WO2023056313A1 - Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof - Google Patents

Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof Download PDF

Info

Publication number
WO2023056313A1
WO2023056313A1 PCT/US2022/077201 US2022077201W WO2023056313A1 WO 2023056313 A1 WO2023056313 A1 WO 2023056313A1 US 2022077201 W US2022077201 W US 2022077201W WO 2023056313 A1 WO2023056313 A1 WO 2023056313A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
antigen binding
chain variable
variable region
structure represented
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/077201
Other languages
English (en)
French (fr)
Inventor
Mark GRECI
Hao Chen
Lan Wu
Ronnie Rong Wei
Ling Xu
Zhi-Yong Yang
Edward Seung
Gary J. Nabel
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Isotis SA
Original Assignee
Modex Therapeutiques SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Modex Therapeutiques SA filed Critical Modex Therapeutiques SA
Priority to MX2024003807A priority Critical patent/MX2024003807A/es
Priority to AU2022354068A priority patent/AU2022354068A1/en
Priority to KR1020247014151A priority patent/KR20240099224A9/ko
Priority to CN202280078695.8A priority patent/CN118317979A/zh
Priority to IL311758A priority patent/IL311758A/en
Priority to JP2024519821A priority patent/JP2024537826A/ja
Priority to EP22877540.9A priority patent/EP4408897A4/en
Priority to CA3232357A priority patent/CA3232357A1/en
Publication of WO2023056313A1 publication Critical patent/WO2023056313A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • C07K16/468Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/18Antivirals for RNA viruses for HIV
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/081DNA viruses
    • C07K16/082Hepadnaviridae (F), e.g. hepatitis B virus
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/081DNA viruses
    • C07K16/085Orthoherpesviridae (F), e.g. pseudorabies virus or Epstein-Barr virus
    • C07K16/087Herpes simplex virus
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/106Picornaviridae (F), e.g. hepatitis A virus
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/108Orthomyxoviridae (F), e.g. influenza virus
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/11Paramyxoviridae (F); Pneumoviridae (F), e.g. respiratory syncytial virus [RSV]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/112Retroviridae (F), e.g. leukemia viruses
    • C07K16/114Lentivirus (G), e.g. human immunodeficiency virus [HIV], feline immunodeficiency virus [FIV] or simian immunodeficiency virus [SIV]
    • C07K16/1145Env proteins, e.g. gp41, gp110/120, gp160, V3, principal neutralising domain [PND] or CD4-binding site
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/08Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10RNA viruses
    • C07K16/116Togaviridae (F); Matonaviridae (F); Flaviviridae (F)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1203Gram-negative bacteria
    • C07K16/125Gram-negative bacteria from Chlamydiales (O)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1203Gram-negative bacteria
    • C07K16/1253Gram-negative bacteria from Mycoplasmatales, e.g. Pleuropneumonia-like organisms [PPLO]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1267Gram-positive bacteria
    • C07K16/1275Streptococcus (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1267Gram-positive bacteria
    • C07K16/1285Gram-positive bacteria from Corynebacterium (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C07K16/3076Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells against structure-related tumour-associated moieties
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/46Hybrid immunoglobulins
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K19/00Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/626Diabody or triabody
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/64Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/41Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/42Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a HA(hemagglutinin)-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/40Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
    • C07K2319/43Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a FLAG-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2502/00Coculture with; Conditioned medium produced by
    • C12N2502/30Coculture with; Conditioned medium produced by tumour cells

