxyterminal C domain derived from IgG3, such as from human IgG3.
- the dimerization unit comprises or consists of a carboxyterminal C domain derived from IgG3 with an amino acid sequence having at least 80 % sequence identity to the amino acid sequence 131-237 of SEQ ID NO: 168.
- the dimerization unit comprises or consists of a carb oxy terminal C domain derived from IgG3 with an amino acid sequence having at least 85% sequence identity to the amino acid sequence 131-237 of SEQ ID NO: 168, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98% or such as at least 99% sequence identity.
- the dimerization unit comprises or consists of a carboxyterminal C domain derived from IgG3 with the amino acid sequence 131-237 of SEQ ID NO: 168.
- the dimerization unit comprises or consists of the amino acid sequence 131-237 of SEQ ID NO: 168, except that at the most 16 amino acids have been substituted, deleted or inserted, such as at the most 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid.
- the dimerization unit comprises or consists of a nucleic acid sequence having at least 80% sequence identity to the nucleic acid sequence of SEQ ID NO: 281.
- the dimerization unit comprises or consists of a nucleic acid sequence having at least 85% sequence identity to the nucleic acid sequence of SEQ ID NO: 281, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity.
- the dimerization unit comprises or consists of the nucleic acid sequence of SEQ ID NO: 281.
- the immunoglobulin domain contributes to dimerization through non-covalent interactions, e g. hydrophobic interactions.
- the immunoglobulin domain has the ability to form dimers via noncovalent interactions.
- the noncovalent interactions are hydrophobic interactions.
- the dimerization unit comprises a CH3 domain, it does not comprise a CH2 domain and vice versa.
- the dimerization unit comprises a hinge exon hl, a hinge exon h4, a dimerization unit linker and a CH3 domain of human IgG3.
- the dimerization unit comprises a polypeptide consisting of hinge exon hl, hinge exon h4, a dimerization unit linker and a CH3 domain of human IgG3.
- the dimerization unit consists of a polypeptide consisting of hinge exon hl, hinge exon h4, a dimerization unit linker and a CH3 domain of human IgG3.
- the dimerization unit linker is a glycine-serine rich linker, preferably GGGSSGGGSG, i.e. the dimerization unit comprises a glycine-serine rich dimerization unit linker and preferably the dimerization unit linker GGGSSGGGSG.
- the dimerization unit comprises an amino acid sequence having at least 80 % sequence identity to the amino acid sequence of 94-237 of SEQ ID NO: 168.
- the dimerization unit comprises an amino acid sequence having at least 85% sequence identity to the amino acid sequence 94-237 of SEQ ID NO: 168, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98% or such as at least 99% sequence identity.
- the dimerization unit consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 94-237 of SEQ ID NO: 168, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98% or such as at least 99%.
- the dimerization unit consists of the amino acid sequence 94-237 of SEQ ID NO: 168.
- the dimerization unit comprises or consists of the amino acid sequence 94-237 of SEQ ID NO: 168, except that at the most 28 amino acids have been substituted, deleted or inserted, such as at the most 25, 20, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acids.
- the dimerization unit comprises or consists of a nucleic acid sequence having at least 80% sequence identity to the nucleic acid sequence of SEQ ID NO: 282.
- the dimerization unit comprises or consists of a nucleic acid sequence having at least 85% sequence identity to the nucleic acid sequence of SEQ ID NO: 282, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity.
- the dimerization unit comprises or consists of the nucleic acid sequence of SEQ ID NO: 282
- constructs disclosed herein comprise a unit linker.
- the antigenic unit is connected to the targeting unit or multimerization unit by a unit linker.
- constructs disclosed herein comprise a unit linker that connects the antigenic unit to the targeting unit or the multimerization unit.
- the unit linker is a non-immunogenic linker and/or flexible or rigid linker.
- the unit linker may comprise a restriction site in order to facilitate the construction of the first nucleic acid sequence.
- the unit linker is GLGGL (SEQ ID NO: 214) or GLSGL (SEQ ID NO: 283).
- the unit linker comprises or consists of GGGGS (SEQ ID NO: 186), GGGGSGGGGS (SEQ ID NO: 191), (GGGGS)m (SEQ ID NO: 192), EAAAK (SEQ ID NO: 284), (EAAAK)m (SEQ ID NO: 265), (EAAAK)mGS (SEQ ID NO: 285), (EAAK)mGS (SEQ ID NO: 286), GPSRLEEELRRRLTEPG (SEQ ID NO: 287), AAY or HEYGAEALERAG (SEQ ID NO: 288).
- m is an integer from 1 to 5, e.g., 1, 2, 3, 4, or 5. In some embodiments, m is 2. Signal peptide
- the construct of the invention is a polynucleotide which comprises a nucleotide sequence which further encodes a signal peptide.
- the signal peptide is either located at the N-terminal end of the targeting unit or the C-terminal end of the targeting unit, depending on the orientation of the targeting unit in the polypeptide ( Figure. 1).
- the signal peptide is designed to allow secretion of the polypeptide encoded by the nucleic acid comprised in the polynucleotide from cells transfected with said polynucleotide.
- the signal peptide is that which is naturally present at the N- terminus of any of the targeting units described herein (also called the natural leader sequence).
- any suitable signal peptide may be used.
- suitable peptides are an Ig VH signal peptide, preferably a human Ig VH signal peptide, a human TPA signal peptide, such as SEQ ID NO: 170 and a human MIPl-a signal peptide.
- the polynucleotide comprises a nucleotide sequence encoding a human MIPl-a signal peptide and preferably comprises a nucleotide sequence encoding a human MIPl-a targeting unit.
- the polynucleotide comprises a nucleotide sequence encoding a signal peptide that comprises an amino acid sequence having at least 85% sequence identity to the amino acid sequence 1-23 of SEQ ID NO: 168, such as at least
- 94% such as at least 95%, such as at least 96%, such as at least 97%, such as at least
- polynucleotide comprises a nucleotide sequence encoding a signal peptide that comprises the amino acid sequence 1-23 of SEQ ID NO: 168.
- the polynucleotide comprises a nucleotide sequence encoding a signal peptide that consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 1-23 of SEQ ID NO: 168, preferably at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98% or such as at least 99%.
- the polynucleotide comprises a nucleotide sequence encoding a signal peptide with the amino acid sequence 1-23 of SEQ ID NO: 168.
- the polynucleotide comprises a nucleotide sequence encoding an Ig VH signal peptide and preferably comprises a nucleotide sequence encoding an anti-pan HLA class II targeting unit.
- polynucleotide comprises a nucleotide sequence encoding a signal peptide that comprises an amino acid sequence having at least 85% sequence identity to the amino acid sequence 1-19 of SEQ ID NO: 169, such as at least
- 94% such as at least 95%, such as at least 96%, such as at least 97%, such as at least
- polynucleotide comprises a nucleotide sequence encoding a signal peptide that comprises the amino acid sequence 1-19 of SEQ ID NO: 169.
- the polynucleotide comprises a nucleotide sequence encoding a signal peptide that consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 1-19 of SEQ ID NO: 169, preferably at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98% or such as at least 99%.
- the polynucleotide comprises a nucleotide sequence encoding a signal peptide with the amino acid sequence 1-19 of SEQ ID NO: 169.
- Preferred immunogenic constructs are described below.
- Preferred immunogenic constructs are those comprising the following units:
- the targeting unit comprises an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168.
- the targeting unit comprises an amino acid sequence having at least 85% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity.
- the targeting unit comprises the amino acid sequence 24-93 of SEQ ID NO: 168 or comprises the amino acid sequence 26-93 of SEQ ID NO: 168.
- the targeting unit consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168.
- the targeting unit consists of an amino acid sequence having at least 85% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity.
- the targeting unit consists of the amino acid sequence 24-93 of SEQ ID NO: 168 or consists of the amino acid sequence 26-93 of SEQ ID NO: 168.
- the dimerization unit comprises an amino acid sequence having at least 80 % sequence identity to the amino acid sequence of 94-237 of SEQ ID NO: 168.
- the dimerization unit comprises an amino acid sequence having at least 85% sequence identity to the amino acid sequence 94-237 of SEQ ID NO: 168, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98% or such as at least 99% sequence identity.
- the dimerization unit comprises the amino acid sequence 94-237 of SEQ ID NO: 168.
- the dimerization unit consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 94-237 of SEQ ID NO: 168, such as at least 85%, such as at least 86%, such as at least 87%, such as at least 88%, such as at least 89%, such as at least 90%, such as at least 91%, such as at least 92%, such as at least 93%, such as at least 94%, such as at least 95%, such as at least 96%, such as at least 97%, such as at least 98% or such as at least 99%.
- the dimerization unit consists of the amino acid sequence 94-237 of SEQ ID NO: 168.
- the following embodiments are preferred embodiments of the antigenic unit either as comprised in the immunogenic constructs or on its own (for prophylactic or therapeutic use, in a pharmaceutical composition); i.e. without the targeting unit and the multimerization unit, such as dimerization unit, being present.
- the antigenic unit comprises an amino acid sequence having at least 80% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167.
- the antigenic unit comprises an amino acid sequence having at least 85% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity.
- the antigenic unit comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167.
- the antigenic unit consists of an amino acid sequence having at least 80% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167.
- the antigenic unit consists of an amino acid sequence having at least 85% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167, such as at least 86% or at least 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or at least 99% sequence identity.
- the antigenic unit has an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167.
- the immunogenic constructs is a polypeptide that has an amino acid sequence selected from the group consisting of SEQ ID NOs: 171, 172, 173, 174, 175, 176 and 177 or a dimeric protein consisting of two such polypeptides.
- the immunogenic construct is a polynucleotide comprising a nucleotide sequence encoding a polypeptide that has an amino acid sequence selected from the group consisting of SEQ ID NOs: 178, 179, 180, 181, 182, 183 and 184.
- the immunogenic construct is a polypeptide that has the amino acid sequence of SEQ ID NO: 177 or a dimeric protein consisting of two such polypeptides.
- the immunogenic construct is a polynucleotide comprising a nucleotide sequence encoding a polypeptide that has the amino acid sequence of SEQ ID NO: 184.
- the immunogenic construct is a polynucleotide comprising the nucleotide sequence of SEQ ID NO: 185.
- Sequence identity may be determined as follows: A high level of sequence identity indicates likelihood that a second sequence is derived from a first sequence. Amino acid sequence identity requires identical amino acid sequences between two aligned sequences. Thus, a candidate sequence sharing 70% amino acid identity with a reference sequence requires that, following alignment, 70% of the amino acids in the candidate sequence are identical to the corresponding amino acids in the reference sequence. Identity may be determined by aid of computer analysis, such as, without limitations, the ClustalW computer alignment program (Higgins D., Thompson J., Gibson T., Thompson J.D., Higgins D.G., Gibson T.J., 1994. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res.
- the ClustalW algorithm may similarly be used to align nucleotide sequences. Sequence identities may be calculated in a similar way as indicated for amino acid sequences.
- Another preferred mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, CABIOS (1989). Such an algorithm is incorporated into the ALIGN program (version 2.0) which is part of the FASTA sequence alignment software package (Pearson WR, Methods Mol Biol, 2000, 132: 185-219). Align calculates sequence identities based on a global alignment. AlignO does not penalize to gaps in the end of the sequences. When utilizing the ALIGN and AlignO program for comparing amino acid sequences, a BLOSUM50 substitution matrix with gap opening/extension penalties of-12/-2 is preferably used.
- the construct of the invention may be in the form of the polynucleotide as described herein.
- a further aspect of the invention is a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit such as dimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77.
- Yet another further aspect of the invention is a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77
- the polynucleotide may be a DNA or an RNA, including genomic DNA, cDNA and mRNA, either double stranded or single stranded.
- the polynucleotide is a DNA.
- the polynucleotide is human codon optimized.
- the polynucleotide as described herein is comprises in a vector
- a further aspect of the disclosure is vector comprising a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit such as dimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77.
- Yet another further aspect of the disclosure is a vector comprising a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77.
- the vector may be any molecule which is suitable to deliver foreign nucleic acid sequences, such as DNA or RNA, into a cell (in vitro or in vivo) where they are expressed, i.e. expression vectors.
- the vector is a DNA vector, such as a DNA plasmid or a DNA viral vector, such as a DNA viral vector selected from the group consisting of adenovirus, vaccinia virus, adeno-associated virus, cytomegalovirus and Sendai virus.
- the vector is an RNA vector, such as an RNA plasmid or an RNA viral vector, such as a retroviral vector, e.g. a retroviral vector selected from the group consisting of alphavirus, lentivirus, Moloney murine leukemia virus and rhabdovirus.
- RNA vector such as an RNA plasmid or an RNA viral vector, such as a retroviral vector, e.g. a retroviral vector selected from the group consisting of alphavirus, lentivirus, Moloney murine leukemia virus and rhabdovirus.
- the vector is a DNA plasmid and the polynucleotide is a DNA.
- the above-described vector is a polycistronic vector that allows the expression of the polypeptide or antigenic unit disclosed herein and, in addition, the expression of one or more immunostimulatory compounds, as separate molecules.
- a further aspect of the disclosure is a vector comprising:
- A a polynucleotide comprising a nucleotide sequence encoding a polypeptide comprising a targeting unit that targets antigen presenting cells, a multimerization unit such as dimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; and
- a yet further aspect of the disclosure is a vector comprising:
- A a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; and (B) one or more nucleic acid sequences encoding one or more immunostimulatory compounds, wherein the vector allows for the co-expression of the antigenic unit and the one or more immunostimulatory compounds as separate molecules.
- Polycistronic vectors comprising a polynucleotide comprising a nucleotide sequence encoding polypeptide that comprises a targeting unit, a multimerization unit such as a dimerization unit and an antigenic unit and one or more nucleic acid sequences encoding one or more immunostimulatory compounds, wherein the vector allows for the coexpression of the polypeptide and the one or more immunostimulatory compounds as separate molecules are disclosed by the applicant in PCT/EP2022/062665, the disclosure of which is hereby incorporated by reference.
- the polycistronic vector may be any molecule which is suitable to deliver foreign nucleic acid sequences, such as DNA or RNA, into a cell (in vitro or in vivo) where they are expressed, i.e. expression vectors.
- the polycistronic vector is a DNA vector, such as a DNA plasmid or a DNA viral vector, such as a DNA viral vector selected from the group consisting of adenovirus, vaccinia virus, adeno-associated virus, cytomegalovirus and Sendai virus.
- the polycistronic vector is an RNA vector, such as an RNA plasmid or an RNA viral vector, such as a retroviral vector, e.g. a retroviral vector selected from the group consisting of alphavirus, lentivirus, Moloney murine leukemia virus and rhabdovirus.
- RNA vector such as an RNA plasmid or an RNA viral vector, such as a retroviral vector, e.g. a retroviral vector selected from the group consisting of alphavirus, lentivirus, Moloney murine leukemia virus and rhabdovirus.
- the vector is a polycistronic DNA plasmid.
- the polycistronic vector of the disclosure will be illustrated discussing a plasmid, e.g. DNA plasmid (i.e. a polycistronic DNA plasmid), but it is understood that the discussion thereof applies also to other polycistronic vectors, e.g. viral vectors.
- polycistronic plasmids are known in the art, hence, the skilled person is able to design and construct the polycistronic plasmid of the disclosure.
- the polycistronic plasmid of the disclosure comprises one or more co-expression elements, i.e. nucleic acid sequences which allow co-expression of the polypeptide/antigenic unit and the one or more immunostimulatory compounds from the plasmid as separate molecules.
- the polycistronic plasmid comprises a co-expression element, which causes that the polypeptide/antigenic unit and the one or more immunostimulatory compounds are transcribed on a single transcript but independently translated. Hence, the presence of the co-expression element results in a final production of separate translation products.
- such co-expression element is an IRES element (internal ribosome entry site). In other embodiments, such co-expression element is a 2A selfcleaving peptide (2A peptide). Both co-expression elements are known in the art. If more than one immunostimulatory compound is expressed from the polycistronic plasmid of the disclosure, an IRES element and/or 2A peptide needs to be present in plasmid, e g. upstream of each nucleic acid sequence encoding an immunostimulatory compound.
- the polycistronic plasmid comprises a co-expression element which causes that the polypeptide/antigenic unit and the one or more immunostimulatory compounds are transcribed as separate transcripts, which results in separate transcription products and thus separate proteins.
- such co-expression element is a bidirectional promoter.
- such co-expression elements are various promotors, i.e. the polycistronic plasmid comprises a promoter for each of the nucleic acid sequences encoding either the polypeptide or the one or more immunostimulatory compounds. Both co-expression elements are known in the art.
- co-expression elements can be combined in any manner, i.e. the polycistronic plasmid of the disclosure may comprise one or several of such same or different co-expression elements.
- Immunostimulatory compounds i.e. the polycistronic plasmid of the disclosure may comprise one or several of such same or different co-expression elements.
- the polycistronic plasmid of the present disclosure comprises one or more nucleic acid sequences encoding one or more immunostimulatory compounds.
- the immunostimulatory compound is a compound that stimulates APCs and the stimulation results in e.g. attraction, activation, maturation and/or proliferation of APCs.
- the immunostimulatory compound is one that attracts APCs, preferably one that can interact with the following surface molecules on APCs: CCR1 (C-C motif chemokine receptor 1), CCR3 (C-C motif chemokine receptor 3), CCR4 (C- C motif chemokine receptor 4), CCR5 (C-C motif chemokine receptor 5), CCR6 (C-C motif chemokine receptor 6), CCR7 (C motif chemokine receptor 7), CCR8 (C motif chemokine receptor 8) or XCR1 (X-C motif chemokine receptor 1).
- CCR1 C-C motif chemokine receptor 1
- CCR3 C-C motif chemokine receptor 3
- CCR4 C- C motif chemokine receptor 4
- CCR5 C-C motif chemokine receptor 5
- CCR6 C-C motif chemokine receptor 6
- CCR7 C motif chemokine receptor 7
- CCR8 C motif chemokine receptor 8
- the immunostimulatory compound is selected from the list consisting of CCL4, CCL5, CCL19, CCL20, CCL21, XCL1 or XCL2
- the immunostimulatory compound is one that promotes activation and/or maturation of APCs.
- the immunostimulatory compound can interact with the following surface molecules on APCs: a receptor of the TNF receptor superfamily, including CD40 (cluster of differentiation 40), CD 137 (4- 1BB), CD27, ICOSL (CD275) or RANK.
- Such immunostimulatory compounds may be selected from the list consisting of CD40L (CD40 ligand, CD154), CD137L (4-1BBL, 4-1BB ligand), CD70, ICOS (CD278) or RANKL.
- the immunostimulatory compound is a cytokine selected from IL-2, IL-10, IL-12, TNFa and IFNy.
- the immunostimulatory compound can be an immune signaling molecule such as MyD88 and TRIF which activate through TLR receptors.
- the immunostimulatory compound can be a viral infection sensor such as for example RIG-1 and MDA-5.
- the immunostimulatory compound can interact with a pattern recognition receptor on APCs, e.g. a Toll-like receptor, including TLR2, TLR4 or TLR5.
- a pattern recognition receptor on APCs e.g. a Toll-like receptor, including TLR2, TLR4 or TLR5.
- Such immunostimulatory compounds may be selected from the list consisting of pathogen-associated molecular patterns (PAMPs), such as flagellin, or protein damage- associated molecular patterns (DAMPs), such as HMGB1, HSPs (heat-shock proteins), Calrecticulin and Annexin Al.
- PAMPs pathogen-associated molecular patterns
- DAMPs protein damage- associated molecular patterns
- PAMPs/DAMPs include those can be included as a nucleic acid sequence into the DNA plasmid of the disclosure and will be expressed as functional proteins that may comprise functional groups introduced by post-translational modifications.
- the aforementioned molecules in turn activate the following receptors on APCs: RAGE, TLR4, TLR9 and TIM-3 (for HMGB1), FPR (for Annexin Al), SREC1, LOX1 and CD91 (for HSP).
- the immunostimulatory compound is one that promotes growth and/or expansion of APCs.
- the immunostimulatory compound can interact with the following surface molecules on APCs: GM-CSF-receptor (granulocyte-macrophage colony-stimulating factor receptor, CD116), FLT-3R (fms like tyrosine kinase 3, CD135), IL-15R or IL-4R.
- the immunostimulatory compound is a growth factor, such as GM-CSF (granulocyte-macrophage colony- stimulating factor), FLT-3L, IL- 15 or IL-4.
- GM-CSF granulocyte-macrophage colony- stimulating factor
- FLT-3L IL- 15 or IL-4.
- the polycistronic vector comprises nucleic acid sequences encoding 2, 3, 4, 5, 6, 7 or 8 immunostimulatory compounds. In preferred embodiments, the polycistronic vector comprises nucleic acid sequences encoding 2 to 6 immunostimulatory compounds, i.e. 2 or 3 or 4 or 5 or 6 different immunostimulatory compounds.
- the immunostimulatory compounds may be the same or different, preferably different.
- the different immunostimulatory compounds also affect APCs differently in order to stimulate the immune system on many different levels and by that maximize the therapeutic or prophylactic effect of the construct of the disclosure.
- the polycistronic vector comprises nucleic acids encoding 2 different immunostimulatory compounds, with the first one being an immunostimulatory compound that promotes the growth of DCs (e.g. FLT-3L) and the second one being an immunostimulatory compound that promotes activation of DCs (e.g. CD40L).
- the vectors disclosed herein are generally suitable for transfecting a host cell for expression of a polypeptide/anti genic unit as disclosed herein and formation of a multimeric protein consisting of multiple of such polypeptides, such as formation of a dimeric protein consisting of two of such polypeptides, if a polypeptide is expressed.
- a further aspect of the disclosure is a host cell comprising a vector comprising a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit, such as dimerization unit, and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77.
- a host cell comprising a vector comprising a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77.