Definitions

  • the present disclosure relates to antigen binding polypeptides and antigen binding polypeptide complexes (e.g., antibodies and antigen binding fragments thereof) having certain structural features.
  • the present disclosure also relates to polynucleotides and vectors encoding such polypeptides and polypeptide complexes, cells, chimeric antigen receptors (CARs), pharmaceutical compositions and kits containing such polypeptides and polypeptide complexes; and methods of using such polypeptides and polypeptide complexes.
  • CARs chimeric antigen receptors
  • Immunotherapy is the treatment of disease by activating or suppressing the immune system.
  • immunotherapy has become of great interest to researchers and clinicians, particularly in its promise to treat cancer and infectious disease.
  • Therapeutic antibodies are an important type of immunotherapy.
  • Therapeutic antibodies can be monospecific, meaning that they have specificity to one antigen or epitope.
  • Therapeutic antibodies have also been engineered to have specificity for two different antigens or epitopes (i.e., bispecific antibodies) or for multiple different antigens or epitopes (trispecific antibodies, tetraspecific antibodies, etc.).
  • monospecific, bispecific and multispecific antibodies have been combined to form multi -targeting strategies to treat complex human diseases, such as cancer and infectious disease.
  • bispecific or multispecific antibodies can be challenging, especially manufacturing and late stage development.
  • the production of bispecific or multispecific antibodies often requires multiple genes or plasmids for cell line development. These multiple genes or plasmids must be delivered into the same cell to make the correct molecules.
  • bispecific and multispecific antibodies can have mispairing between the heavy and light chains, which can reduce product yield, increase cell line colony screen workload, and create product heterogeneity.
  • HIV human immunodeficiency virus
  • AIDS acquired immunodeficiency syndrome
  • Gag group specific antigen
  • Pol is a polyprotein containing the enzymes critical for viral replication: protease (PR), reverse transcriptase (RT), and integrase (IN).
  • Env envelope
  • Env encodes glycoproteins that form the virus's exterior envelope.
  • Env is synthesized as a precursor glycoprotein, gpl60, which is then processed into gpl20 and gp41.
  • Env interacts with the primary receptor CD4 and a coreceptor (such as chemokine receptor CCR5) to fuse viral and target-cell membranes.
  • a coreceptor such as chemokine receptor CCR5
  • HIV patients still face daily challenges in taking multiple medicines with strict regimens. Inevitably, most patients will bear the consequences of emergence of drug-resistant viral variants, and develop other health issues from the toxicities of taking anti-HIV medicines long term, such as cardiovascular disease, kidney disease, diabetes, bone disease, liver disease, cognitive disorders, etc. Alternative treatment options are urgently needed for HIV/AIDS patients.
  • bnAbs Broadly neutralizing HIV-1 antibodies
  • bnAbs are antibodies that neutralize multiple HIV-1 viral strains. bnAbs target conserved epitopes of the virus, meaning that the targeted epitopes may be more likely to remain even if the virus mutates.
  • bnAbs have been investigated recently for HIV/AIDS treatment and prevention. Human clinical studies have revealed two factors critical for efficacy of bnAbs. First, there is the need to exceed a minimally effective dose, or trough level of circulating bnAbs to prevent infection. Second, there is a need to prevent the emergence of viral escape through resistance mutations.
  • Multispecific antibodies address the limitations of bnAbs by providing a single antibody type that recognizes multiple independent binding sites on HIV-1 envelope protein. Xu et al., Science. 358(6359):85-90 (2017). Treatment with multispecific antibodies also ensures that independent binding specificities are maintained with the same pharmacokinetics, while treatment with multiple single-target antibodies results in different antibody half-lives that wane at different rates. Furthermore, multispecific antibodies simplify manufacturing and regulatory processes by using one product for clinical development instead of a combination of multiple products.
  • multispecific anti-HIV antibodies provide an important technological platform for developing neutralizing antibody-based therapeutics for treating HIV/AIDS, offering a class of medicines with low long-term toxicities and significantly less frequent treatment regimens.
  • Multispecific antibodies also use completely different targets on HIV from the current standard of care in HIV/AIDS medicine, complementing the existing medicines by providing patients alternatives for their disease control and health management.
  • Multispecific antibodies may also offer a meaningful way for HIV prevention in the current absence of an effective HIV vaccine.
  • multispecific antibodies can be challenging, especially in manufacturing and late stage development.
  • the production of multispecific antibodies often requires multiple genes or plasmids for cell line development. These multiple genes or plasmids must be delivered into the same cell to make the correct molecules.
  • multispecific antibodies can have mispairing between the heavy and light chains, which can reduce product yield, increase cell line colony screen workload, and create product heterogeneity.
  • an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2- VH2-VH1; VH I -VH2-VL2-VL I ; VL1-L1-VL2-L2-VH2-L3-VH1; or VH1-L1-VH2-L2-VL2- L3-VL1; wherein the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; or VH3-L4-VL3; wherein VL1 is a first immunoglobulin light chain variable region; VL2 is a second immunoglobulin light chain variable region; VL3 is a third immunoglobulin light chain variable region; VH1 is a first immunoglobulin heavy chain variable region; VH2 is a second immunoglobulin heavy chain variable region;
  • an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1-L1-VH2-L2- VL2-L3 - VL 1 -Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4-Fc; or VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4- Fc; wherein the second polypeptide has a structure represented by VL3-VH3-Fc; VH3-VL3-Fc; VL3-L5-VH3-Fc; or VH3-L5-V