- the host cell which comprises the vector is a cell of a cell culture, e.g. a bacteria cell, and the polypeptide/antigenic unit encoded by the vector is expressed in vitro.
- the host cell which comprises the vector of the invention is a cell of a subject and the polypeptide/antigenic unit encoded by the vector is expressed in said subject, i.e. in vivo, as a result of the administration of the vector to the subject.
- Suitable host cells for in vitro transfection include prokaryote cells, yeast cells, insect cells or higher eukaryotic cells.
- Suitable host cells for in vivo transfection are e.g. human muscle cells.
- the vectors allows for easy exchange of the various units described above, particularly the antigenic unit.
- the vector is a pUMVC4a vector or a vector comprising NTC9385R vector backbones.
- the antigenic unit may be exchanged with an antigenic unit cassette restricted by the Sfil restriction enzyme cassette where the 5’ site is incorporated in the nucleotide sequence encoding a GLGGL (SEQ ID NO: 214) or GLSGL (SEQ ID NO: 283) unit linker and the 3’ site is included after the stop codon in the vector.
- vectors e.g. expression vectors such as DNA and RNA plasmids or viral vectors
- expression vectors such as DNA and RNA plasmids or viral vectors
- various commercial manufacturers offer services for vector design and production.
- the disclosure relates to a method of producing a vector comprising a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit, such as dimerization unit, and an antigenic unit, wherein the antigenic unit comprises at least 77 SAR.S-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77, the method comprising: a) transfecting cells in vitro with the vector; b) culturing said cells; c) optionally, lysing the cells to release the vector from the cells; and d) isolating and optionally purifying the vector.
- the disclosure relates to a method of producing a vector comprising a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77, the method comprising: a) transfecting cells in vitro with the vector; b) culturing said cells; c) optionally, lysing the cells to release the vector from the cells; and d) isolating and optionally purifying the vector.
- Polypeptides/ Antigenic unit comprising: a) transfecting cells in vitro with the vector; b) culturing said cells; c) optionally, lysing the cells to release the vector from the cells; and d) isolating and optionally purifying the vector.
- the construct of the invention may be in the form of a polypeptide encoded by the nucleotide sequence comprised in the polynucleotide as described herein.
- a further aspect of the invention is a polypeptide comprising a targeting unit that targets antigen presenting cells, a multimerization unit, such as dimerization unit, and an antigenic unit, wherein the antigenic unit comprises at least 77 SAR.S-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77.
- the polypeptide may be expressed in vitro for production of e.g. a pharmaceutical composition, such as vaccine, comprising such polypeptide.
- a pharmaceutical composition such as vaccine
- the polypeptide may be expressed in vivo as a result of the administration of the polynucleotide as described herein to a subject.
- the disclosure relates to an antigenic unit wherein the antigenic unit comprises at least 77 SAR.S-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77.
- the antigenic unit may be expressed in vitro for production of e.g. a pharmaceutical composition, such as vaccine, comprising such antigenic unit.
- the antigenic unit may be produced in vitro, e.g. by transfecting or transducing cells with a polynucleotide comprising a nucleotide sequence encoding antigenic unit such that the antigenic unit is expressed, culturing the cells, isolating the antigenic unit from the cells (which may mean isolating it from the cells in the cell medium, if the antigenic unit is secreted from the cells into the medium) and optionally purifying the antigenic unit.
- a further aspect of the invention is a method for preparing an antigenic unit comprising at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77, the method comprises: a) transfecting or transducing cells with a polynucleotide comprising a nucleotide sequence encoding the antigenic unit; b) culturing the cells; c) isolating the antigenic unit from the cells; and d) optionally purifying the antigenic unit.
- the antigenic unit may be expressed in vivo as a result of the administration of a polynucleotide encoding such antigenic unit as described herein to a subject.
- a further aspect of the invention is a multimeric protein consisting of multiple polypeptides, each of which comprises a targeting unit that targets antigen presenting cells, a multimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77
- the disclosure relates to a dimeric protein consisting of two polypeptides, each of which comprises a targeting unit, a dimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SAR.S-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77.
- the multimeric proteins may be homomultimers or hetereomultimers.
- the multimeric protein is a dimeric protein
- said dimeric protein may be a homodimer, i.e. a dimeric protein formed by two identical polypeptide molecules (which comprise identical units/elements).
- said dimeric protein may be a heterodimer formed by two different polypeptides, wherein e.g. polypeptide 1 and 2 comprise the same targeting units and dimerization units but each comprise different antigenic units.
- Heteromultimeric proteins can be produced by co-transfecting cells with 2 different vectors - one that comprises a polynucleotide that encodes a polypeptide 1 and another that comprises a polynucleotide that encodes a polypeptide 2 which is different from polypeptide 1 - and isolation of the heteromultimeric protein after the polypeptides are expressed and the heteromultimeric proteins are formed.
- Heteromultimeric proteins may be of relevance if the number of T cell epitopes for inclusion into the antigenic unit would exceed an upper size limit for the antigenic unit. It is preferred that the multimeric protein is a homomultimeric protein.
- the multimeric/dimeric protein may be prepared by expression of the polypeptide in vitro, e.g.
- transfecting or transducing cells with a polynucleotide comprising a nucleotide sequence encoding the polypeptide such that the polypeptide is expressed and forms the multimeric protein/dimeric protein, culturing the cells, isolating the multimeric protein/dimeric protein from the cells (which may mean isolating the protein from the cells in the cell medium, if the protein is secreted from the cells into the medium) and optionally purifying the protein.
- a further aspect of the invention is a method for preparing a multimeric protein, consisting of multiple polypeptides; each of which comprises a targeting unit that targets antigen presenting cells, a multimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77, the method comprises: a) transfecting or transducing cells with a polynucleotide comprising a nucleotide sequence encoding the polypeptide; b) culturing the cells; c) isolating the multimeric protein from the cells; and d) optionally purifying the multimeric protein.
- the method is for preparing a dimeric protein, consisting of two polypeptides; each of which comprises a targeting unit that targets antigen presenting cells, a dimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77, the method comprises: a) transfecting or transducing cells with a polynucleotide comprising a nucleotide sequence encoding the polypeptide; b) culturing the cells; c) isolating the dimeric protein from the cells; and d) optionally purifying the dimeric protein. Isolation of the polypeptide/multimeric protein and the optional purification can be carried out by methods known in the art, including precipitation, differential solubilization and chromatography.
- the polynucleotide may be comprised in a plasmid for transfection or a vector for transduction.
- the above-described multimeric/dimeric proteins may be used as the active ingredient in a protein vaccine for the prophylactic or therapeutic treatment of diseases caused by SARS-CoV-2
- the constructs i.e. polynucleotides, polypeptides/multimeric proteins
- antigenic units and vectors disclosed herein are for use as a medicament.
- compositions and vaccines are provided.
- the construct of the invention may be administered to a subject in the form of a pharmaceutical composition
- a pharmaceutical composition comprising the construct, e.g. the form of a polynucleotide, vector or multimeric protein, and pharmaceutically acceptable carrier, e.g. in the form of a vaccine.
- the antigenic unit as described herein may be administered to a subject in the form of a pharmaceutical composition
- a pharmaceutical composition comprising the antigenic unit, e.g. the form of a polynucleotide, vector or polypeptide, and pharmaceutically acceptable carrier, e.g. in the form of a vaccine.
- a “vaccine” as used herein is a pharmaceutical composition comprising the construct as disclosed herein and pharmaceutically acceptable carrier, which may further comprise excipients which are typical for vaccines.
- a further aspect of the invention is a vaccine comprising a pharmaceutically acceptable carrier and (i) a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit, such as dimerization unit, and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- a multimeric protein consisting of multiple polypeptides as defined in (ii), such as a dimeric protein consisting of two polypeptides as defined in (ii).
- a further aspect of the invention is a pharmaceutical composition
- a pharmaceutical composition comprising a pharmaceutically acceptable carrier and
- a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit, such as dimerization unit, and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- a multimeric protein consisting of multiple polypeptides as defined in (ii), such as a dimeric protein consisting of two polypeptides as defined in (ii).
- a further aspect of the invention is a vaccine comprising a pharmaceutically acceptable carrier and
- a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- a further aspect of the invention is a pharmaceutical composition
- a pharmaceutical composition comprising a pharmaceutically acceptable carrier and
- a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or (ii) a polypeptide encoded by the nucleic acid sequence defined in (i).
- Suitable pharmaceutically acceptable carriers include, but are not limited to, saline, buffered saline, such as PBS, dextrose, water, glycerol, ethanol, aqueous buffers, such as isotonic aqueous buffers or Tyrode’s buffer, and combinations thereof.
- the pharmaceutically acceptable carrier is an aqueous buffer.
- the aqueous buffer is Tyrode’s buffer, e.g. Tyrode’s buffer comprising 140 mM NaCl, 6 mM KC1, 3 mM CaC12, 2 mM MgC12, 10 mM 4-(2- hy droxy ethyl)- 1 -piperazineethanesulfonic acid (Hepes) pH 7.4, and 10 mM glucose.
- the pharmaceutical composition or vaccine may further comprise an adjuvant.
- vaccines comprising a multimeric protein or a polypeptide as described herein further comprise pharmaceutically acceptable adjuvants including, but are not limited to poly-ICLC, 1018 ISS, aluminum salts, Amplivax, AS 15, BCG, CP- 870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact EVI P321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PLGA microparticles, resiquimod, SRL172, virosomes and other virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cy
- the pharmaceutical compositions/vaccines may comprise molecules that facilitate the transfection/transduction of cells with the polynucleotide or vector, e.g. one or more transfection agents that facilitate the transfection of muscle cells of a subject.
- Transfection agents for polynucleotides are known in the art and include positively charged molecules that interact with negatively charged molecules like DNA or RNA and form a positively charged transfection agent-DNA or transfection agent-RNA complex. Such complexes can interact with negatively charged cell membranes which enables the uptake of the complexes and thus the delivery of the DNA or RNA into the cell. If the polynucleotide is RNA, e g.
- the RNA may be formulated in or with a lipid, nanoparticle, micelle, lipoplex nanoparticle (a particle having a diameter making the particle suitable for systemic, in particular intravenous administration, typically having a diameter of less than 1000 nanometers, which is composed of a combination of different lipids) or liposome, especially for intravenous administration.
- the lipoplex nanoparticle or liposome includes one or more lipids that form a multilamellar structure that encapsulates the RNA
- the one or more lipids includes at least one cationic lipid and at least one helper lipid.
- the one or more lipids includes (R)-N,N,N-trimethyl-2,3-dioleyloxy-l- propanaminium chloride (DOTMA) and 1,2- dioleoyl-sn-glycero-3 -phosphoethanolamine (DOPE).
- DOTMA 2,3-dioleyloxy-l- propanaminium chloride
- DOPE 1,2- dioleoyl-sn-glycero-3 -phosphoethanolamine
- mRNA molecules may also be formulated as naked mRNA molecules in a suitable injection buffer.
- the pharmaceutical composition/vaccine comprises a pharmaceutically acceptable amphiphilic block co-polymer comprising blocks of poly(ethylene oxide) and polypropylene oxide.
- an “amphiphilic block co-polymer” as used herein is a linear or branched co- polymer comprising or consisting of blocks of poly(ethylene oxide) (“PEO”) and blocks of polypropylene oxide) (“PPO”).
- PEO poly(ethylene oxide)
- PPO polypropylene oxide
- Typical examples of useful PEO-PPO amphiphilic block co-polymers have the general structures PEO-PPO-PEO (poloxamers), PPO PEO PPO, (PEO PPO-)4ED (a poloxamine), and (PPO PEO-)4ED (a reverse poloxamine), where "ED” is a ethyl enediaminyl group.
- a “poloxamer” is a linear amphiphilic block co-polymer constituted by one block of poly(ethylene oxide) coupled to one block of polypropylene oxide) coupled to one block of PEO, i.e. a structure of the formula EOa-POb-EOa, where EO is ethylene oxide, PO is propylene oxide, a is an integer from 2 to 130, and b is an integer from 15 to 67.
- Poloxamers are conventionally named by using a 3-digit identifier, where the first 2 digits multiplied by 100 provides the approximate molecular mass of the PPO content, and where the last digit multiplied by 10 indicates the approximate percentage of PEO content.
- Polyxamer 188 refers to a polymer comprising a PPO block of a molecular weight of about 1800 (corresponding to b being about 31 PPO) and approximately 80% (w/w) of PEO (corresponding to a being about 82).
- the values are known to vary to some degree, and commercial products such as the research grade Lutrol® F68 and the clinical grade Kolliphor® P188, which according to the producer's data sheets both are Pol oxamer 188, exhibit a large variation in molecular weight (between 7,680 and 9,510) and the values for a and b provided for these particular products are indicated to be approximately 79 and 28, respectively. This reflects the heterogeneous nature of the block co-polymers, meaning that the values of a and b are averages found in a final formulation.
- a “poloxamine” or “sequential poloxamine” (commercially available under the trade name of Tetronic®) is an X-shaped block co-polymers that bears four PEO-PPO arms connected to a central ethylenediamine moiety via bonds between the free OH groups comprised in the PEO-PPO-arms and the primary amine groups in ethylenediamine moiety.
- Reverse poloxamines are likewise X- shaped block co-polymers that bear four PPO-PEO arms connected to a central ethylenediamine moiety via bonds between the free OH groups comprised in the PPO-PEO arms and the primary amine groups in ethylenediamine.
- Preferred amphiphilic block co-polymers are poloxamers or poloxamines. Preferred are poloxamer 407 and 188, in particular poloxamer 188. Preferred poloxamines are sequential poloxamines of formula (PEO-PPO)4-ED. Particularly preferred poloxamines are those marketed under the registered trademarks Tetronic® 904, 704, and 304, respectively. The characteristics of these poloxamines are as follows: Tetronic® 904 has a total average molecular weight of 6700, a total average weight of PPO units of 4020, and a PEO percentage of about 40%.
- Tetronic® 704 has a total average molecular weight of 5500, a total average weight of PPO units of 3300, and a PEO percentage of about 40%; and Tetronic® 304 has a total average molecular weight of 1650, a total average weight of PPO units of 990, and a PEO percentage of about 40%.
- the pharmaceutical composition comprises the amphiphilic block co- polymer in an amount of from 0.2% w/v to 20% w/v, such as of from 0.2% w/v to 18% w/v, 0.2% w/v to 16% w/v, 0.2% w/v to 14% w/v, 0.2% w/v to 12% w/v, 0.2% w/v to 10% w/v, 0.2% w/v to 8% w/v, 0.2% w/v to 6% w/v, 0.2% w/v to 4% w/v, 0.4% w/v to 18% w/v, 0.6% w/v to 18% w/v, 0.8% w/v to 18% w/v, 1% w/v to 18% w/v, 2% w/v to 18% w/v, 1% w/v to 5% w/v, or 2% w/v to 4% w/v.
- the pharmaceutical composition comprises the amphiphilic block co- polymer in an amount of from 2% w/v to 5% w/v, such as about 3% w/v.
- the pharmaceutical composition/vaccine may be formulated in any way suitable for administration to a subject, e g. such as a liquid formulation for injection, e g. for intradermal or intramuscular injection.
- composition/vaccine may be administered in any way suitable for administration to a subject, such as administered by intradermal, intramuscular, or subcutaneous injection, or by mucosal or epithelial application, such as intranasal or oral
- the pharmaceutical composition/vaccine comprises a polynucleotide, e.g. comprised in a vector, and is administered by intramuscular or intradermal injection.
- the pharmaceutical composition/vaccine of the invention typically comprises the polynucleotide in a range of from 0.1 to 10 mg, e.g. about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9 or 1 mg or e.g. 2, 3, 4, 5, 6, 7, 8, 9 or 10 mg.
- the vaccine of the invention typically comprises the polypeptide/multimeric protein in the range of from 5 pg to 5 mg.
- the amount of polynucleotide/polypeptide/dimeric protein may vary depending on whether the pharmaceutical composition/vaccine is administered for prophylactic or therapeutic treatment, the severity of the disease in individuals which are infected, and parameters like the age, weight, gender, medical history and pre-existing conditions.
- Suitable methods for preparing the pharmaceutical composition/vaccine according to the invention are disclosed in WO 2004/076489A1, WO 20U/16I244A1, WO 2013/092875A1 and WO 2017/118695A1, which are incorporated herein by reference, and include preparing the polynucleotide, vector, polypeptide or multimeric protein by the methods described therein and mixing them with a pharmaceutically acceptable carrier and optionally further pharmaceutically acceptable excipients, like those described in the previous section herein.
- polynucleotide, vector, polypeptide or multimeric protein are dissolved in said pharmaceutically acceptable carrier.
- the pharmaceutical composition/vaccine of the invention may be used to treat diseases caused by SARS-CoV-2 and such treatment may either be for prophylactic or for therapeutic purpose.
- the pharmaceutical composition/vaccine is administered such that it induces an immunoprotective response (for a prophylactic treatment) or an immunotherapeutic response (for a therapeutic treatment) in the individual vaccinated with such vaccine/administered with such pharmaceutical composition.
- an immunoprotective response for a prophylactic treatment
- an immunotherapeutic response for a therapeutic treatment
- Such response is induced by either a single vaccination/administration or several vaccinations/administrations, e.g. an initial vaccination and one or several booster vaccinations, adequately spaced in time.
- the invention provides a method for treating a subject having a disease caused by SARS-CoV-2 or being in need of prevention of such disease, the method comprising administering to the subject a pharmaceutical composition/vaccine comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- the multimerization unit is a dimerization unit and the multimeric protein is a dimeric protein consisting of two polypeptides.
- the disclosure provides a method for treating a subject having a disease caused by SARS-CoV-2 or being in need of prevention of such disease, the method comprising administering to the subject a pharmaceutical composition/vaccine comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- composition/vaccine for use in the prophylactic or therapeutic treatment of a disease caused by SARS-CoV-2, the pharmaceutical composition/vaccine comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- the multimerization unit is a dimerization unit and the multimeric protein is a dimeric protein consisting of two polypeptides.
- the disclosure provides a pharmaceutical composition/vaccine for use in the prophylactic or therapeutic treatment of a disease caused by SARS-CoV-2, the pharmaceutical composition/vaccine comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or (ii) a polypeptide encoded by the nucleic acid sequence defined in (i).
- a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- the multimerization unit is a dimerization unit and the multimeric protein is a dimeric protein consisting of two polypeptides.
- a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- composition/vaccine for use in the prophylactic or therapeutic treatment of a disease caused by SARS-CoV-2 in a subject, wherein the pharmaceutical composition/vaccine comprises a pharmaceutically acceptable carrier and wherein said pharmaceutical composition/vaccine is administered to said subject.
- composition/vaccine comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- the multimerization unit is a dimerization unit and the multimeric protein is a dimeric protein consisting of two polypeptides.
- composition/vaccine comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77, or
- composition/vaccine comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- the multimerization unit is a dimerization unit and the multimeric protein is a dimeric protein consisting of two polypeptides.
- a pharmaceutical composition/vaccine comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- composition/vaccine comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- the multimerization unit is a dimerization unit and the multimeric protein is a dimeric protein consisting of two polypeptides.
- composition/vaccine comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- Also disclosed herein is a medicament for the treatment or prevention of a disease caused by SARS-CoV-2 in a subject having said disease or being in need of prevention of said disease by administering to the subject the medicament comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence encoding a targeting unit that targets antigen presenting cells, a multimerization unit and an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- the multimerization unit is a dimerization unit and the multimeric protein is a dimeric protein consisting of two polypeptides.
- Also disclosed herein is a medicament for the treatment or prevention of a disease caused by SARS-CoV-2 in a subject having said disease or being in need of prevention of said disease by administering to the subject the medicament comprising a pharmaceutically acceptable carrier and:
- a polynucleotide comprising a nucleotide sequence an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- the pharmaceutical composition/vaccine/medicament comprises the polynucleotide in a vector.
- said pharmaceutical composition/vaccine/medicament is preferably administered in a therapeutically effective or prophylactically effective amount.
- Such amount may be administered in one administration, i.e. one dose, or in several administrations, i.e. repetitive doses, i.e. in a series of doses, e.g. over the course of several days, weeks or months.
- the actual dose to be administered may vary and depend on whether the treatment is a prophylactic or therapeutic treatment, the age, weight, gender, medical history, preexisting conditions and general condition of the subject, the severity of the disease being treated and the judgment of the health care professionals.
- said pharmaceutical composition/vaccine/medicament may be administered in way as described herein, e.g. described in the section “pharmaceutical compositions/vaccines”.
- the method of treatment/use of the pharmaceutical composition/vaccine/medicament as disclosed herein can be continued for as long as the clinician overseeing the patient's care deems the method to be effective and the treatment to be needed.
- VB10.COV2 Seven DNA plasmid constructs (in the following, collectively also called VB10.COV2) were designed, produced and tested. All constructs comprise nucleic acid sequences encoding a human MIP-la (hMIP-la) targeting unit, (including its signal peptide), a dimerization unit comprising hinge exons 1 and 4 from IgG3 and the CH3 domain of human IgG3 (signal peptide, targeting unit and dimerization unit having the amino acid sequence of SEQ ID NO: 168) and an antigenic unit which comprises at least the 77 SARS CoV2 T cell epitopes with the amino acid sequences SEQ ID NOs: 1-77 listed in Table 1. Details for each of the constructs are as follows:
- VB2193 comprises a nucleic acid sequence encoding the antigenic unit of SEQ ID NO:
- VB2193 comprises a nucleic acid sequence encoding the polypeptide having the amino acid sequence of SEQ ID NO: 178.
- VB2194 comprises a nucleic acid sequence encoding the antigenic unit of SEQ ID NO:
- VB2194 comprises a nucleic acid sequence encoding the polypeptide having the amino acid sequence of SEQ ID NO: 179.
- VB2196 comprises a nucleic acid sequence encoding the antigenic unit of SEQ ID NO:
- VB2196 comprises a nucleic acid sequence encoding the polypeptide having the amino acid sequence of SEQ ID NO: 180.
- VB2197 comprises a nucleic acid sequence encoding the antigenic unit of SEQ ID NO:
- VB2197 comprises a nucleic acid sequence encoding the polypeptide having the amino acid sequence of SEQ ID NO: 181.
- VB2207 comprises a nucleic acid sequence encoding the antigenic unit of SEQ ID NO:
- VB2207 comprises a nucleic acid sequence encoding the polypeptide having the amino acid sequence of SEQ ID NO: 182.
- VB2208 comprises a nucleic acid encoding the antigenic unit of SEQ ID NO: 166), comprising the 141 T cell epitopes with the amino acid sequences SEQ ID NOs: 1-77 and 97-160, wherein the epitopes or groups of epitopes are separated by SGSSGS or GGSGG T cell epitope linkers.
- VB2208 comprises a nucleic acid sequence encoding the polypeptide having the amino acid sequence of SEQ ID NO: 183.
- VB2210 comprises a nucleic acid encoding the antigenic unit of SEQ ID NO: 167, comprising the 96 T cell epitopes with the amino acid sequences SEQ ID NOs: 1-196, wherein the epitopes or groups of epitopes are separated by GGSGG and SGSSGS T cell epitope linkers.
- VB2210 comprises a nucleic acid sequence encoding the polypeptide having the amino acid sequence of SEQ ID NO: 184.
- VB2210 comprises the nucleic acid sequence of SEQ ID NO: 185.
- the purpose of the study was to characterize the VB10.COV2 proteins post transient in vitro transfection of mammalian cells with the various VB10.COV2 DNA plasmids.
- the presence of functional VB10.COV2 proteins in the cell supernatant was verified by an ELISA assay by antibodies binding to the human MIP-la (targeting unit) and human IgG3 CH3-domain (dimerization unit, as capture antibody).
- HEK293 cells were purchased from ATCC and were transiently transfected with VB10.COV2 DNA. Briefly, 2xl0 5 cells/well were plated in 24-well tissue culture plates with 10% FBS growth medium and transfected with 1 pg VB10.COV2 DNA plasmid using Lipofectamine® 2000 reagent under the conditions suggested by the manufacturer (Invitrogen by Life Technologies). The transfected cells were then maintained for up to 6 days at 37°C with 5% C02 and the cell supernatant was harvested for characterization of the VB10.COV2 protein.
- the ELISA was performed to verify the amount of VB10.COV2 protein produced by the HEK293 cells and secreted into the cell supernatant. Briefly, MaxiSorp Nunc- immuno plates were coated with 1 pg/ml of anti-human IgG3 CH3 (MCA878G, BioRad) in lx PBS with 100 pl/well and plates were incubated overnight at 4°C. The microtiter wells were blocked by the addition of 200 pl/well 4% BSA in lx PBS. 100 pl of cell supernatant from transfected HEK293 cells containing VB10.COV2 proteins were added to the plates. For detection antibody, anti-human MIP-la biotinylated was added and incubated.
- strep-HRP (1:3000) was added and incubated. Unless specified, all incubations were carried out at 37°C for 1 h, followed by 3x washing with PBS-Tween. Afterwards, 100 pl/well of TMB solution was added and color development was stopped after 5-15 min adding 100 pl/well of 1 M HC1. The optical density at 450 nm was determined on an automated plate reader (Thermo Scientific Multiscan GO).
- the purpose of the study was to evaluate the cellular immune response (T cell response) against the T cell epitopes comprised in VB10.COV2 DNA in mice vaccinated with such constructs.
- mice Female 16-week-old BALB/c and 10-week-old C57BL/6 mice were obtained from Janvier Labs (France), and 6-9-week-old C57BL/6-McphlTg(HLA-A2.1)lEnge/J mice were obtained from Jackson Laboratory (USA). The latter are homozygous mice carrying the Tg(HLA-A2.1)lEnge transgene. These mice express significant quantities of the human HLA-A2.1 class I molecules on cells from the spleen, bone marrow and thymus.
- This transgenic model was used to specifically evaluate responses to the human HLA-A2.1 T cell epitopes comprised in the VB10.COV2 DNA constructs since the other mouse models, expressing mouse MHC class I and II, will not optimally respond to the human T cell epitopes comprised in the constructs. All animals were housed in the animal facility at the Domus Medica at University of Oslo (Oslo, Norway). All animal protocols were approved by the Norwegian Food Safety Authority (Oslo, Norway). Mice were anesthetized and shaved prior to vaccination. For the studies, the mice received VB10.COV2 at doses of 1, 5, 25 or 50 pg DNA i.m. on day 0 and day 21 for boost regime (see vaccination schedule in Table 6).
- VB 10.COV2 DNA plasmid was administrated to the tibialis anterior muscle by needle injection (as 25 pl solution in sterile PBS in each leg) followed by AgilePulse in vivo electroporation (BTX, US), consisting of 3 sets of pulses with 110-450 V. Mice administered with PBS (vehicle only) were included as negative control group in each experiment. On days 14 or 35, spleens were collected.
- the IFN-y ELISpot assay was performed on fresh splenocytes from mice vaccinated with VB10.COV2 DNA plasmids. The animals were sacrificed at day 14 and 35, and the spleens were harvested aseptically. The spleens were mashed, cell suspensions were incubated with lx ACK buffer, washed and re-suspended to a cell concentration of 6xl0 5 cells.
- the cells were plated in triplicates (6 x 10 5 cells/well) and stimulated for 24h with PBS solutions of peptides or peptide pools as follows: for assays performed on splenocytes from transgenic C57BL/6-McphlTg(HLA-A2.1)lEnge/J mice expressing human HLA2-2.1 class I molecules, the stimulation was carried out with a) individual peptides corresponding to HLA-A2.1 epitopes comprised in the respective constructs, as discrete T cell epitope or as the only HLA-A2.1 epitope in a group of epitopes or b) pools of peptides corresponding to HLA-A2.1 epitopes comprised in groups of epitopes present in the respective constructs, wherein such groups comprise more than one HLA-A2.1 epitope.
- peptide pools used composed of overlapping 15-mer peptides covering all the epitopes/groups of epitopes present in the respective constructs.
- PBS/no peptide stimulation was used as negative control.
- the stimulated splenocytes were analyzed for IFN-y responses using the IFN-y ELISpot Plus kit (Mabtech AB, Sweden). Spot-forming cells were measured in a CTL ELISpot reader, ImmunoSpot 5.0.3 from Cellular Technology.
- transgenic C57BL/6-McphlTg(HLA-A2.1)lEnge/I mice were vaccinated with one dose of 50 pg of each of the 7 VB 10.COV2 constructs, and the IFN- y ELISpot assay was carried out as described in the previous paragraph.
- the results showed that all 7 VB10.COV2 constructs induced a rapid and strong T cell responses to the T cell epitopes specific to human HLA-A2.1 molecules in the transgenic mice (Figure 4), with the response induced by VB2197, VB2207 and VB2210 being about twice as strong than the other 4 constructs.
- All 7 VB10.COV2 constructs were also tested in the wildtype BALB/c mice which were vaccinated with one dose of 25 pg of each construct.
- the peptide pools used for stimulation of the splenocytes were composed of overlapping 15-mer peptides covering all the epitope s/groups of epitopes included in the respective constructs.
- the results showed that all 7 VB10.COV2 constructs were able to induce a rapid and strong T cell responses in the wildtype mice model as well (Figure 5). VB2193, VB2194, VB2197 and VB2210 induced stronger responses than the other 3 constructs in this mouse model.
- VB2210 construct One dose of 25 pg VB2210 construct was also used for vaccination in the C57BL/6 wildtype mouse model. 14 days post vaccination, in an ELISpot assay using peptide pools composed of overlapping 15-mer peptides covering all the epitopes/groups of epitopes included in the construct, the results showed that VB2210 induced a strong specific T cell response (Figure 6). The strength of the responses differed between the two wildtype mouse models, BALB/c ( Figure 6, 3163 SFU/10 6 cells) and C57BL/6 ( Figure 7, 7414 SFU/10 6 cells), which is expected and due to the different genetic background of the two mouse strains which express distinct MHC haplotypes.
- the responses induced by VB2210 at three dose levels, 1, 5 and 25 pg, were evaluated in C57BL/6-McphlTg(HLA-A2.1)lEnge/J transgenic mice in either a one or two dose regimen.
- the second dose (boost vaccination) was administered 21 days after the first vaccination.
- the cellular responses against specific T cells epitopes from SARS-CoV-2 included in the construct were assessed in the splenocytes from individual mice 14 days post first vaccination (if only one dose was administered) or 14 days post the boost vaccination (if 2 doses were administered).
- Peptide pools composed of overlapping 15-mer peptides covering all the epitopes/groups of epitopes ( Figure 8) or peptides and peptide pools composed of peptides corresponding to human HLA-A2.1 epitopes ( Figure 9) included in the construct were used in the ELISpot assay.
- the results showed a dose-dependent immune response with stronger responses induced by 25 pg of VB2210 in comparison to the lower doses (dose response).
- dose response dose response
- the results showed further that the second vaccination at day 21 considerably enhanced the T cell responses, revealing a significant role of boosting (Figure 8 and 9).
- the second dose (boost vaccination) was administered 21 days after the first vaccination.
- the cellular responses against specific T cells epitopes from SARS-CoV-2 included in the construct were assessed in the splenocytes from individual mice 84 days post vaccination (if only one dose was administered) or 85 days post vaccination (if 2 doses were administered).
- Selected peptide pools composed of overlapping 15-mer peptides/peptides covering multiple epitopes/groups of epitopes included in the construct were used in the ELISpot assay.
- C57BL/6-McphlTg(HLA-A2.1)lEnge/J transgenic mice were vaccinated with one or two doses (boost vaccination at day 21) of 25 pg of VB2210.
- Stimulated cells were stained for phenotyping and intracellular expression of TNF-a, IFN-y, IL-4, IL- 17, IL-2 and FoxP3, and further subjected to multiparameter functional analysis by flow cytometry.
- Flow cytometry analysis of T cells showed CD8+ responses specific to the T cell epitopes in VB2210 (Figure 11).
- the population of specific CD8+ T cells increased after the second vaccine dose from 1.3% to 3% of the total splenocyte population, indicating a strong effect of the boost vaccination at day 21.
- the CD8+ specific T cells were dominated by production of IFN-y or a combination of IFN-y and TNF-a, a cytokine profile typical for pro-inflammatory responses, implying that VB2210 may induce a cytotoxic T cell response specific for SARS-CoV-2.
- Covid- 19 vaccines Comimaty (Pfizer/BioNTech) or Spikevax (Moderna) were enrolled into 3 dose level cohorts.
- Comirnaty and Spikevax comprise mRNA encapsulated into lipid nanoparticles which, upon vaccination, deliver the mRNA into cells to direct transient expression of the full-length SARS-CoV2 spike protein (with two point mutations to lock the protein in a preferred prefusion conformation).
- Participants were intramuscularly vaccinated with two doses of either 0.3, 1 or 3 mg of VB10.2210 DNA plasmid (which is identical to the DNA plasmid VB2210 mentioned herein) at day 0 and day 21 (booster).
- the IFN-y ELISpot assay was performed on peripheral blood mononuclear cells (PBMCs) of participants vaccinated with VB10.2210 plasmid according to the manufacturer’s instructions (Mabtech AB, Sweden). The stimulation was carried out with 5 pools of peptides covering epitopes included in VB10.2210 from the viral proteins S, N, M, ORF7 and ORF 1/3/10. Peptides composed of overlapping 15-mer peptides covering all the epitopes present in VB10.2210 in addition to a selection of minimal peptides were used. PBMCs only in cell medium with DMSO concentration corresponding to the DMSO concentration used in the peptide pool ( ⁇ 0.5% DMSO) was used as negative control. The stimulated PBMCs were analyzed for IFN-y responses using the human IFN-y ELISpot Plus kit (Mabtech AB, Sweden). Spot-forming cells were measured in an IRIS ELISpot reader from Mabtech AB, Sweden.
- PBMCs from VB10.2210-vaccinated participants were stimulated with corresponding peptides as for ELISpot divided into three peptide pools (M+N, ORFs, and S).
- PBMCs were peptide-stimulated for 16 h prior to intracellular staining for phenotype markers (CD4 and CD8), TNF-a and IFN-y and subjected to multiparameter analysis by flow cytometry.
- VB10.2210 was safe and well tolerated up the highest dose of 3 mg with no dose-limiting adverse events. No fatal or serious adverse events and no adverse events of any special interest were observed or reported. Local reactions were mainly mild injection site reactions (pain, tenderness and bruises). Systemic reactions were mainly mild or moderate and of short duration. There were no signs of increase in adverse events or reactogenicity after the second dose.
- VB10.2210 amplified T cell responses to the Sars-CoV-2 spike protein and induced novel T cell responses against epitopes of all of the seven non-spike Sars-CoV2 proteins (M, N, ORF lab, ORF3a, ORF7a, ORF7b and ORF 10). Responses were dose-dependent with the highest and broadest response observed in the group having received the highest dose (3 mg) ( Figures 12 and 13).
- Amino acid sequence of signal peptide of human MIPl-a (amino acids 1- 23), human MIPl-a (CCL3L1) (amino acids 24-93), hinge exon hl from IgG3 (amino acids 94-105), hinge exon 114 from IgG3 (amino acids 106-120), a dimerization unit linker (amino acids 121-130), the human CH3 domain of IgG3 (amino acids 131-237) and a unit linker (238-242):
- Amino acid sequence of anti-pan HLA class II with Ig VH signal peptide (amino acids 1-19), anti-pan HLA class II VL (amino acids 20-127), a linker (amino acids 128-142) and anti-pan HLA class II VH (amino acids 143-260):
- APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPS EEWVQKYVSDLELSAELKTPLGDTTHTEPKSCDTPPPCPRCPGGGSSGGGSGG QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTT PPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK GLGGLSEHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVE HVTFFIGGGGSGGGGSLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPD DQIGYYRRATRRIRGGS SGGGS SGGGHLRIAGHHLGRCDIKDLPKEITVATSRT LSYYKLGASQRVAGDSGGGSSGGGSSGSTQLSTDTGVEHVTFFIYNKIVDEPE GG
- APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPS EEWVQKYVSDLELSAELKTPLGDTTHTEPKSCDTPPPCPRCPGGGSSGGGSGG QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTT PPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK GLGGLSEHDYQIGGYTEKWESGVKDCVVLHSYFTSGGGGSGGGGICGDSTEC SNLLLQYGSFCTQLNRALTGIAVEQDKNTGSGGGGSGGGGVKDCVVLHSYFT SDYYQLYSTQLSTDTGVEHVTFFIGGGGSGGGGSCLYRNRDVDTDFVNEFYA YLRKHFGGGGSGGGGSDGKMKDLSPRWYFYYLGTGPEAGGSGGGGSGGQG NFK
- APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPS EEWVQKYVSDLELSAELKTPLGDTTHTEPKSCDTPPPCPRCPGGGSSGGGSGG QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTT PPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK GLGGLMSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHSGSS GSKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAAR DLICAQKFSGSSGSSTQLSTDTGVEHVTFFIYNKIVDEPESGSSGSMESEFRVYS SANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVR DLPQGS
- APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPS EEWVQKYVSDLELSAELKTPLGDTTHTEPKSCDTPPPCPRCPGGGSSGGGSGG QPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESSGQPENNYNTT PPMLDSDGSFFLYSKLTVDKSRWQQGNIFSCSVMHEALHNRFTQKSLSLSPGK GLGGLMCLYRNRDVDTDFVNEFYAYLRKHFSGSSGSKDFGGFNFSQILPDPSK PSKRSFIEDLLFNKVTLADASGSSGSAFEYYHTTDPSFLGRYMSALNGGSGGED LLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFGGSGGICGDSTECSNLLLQ YGSFCTQLNRALTGIAVEQDKNTGGSGGDGKMKDLSPRWYFYYLGTGPEAG GSGGKRF
- An immunogenic construct the construct being:
- a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77; or
- nucleic acid sequence defined in (i) a polypeptide encoded by the nucleic acid sequence defined in (i), preferably wherein said nucleotide sequence does not encode a targeting unit that targets antigen presenting cells and does encode a multimerization unit.
- a polynucleotide comprising a nucleotide sequence encoding an antigenic unit, wherein the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 1-77 and wherein the nucleotide sequence further encodes a targeting unit that targets antigen presenting cells and a multimerization unit; or
- the antigenic unit comprises at least 77 SARS-CoV-2 T cell epitopes with amino acid sequences having at least 75% to 80% sequence identity to the amino acid sequences SEQ ID NOs: 1-77, preferably at least 81% to 85%, more preferably at least 86% to 90% or at least 91% to 95% and most preferably at least 96% to 99%.
- the immunogenic construct according any of the preceding embodiments wherein the 77 SARS-CoV-2 T cell epitopes have the amino acid sequences of SEQ ID NOs: 1- 77. 6. The immunogenic construct according any of the preceding embodiments, wherein the antigenic unit further comprises one or more T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 78-96, preferably all of said T cell epitopes.
- T cell epitopes have amino acid sequences having at least 75% to 80% sequence identity to the amino acid sequences SEQ ID NOs: 78-96, preferably at least 81% to 85%, more preferably at least 86% to 90% or at least 91% to 95% and most preferably at least 96% to 99%.
- the antigenic unit further comprises one or more T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 97-160, preferably all of said T cell epitopes.
- T cell epitopes have amino acid sequences having at least 75% to 80% sequence identity to the amino acid sequences SEQ ID NOs: 97-160, preferably at least 81% to 85%, more preferably at least 86% to 90% or at least 91% to 95% and most preferably at least 96% to 99%.
- the antigenic unit further comprises one or more T cell epitopes with amino acid sequences having at least 73% sequence identity to the amino acid sequences SEQ ID NOs: 97-160, preferably all of said T cell epitopes.
- the one or more T cell epitopes have amino acid sequences having at least 75% to 80% sequence identity to the amino acid sequences SEQ ID NOs: 97-160, preferably at least 81% to 85%, more preferably at least 86% to 90% or at least 91% to 95% and most preferably at least 96% to 99%.
- T cell epitopes are flanked by amino acids sequences also flanking said epitopes in the naturally occurring protein the epitope is derived from.
- flanking sequences comprise 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more or 10 or more amino acids, preferably 1 to 10 amino acids, e.g. 2 to 8 amino acids or 3 to 7 amino acids or 4 to 5 amino acids.
- T cell epitopes are present as groups of T cell epitopes, wherein each group comprises at least 2 T cell epitopes.
- each group comprises from 2 to 20 T cell epitopes, preferably from 2 to 15 T cell epitopes, such as 2, 3, 4, 5, 6, 7, 8, 8, 10, 11, 12, 13, 14, or 15 T cell epitopes.
- 21 The immunogenic construct according to any of embodiments 19 to 20, wherein the at least 2 T cell epitopes are derived from the same SARS-CoV-2 protein, preferably from the same part of the same SARS-CoV-2 protein.
- flanking sequences comprise 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more or 10 or more amino acids, preferably 1 to 10 amino acids, e.g. 2 to 8 amino acids or 3 to 7 amino acids or 4 to 5 amino acids.
- the immunogenic construct according to any of embodiments 24 to 26, wherein the resulting length of the group of epitopes plus flanking sequences is from about 18 amino acids to about 80 amino acids, such as from 18 amino acids to 80 amino acids.
- each group comprises at least 2 T cell epitopes.
- each group comprises from 2 to 20 T cell epitopes, preferably from 2 to 15 T cell epitopes, such as 2, 3, 4, 5, 6, 7, 8, 8, 10, 11, 12, 13, 14, or 15 T cell epitopes.
- flanking sequences comprise 1 or more, 2 or more, 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more or 10 or more amino acids, preferably 1 to 10 amino acids, e.g. 2 to 8 amino acids or 3 to 7 amino acids or 4 to 5 amino acids.
- the resulting length of the group of epitopes plus flanking sequences is from about 18 amino acids to about 80 amino acids, such as from 18 amino acids to 80 amino acids.
- T cell epitopes are grouped together: the epitopes with SEQ ID NOs: 1-4, the epitopes with SEQID NOs: 5-9, the epitopes with SEQ ID NOs: 10-18, the epitopes with SEQ ID NOs: 19-20, the epitopes with SEQ ID NOs: 22-23, the epitopes with SEQ ID NOs: 24-26, the epitopes with SEQ ID NOs: 27-39, the epitopes with SEQ ID NOs: 40-43, the epitopes with SEQ ID NOs: 44-47, the epitopes with SEQ ID NOs: 48-58, the epitopes with SEQ ID NOs: 59-65, the epitopes with SEQ ID NOs: 66-71 and the epitopes with SEQ ID NOs: 72-77, or the aforementioned T cell epitopes with amino acid sequences having at least
- the antigenic unit further comprises one or more groups of T cell epitopes with SEQ ID NOs: 97-160 or amino acid sequences having at least 73% sequence identity to SEQ ID NOs: 97-160, wherein the following T cell epitopes are grouped together: the epitopes with SEQ ID NOs: 97-102, the epitopes with SEQ ID NOs: 103-109, the epitopes with SEQ ID NOs: 110-111, the epitopes with SEQ ID NOs: 112-113, the epitopes with SEQ ID NOs: 114-118, the epitopes with SEQ ID NOs: 120-123, the epitopes with SEQ ID NOs: 124-129, the epitopes with SEQ ID NOs: 130-134, the epitopes with SEQ ID NOs: 135-137, the epitopes with SEQ ID NOs: 138-140, the epitope
- the antigenic unit further comprises one or more groups of T cell epitopes with SEQ ID NOs: 78-96 or amino acid sequences having at least 73% sequence identity to SEQ ID NOs: 78-96, wherein the following T cell epitopes are grouped together: the epitopes with SEQ ID NOs: 78-84 and the epitopes with SEQ ID NOs: 86-96, or the aforementioned T cell epitopes with amino acid sequences having at least 73% sequence identity to the aforementioned SEQ ID NOs.
- immunogenic construct according to any of embodiments 37 to 48, wherein the antigenic unit further comprises the T cell epitope with the SEQ ID NO: 21, or with an amino acid sequence having at least 73% sequence identity to SEQ ID NO: 21, as a single, discrete epitope.
- the antigenic unit further comprises one or more of the following T cell epitopes as a single, discrete epitope: the T cell epitope with the SEQ ID NO: 85 and the T cell epitope with the SEQ ID NO: 119, or the aforementioned T cell epitopes with amino acid sequences having at least 73% sequence identity to SEQ ID NOs: 85 and 119, respectively.
- T cell epitope linkers are serine and/or glycine-rich linkers.
- T cell epitope linkers are serine and/or glycine-rich linkers which further comprise at least one leucine residue.
- the antigenic unit comprises an amino acid sequence having at least 73% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167.
- the immunogenic construct according to embodiment 56 wherein the antigenic unit comprises an amino acid sequence having at least 75% to 80% sequence identity to an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167, preferably at least 81% to 85%, more preferably at least 86% to 90% or at least 91% to 95% and most preferably at least 96% to 99%.
- the antigenic unit comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167, preferably wherein the antigenic unit has an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164,
- the antigenic unit comprises the amino acid sequence of SEQ ID NO: 167 or even more preferably wherein the antigenic unit has the amino acid sequence of SEQ ID NO: 167.
- the targeting unit is or comprises a moiety that interacts with surface molecules on the antigen presenting cells, preferably wherein the targeting unit is or comprises a moiety that interacts with surface molecules on human antigen-presenting cells.
- the immunogenic construct according to embodiment 59 wherein the surface molecule is selected from the group consisting of MHC, CD 14, CD40, CLEC9A, chemokine receptors, such as CCR1, CCR3, CCR4, CCR5, CCR6, CCR7, CCR8 and XCR1 and Toll-like receptors such as TLR-2, TLR-4 or TLR-5, preferably wherein the surface molecule is selected from the group consisting of HLA; hCD14, hCD40, hCLEC9A, human chemokine receptors, such as hCCRl, hCCR3, hCCR4, hCCR5, hCCR6, hCCR7, hCCR8 and hXCRl and Toll-like receptors such as hTLR-2, hTLR-4 or hTLR-5.
- chemokine receptors such as CCR1, CCR3, CCR4, CCR5, CCR6, CCR7, CCR8 and XCR1 and Toll-like receptors such
- the targeting unit comprises or consists of soluble CD40 ligand, preferably human soluble CD40 ligand, CCL4 and its isoforms, preferably human CCL4 and its isoforms, CCL5, preferably human CCL5, CCL19, preferably human CCL19, CCL20, preferably human CCL20, CCL21, preferably human CCL21, macrophage inflammatory protein alpha including its isoforms, such as mouse CCL3, human CCL3, human CCL3L1, human CCL3L2 and human CCL3L3, XCL1, preferably human XCL1, XCL2, preferably human XCL2, flagellin, anti-HLA-DP, anti-HLA-DR, anti-pan HLA class II, anti- CD40, preferably anti-human CD40, anti-TLR-2, preferably anti-human TLR-2, anti- TLR-4, preferably anti-human TLR-4, anti-TLR-5, preferably
- the targeting unit comprises an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168, such as comprising the amino acid sequence 26-93 of SEQ ID NO: 168 or comprising the amino acid sequence 28-93 of SEQ ID NO: 168.
- the targeting unit consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168, such as consisting of the amino acid sequence 26-93 of SEQ ID NO: 168 or consisting of the amino acid sequence 28-93 of SEQ ID NO: 168.
- the targeting unit comprises an amino acid sequence having at least 80% sequence identity to the amino acid sequence 20-260 of SEQ ID NO: 169, such as comprising the amino acid sequence 20-260 of SEQ ID NO: 169.
- the targeting unit consists of an amino acid sequence having at least 80% sequence identity to the amino acid sequence 20-260 of SEQ ID NO: 169, such as consists of the amino acid sequence 20-260 of SEQ ID NO: 169.
- the multimerization unit is a trimerization unit, such as a human collagen-derived trimerization or the C-terminal domain of T4 fibritin.
- the multimerization unit is a human collagen-derived trimerization unit, preferably one selected from the group consisting of human collagen derived XVIII-derived trimerization domain and human collagen XV-derived trimerization domain.
- immunogenic construct according to any of embodiments 69 to 73, wherein the hinge region is Ig derived, such as derived from human Ig, such as derived from hlgGl or h!gG2 or h!gG3 or from hlgM.
- dimerization unit linker such as glycine- serine rich linker, such as GGGSSGGGSG.
- the dimerization unit comprises hinge exon hl and hinge exon 114, a dimerization unit linker and a CH3 domain of human IgG3.
- the immunogenic construct according to any of the preceding embodiments, wherein the construct is the polynucleotide (i), preferably wherein the polynucleotide comprises a nucleotide sequence which further encodes a signal peptide.
- the signal peptide is an Ig VH signal peptide, a human TPA signal peptide or a human MIPl-a (CCL3L1) signal peptide, preferably wherein the polynucleotide comprises a nucleotide sequence which encodes a targeting unit that comprises or consists of human MIP-la (LD78P, CCL3L1) and the signal peptide is a human MIPl-a (CCL3L1) signal peptide.
- polynucleotide comprises a nucleotide sequence which encodes a targeting unit comprising an amino acid sequence having at least 80% sequence identity to the amino acid sequence 24-93 of SEQ ID NO: 168, such as comprising the amino acid sequence 26-93 of SEQ ID NO: 168 or comprising the amino acid sequence 28-93 of SEQ ID NO: 168 and further encodes a signal peptide that comprises an amino acid sequence having at least 85% sequence identity to the amino acid sequence 1-23 of SEQ ID NO: 168
- immunogenic construct according to any of embodiments 88 to 89, wherein the polynucleotide is a DNA or an RNA.
- a vector comprising the polynucleotide according to embodiment 91.
- the vector according to embodiment 92 wherein the vector is a polycistronic vector which comprises: a) the polynucleotide according to embodiment 91 and b) one or more nucleic acid sequences encoding one or more immunostimulatory compounds, wherein the vector allows for the co-expression of a polypeptide encoded by the polynucleotide and the one or more immunostimulatory compounds as separate molecules.
- vector comprises one or more coexpression elements, such as co-expression elements selected from the group consisting of IRES elements, 2A peptides, promoters and bidirectional promoters.
- the vector is a DNA vector, such as a DNA plasmid or DNA viral vector, such as a DNA viral vector selected from the group consisting of adenovirus, vaccinia virus, adeno-associated virus, cytomegalovirus and Sendai virus.
- a DNA vector such as a DNA plasmid or DNA viral vector, such as a DNA viral vector selected from the group consisting of adenovirus, vaccinia virus, adeno-associated virus, cytomegalovirus and Sendai virus.
- RNA vector such as an RNA plasmid or RNA viral vector, such as a retroviral vector, such as a retroviral vector selected from the group consisting of alphavirus, lentivirus, Moloney murine leukemia virus and rhabdovirus.
- a method of producing a vector as defined in any of embodiments 92 to 98 comprising: a) transfecting or transducing cells in vitro with the vector; b) culturing said cells; c) optionally lysing the cells to release the vector from the cells; and d) isolating and optionally purifying the vector.
- Ahost cell comprising the polynucleotide according to embodiment 91 orthevector according to any of embodiments 92 to 98.
- the multimeric protein according to embodiment 102 which is a dimeric protein consisting of two polypeptides as defined in claim 101, such as a homodimerc protein or heterodimeric protein, preferably a homodimeric protein.
- a method for preparing the polypeptide according to embodiment 101 comprises: a) transfecting or transducing cells with a polynucleotide according to claim 91 or a vector comprising such polynucleotide; b) culturing the cells; c) isolating the polypeptide from the cells; and d) optionally purifying the isolated polypeptide.
- a method for preparing the multimeric protein according to any of embodiments 102 to 103 comprises: a) transfecting or transducing cells with a polynucleotide according to claim 91 or a vector comprising such polynucleotide; b) culturing the cells; c) isolating the multimeric protein from the cells; and d) optionally purifying the isolated multimeric protein.
- a pharmaceutical composition or vaccine comprising the immunogenic construct according to any of embodiments 1 to 90 and 123 to 127or the polynucleotide according to embodiment 91 or the vector according to any of embodiments 92 to 98 or the polypeptide according to embodiment 101 or the multimeric protein according to any of embodiments 102 to 103 and a pharmaceutically acceptable carrier.
- the pharmaceutical composition or vaccine according to embodiment 107 comprising a pharmaceutically acceptable carrier and the vector according to any of embodiments 92 to 98.
- composition or vaccine according to any of embodiments 107 to 108, wherein the pharmaceutically acceptable carrier is selected from the group consisting of saline, buffered saline, such as PBS, dextrose, water, glycerol, ethanol, aqueous buffers, such as isotonic aqueous buffers or Tyrode’s buffer, and combinations thereof.
- the pharmaceutically acceptable carrier is selected from the group consisting of saline, buffered saline, such as PBS, dextrose, water, glycerol, ethanol, aqueous buffers, such as isotonic aqueous buffers or Tyrode’s buffer, and combinations thereof.
- composition or vaccine according to any of embodiments 107 to 109, wherein the composition or vaccine further comprises molecules that facilitate the transfection of cells with the polynucleotide or vector.
- composition or vaccine according to any of embodiments 107 to 110, wherein the composition or vaccine further comprises a pharmaceutically acceptable amphiphilic block co-polymer comprising blocks of poly(ethylene oxide) and polypropylene oxide, such as comprising said pharmaceutically acceptable amphiphilic block co-polymer in an amount of from 0.2% w/v to 20% w/v.
- composition or vaccine according to any of embodiments 107 and 109 to 110, wherein the composition or vaccine comprises the polypeptide or the multimeric protein in a range of from 5 pg to 5 mg.
- compositions 107 to 111 wherein the composition or vaccine comprises the polynucleotide or vector in a range of from 0.1 to 10 mg, e.g. about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9 or 1 mg or e g. 2, 3, 4, 5, 6, 7, 8, 9 or 10 mg.
- a method for treating a disease caused by SARS-CoV-2 comprises administering to a subject the pharmaceutical composition or vaccine according to any of embodiments 107 to 113.
- a method for treating a disease caused by SARS-CoV-2 comprises administering to a subject who has been previously vaccinated with a SARS-CoV-2 vaccine the pharmaceutical composition or vaccine according to any of embodiments 107 to 113.
- the immunogenic construct according to any of embodiments 1 to 90, the construct being a polypeptide that has an amino acid sequence selected from the group consisting of SEQ ID NOs: 171, 172, 173, 174, 175, 176 and 177 or a dimeric protein consisting of two such polypeptides, preferably a polypeptide that has the amino acid of SEQ ID NO: 177 or a dimeric protein consisting of two such polypeptides.
- the immunogenic construct according to any of embodiments 1 to 90, the construct being a polynucleotide comprising a nucleotide sequence encoding a polypeptide that has an amino acid sequence selected from the group consisting of SEQ ID NOs: 178, 179, 180, 181, 182, 183 and 184, preferably comprising a nucleotide sequence encoding a polypeptide that has the amino acid sequence of SEQ ID NO: 184.
- the immunogenic construct according to any of embodiments 1 to 90, the construct being a polynucleotide comprising the nucleotide sequence of SEQ ID NO: 185.
- the immunogenic construct according to any of embodiments 1 to 90, the construct being a polypeptide that has an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167.
- the immunogenic construct according to any of embodiments 1 to 90, the construct being a polynucleotide comprising a nucleotide sequence encoding a polypeptide that has an amino acid sequence selected from the group consisting of SEQ ID NOs: 161, 162, 163, 164, 165, 166 and 167.
- a pharmaceutical composition/vaccine comprising the immunogenic construct according to any of embodiments 123 to 127 and a pharmaceutically acceptable carrier.
- composition/vaccine according to embodiment 128, comprising a vector comprising the immunogenic construct of embodiment 125 and a pharmaceutically acceptable carrier.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Communicable Diseases (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Pulmonology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3235174A CA3235174A1 (en) | 2021-11-03 | 2022-11-03 | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2 |
| IL312539A IL312539A (en) | 2021-11-03 | 2022-11-03 | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2 |
| MX2024005408A MX2024005408A (es) | 2021-11-03 | 2022-11-03 | Construcciones inmunogenicas y vacunas para ser utilizadas en el tratamiento profilactico y terapeutico de enfermedades causadas por sars-cov-2. |
| US18/706,648 US20250049910A1 (en) | 2021-11-03 | 2022-11-03 | Immunogenic Constructs And Vaccines For Use In The Prophylactic And Therapeutic Treatment Of Diseases Caused By SARS-CoV-2 |
| EP22813933.3A EP4426344A1 (en) | 2021-11-03 | 2022-11-03 | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2 |
| AU2022381515A AU2022381515A1 (en) | 2021-11-03 | 2022-11-03 | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2 |
| KR1020247018623A KR20240110821A (ko) | 2021-11-03 | 2022-11-03 | SARS-CoV-2로 인한 질병의 예방적 및 치료적 처치에 사용하기 위한 면역원성 작제물 및 백신 |
| JP2024526682A JP2024540322A (ja) | 2021-11-03 | 2022-11-03 | SARS-CoV-2によって引き起こされる疾患の予防及び処置に使用するための免疫原性構築物及びワクチン |
| CN202280087550.4A CN118742321A (zh) | 2021-11-03 | 2022-11-03 | 用于预防性和治疗性治疗由SARS-CoV-2引起的疾病的免疫原性构建体和疫苗 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163275015P | 2021-11-03 | 2021-11-03 | |
| US63/275,015 | 2021-11-03 | ||
| US202263377087P | 2022-09-26 | 2022-09-26 | |
| US63/377,087 | 2022-09-26 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2023079001A1 true WO2023079001A1 (en) | 2023-05-11 |
Family
ID=84365420
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2022/080679 Ceased WO2023079001A1 (en) | 2021-11-03 | 2022-11-03 | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of diseases caused by sars-cov-2 |
Country Status (9)
| Country | Link |
|---|---|
| US (1) | US20250049910A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4426344A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024540322A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240110821A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022381515A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3235174A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL312539A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2024005408A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2023079001A1 (cg-RX-API-DMAC7.html) |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004076489A1 (en) | 2003-02-25 | 2004-09-10 | Medinnova As | Modified antibody |
| WO2011161244A1 (en) | 2010-06-25 | 2011-12-29 | Vaccibody As | Homodimeric protein constructs |
| WO2013092875A1 (en) | 2011-12-21 | 2013-06-27 | Vaccibody As | Vaccines against hpv |
| WO2017118695A1 (en) | 2016-01-08 | 2017-07-13 | Vaccibody As | Therapeutic anticancer neoepitope vaccine |
| WO2020176797A1 (en) | 2019-02-27 | 2020-09-03 | Nektar Therapeutics | Immunotherapeutic combination for treating cancer |
| WO2021168305A1 (en) * | 2020-02-19 | 2021-08-26 | Ubi Ip Holdings | Designer peptides and proteins for the detection, prevention and treatment of coronavirus disease, 2019 (covid-19) |
| WO2021202765A2 (en) * | 2020-03-31 | 2021-10-07 | The Children's Hospital Of Philadelphia | Sars-cov-2 vaccines for population-scale immunity |
-
2022
- 2022-11-03 WO PCT/EP2022/080679 patent/WO2023079001A1/en not_active Ceased
- 2022-11-03 JP JP2024526682A patent/JP2024540322A/ja active Pending
- 2022-11-03 CA CA3235174A patent/CA3235174A1/en active Pending
- 2022-11-03 KR KR1020247018623A patent/KR20240110821A/ko active Pending
- 2022-11-03 IL IL312539A patent/IL312539A/en unknown
- 2022-11-03 US US18/706,648 patent/US20250049910A1/en active Pending
- 2022-11-03 AU AU2022381515A patent/AU2022381515A1/en active Pending
- 2022-11-03 EP EP22813933.3A patent/EP4426344A1/en active Pending
- 2022-11-03 MX MX2024005408A patent/MX2024005408A/es unknown
Patent Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004076489A1 (en) | 2003-02-25 | 2004-09-10 | Medinnova As | Modified antibody |
| WO2011161244A1 (en) | 2010-06-25 | 2011-12-29 | Vaccibody As | Homodimeric protein constructs |
| WO2013092875A1 (en) | 2011-12-21 | 2013-06-27 | Vaccibody As | Vaccines against hpv |
| WO2017118695A1 (en) | 2016-01-08 | 2017-07-13 | Vaccibody As | Therapeutic anticancer neoepitope vaccine |
| US20190022202A1 (en) | 2016-01-08 | 2019-01-24 | Vaccibody As | Therapeutic anticancer neoepitope vaccine |
| WO2020176797A1 (en) | 2019-02-27 | 2020-09-03 | Nektar Therapeutics | Immunotherapeutic combination for treating cancer |
| WO2021168305A1 (en) * | 2020-02-19 | 2021-08-26 | Ubi Ip Holdings | Designer peptides and proteins for the detection, prevention and treatment of coronavirus disease, 2019 (covid-19) |
| WO2021202765A2 (en) * | 2020-03-31 | 2021-10-07 | The Children's Hospital Of Philadelphia | Sars-cov-2 vaccines for population-scale immunity |
Non-Patent Citations (6)
| Title |
|---|
| A. ALVAREZ-CIENFUEGOS ET AL., SCI REP, vol. 6, 2016, pages 28643 |
| G. NORHEIM ET AL., BIORVIX, 2020 |
| HIGGINS DTHOMPSON J.GIBSON T.THOMPSON J.D.HIGGINS D.GGIBSON T.J.: "CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice", NUCLEIC ACIDS RES., vol. 22, 1994, pages 4673 - 4680, XP002956304 |
| MYERSMILLER, CABIOS, 1989 |
| PEARSON WR, METHODS MOL BIOL, vol. 132, 2000, pages 185 - 219 |
| SAHOO BISWAJIT ET AL: "Identification of T-Cell Epitopes in Proteins of Novel Human Coronavirus, SARS-Cov-2 for Vaccine Development Introduction", INT J APPL BIOL PHARM INTERNATIONAL JOURNAL OF APPLIED BIOLOGY AND PHARMACEUTICAL TECHNOLOGY INT J APPL BIOL PHARM INTERNATIONAL JOURNAL OF APPLIED BIOLOGY AND PHARMACEUTICAL TECHNOLOGY, 1 January 2020 (2020-01-01), pages 37 - 45, XP093024202, Retrieved from the Internet <URL:https://www.fortunejournals.com/articles/identification-of-tcell-epitopes-in-proteins-of-novel-human-coronavirus-sarscov2-for-vaccine-development.pdf> [retrieved on 20230215] * |
Also Published As
| Publication number | Publication date |
|---|---|
| US20250049910A1 (en) | 2025-02-13 |
| EP4426344A1 (en) | 2024-09-11 |
| KR20240110821A (ko) | 2024-07-16 |
| AU2022381515A1 (en) | 2024-05-09 |
| MX2024005408A (es) | 2024-08-06 |
| JP2024540322A (ja) | 2024-10-31 |
| CA3235174A1 (en) | 2023-05-11 |
| IL312539A (en) | 2024-07-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7535489B2 (ja) | 治療用抗癌ネオエピトープワクチン | |
| RU2624041C2 (ru) | Конструкции гомодимерных белков | |
| JP2023524054A (ja) | ベータコロナウイルスの予防と治療 | |
| US20200325182A1 (en) | Alphaherpesvirus glycoprotein d-encoding nucleic acid constructs and methods | |
| EP2542679A1 (en) | B-cell stimulating fusion proteins of an antigen with baff or april | |
| WO2023049272A1 (en) | Coronavirus vaccines and methods of use | |
| US20250339509A1 (en) | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of infectious diseases | |
| WO2022238363A1 (en) | Immunogenic constructs and vaccines for use in the prophylactic and therapeutic treatment of infectious diseases | |
| US20250049910A1 (en) | Immunogenic Constructs And Vaccines For Use In The Prophylactic And Therapeutic Treatment Of Diseases Caused By SARS-CoV-2 | |
| US20250222085A1 (en) | Co-expression of constructs and immunostimulatory compounds | |
| US20220370604A1 (en) | Peptide vaccine for virus infection | |
| CN118742321A (zh) | 用于预防性和治疗性治疗由SARS-CoV-2引起的疾病的免疫原性构建体和疫苗 | |
| Jeon | Role of toll-like receptor agonists as cancer vaccine adjuvants | |
| RU2848314C1 (ru) | Профилактика и лечение бетакоронавируса | |
| WO2022238381A2 (en) | Immunotherapy constructs for treatment of disease | |
| WO2024092025A1 (en) | Constructs and their use | |
| RU2782422C2 (ru) | Терапевтическая противораковая неоэпитопная вакцина | |
| WO2024100196A1 (en) | Co-expression of constructs and polypeptides | |
| CN121574211A (zh) | 一种新型冠状病毒重组亚单位抗原及其制备方法和在疫苗中的应用 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22813933 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3235174 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 810171 Country of ref document: NZ Ref document number: AU2022381515 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2024526682 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2022381515 Country of ref document: AU Date of ref document: 20221103 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112024008680 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202417042558 Country of ref document: IN Ref document number: 11202402748T Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 20247018623 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020247018623 Country of ref document: KR Ref document number: 2022813933 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022813933 Country of ref document: EP Effective date: 20240603 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280087550.4 Country of ref document: CN |
|
| ENP | Entry into the national phase |
Ref document number: 112024008680 Country of ref document: BR Kind code of ref document: A2 Effective date: 20240502 |