  • an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1- CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL- CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1; VH1-L1-VH2- L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 -VH2- L2- VL3
  • an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2- VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1- VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-VH2-VH2-VH1-CL-CH1-Fc; V
  • an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2- VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1-VL2-L2-VH2-L3-VH1; VH1-L1-VH2-L2-VL2-L3- VL1; VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH 1 -L 1 - VH2-L2- VL3 -VH1-Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -Fc; VL 1 -L 1 - VH2-L2- VL3 - VL 1 -Fc; VL 1 -L
  • an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1-VL2-L2-VH2-L3- VH1; or VH1-L1-VH2-L2-VL2-L3-VL1; wherein the second polypeptide has a structure represented by VL3; wherein the third polypeptide has a structure represented by VH3; wherein VL1 is a first immunoglobulin light chain variable region; VL2 is a second immunoglobulin light chain variable region; VL3 is a third immunoglobulin light chain variable region; VH1 is a first immunoglobulin heavy chain variable region; VH2 is a second immunoglobulin heavy chain variable region; VH3 is a third immunoglobulin heavy
  • an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-L1-VL2-L2- VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VL3 or VL3-L1; wherein the third polypeptide has a structure represented by VH3- Fc or VH3-Ll-Fc; wherein VL1 is
  • an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-L1-VL2-L2- VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VL3-Fc or VL3-Ll-Fc; wherein the third polypeptide has a structure represented by VH3 or VH3-L1; wherein VL1 is
  • an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2- VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1- CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-VH2-VH2-L1-CL-CH1; VL1-L1-VL2-L2-VH2-L3- VH1-L4
  • VL1 is a first immunoglobulin light chain variable region
  • VL2 is a second immunoglobulin light chain variable region
  • VL3 is a third immunoglobulin light chain variable region
  • VH1 is a first immunoglobulin heavy chain variable region
  • VH2 is a second immunoglobulin heavy chain variable region
  • VH3 is a third immunoglobulin heavy chain variable region
  • CHI is an immunoglobulin heavy chain constant region 1
  • CL is an immunoglobulin light chain constant region
  • LI is an immunoglobulin light chain constant region
  • an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1-VL2-L2-VH2-L3- VH1; VH1-L1-VH2-L2-VL2-L3-VL1; VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1- L 1 - VL2-L2- VH2-L3 - VH 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -Fc; VL 1 -L 1 - VH2-L2- VL3 - VL
  • an antigen binding polypeptide complex that specifically binds to a viral peptide or an HIV protein.
  • an antibody or antigen binding fragment thereof comprising an antigen binding polypeptide or antigen binding polypeptide complex described herein.
  • a polynucleotide encoding an antigen binding polypeptide or antigen binding polypeptide complex described herein. Also provided herein is a polynucleotide having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:93-107. Also provided herein is a polynucleotide encoding a polypeptide having at least 90% identity, at least 95% identity, or 100% identity to any one of SEQ ID NOs:78-92.
  • a vector comprising a polynucleotide described herein.
  • a host cell comprising a polynucleotide or an described herein.
  • CAR chimeric antigen receptor
  • an immune cell comprising a CAR described herein.
  • composition comprising (i) an antigen binding polypeptide, antigen binding polypeptide complex, antibody or antigen binding fragment thereof, polypeptide, polynucleotide, vector, host cell, CAR, or immune cell described herein, or a combination thereof, and (ii) a pharmaceutically acceptable carrier.
  • kits comprising an antigen binding polypeptide, antigen binding polypeptide complex, antibody or antigen binding fragment thereof, polypeptide, polynucleotide, vector, host cell, CAR, immune cell or pharmaceutical composition described herein, or a combination thereof.
  • FIGs. 1A-1E show exemplary configurations of trispecific antibody molecules of the invention.
  • FIG 1A bispecific arm paired with scFv-Fc.
  • FIG. IB bispecific arm paired with Fab- Fc.
  • FIG. 1C bispecific arm paired with single-chain Fab (scFab).
  • FIG. ID bispecific arm paired with scFv-single chain CL-CHl-Fc.
  • FIG. IE bispecific arm fused to CHI and paired with scFv- CL-Fc.
  • FIGs. 2A-2C show ELISA results of trispecific aCD28aCD3/aCD38scFv, aCD28aCD3/aCD38Fab, aCD28aCD3/aCD38scFab, aCD28aCD3/aCD38CLCHl, or isotype control (Control IgG) binding to CD3 (FIG. 2A), CD28 (FIG. 2B), and CD38 (FIG. 2C). Molecule structures are depicted in FIGs. 1 A-1D.
  • FIG. 3 shows the activation (CD69+) by trispecific antibodies aCD28aCD3Ll/aCD38scFv, aCD3aCD28/aCD38scFv, aCD28aCD3/aCD38scFab, aCD3aCD28/aCD38scFab, PMA/IO positive or negative isotype (Control IgG) control, of CD2+ T cells from three different donors.
  • FIGs. 4A-4C show in vitro cytolysis of lymphoma tumor cells Z-138 by T cells mediated by trispecific antibodies aCD28aCD3Ll/aCD38scFv, aCD3aCD28/aCD38scFv, aCD28aCD3/aCD38scFab, aCD3aCD28/aCD38scFab, PMA/IO or isotype (Control IgG) control from three different donors (FIGs. 4A-4C, respectively).
  • FIGs. 5A-5D show ELISA results of trispecific aCD28aCD3CLlCHl/aCD38scFvCL, aCD28aCD3CLlCHl/aCD19scFvCL, or isotype control (Control IgG) binding to CD3 (A), CD28 (B), CD 19 (C), and CD38 (D). Molecule structures are depicted in FIG. IE.
  • FIGs. 6A-6F show configurations of exemplary bispecific molecules of the invention from the N-terminus to the C-terminus of the single chain antigen binding polypeptide(s).
  • FIGs. 6A and 6D bispecific molecules without Fc region.
  • FIG. 6B bispecific, tetravalent molecule with Fc region.
  • FIGs. 6C, 6E and 6F bispecific molecules with Fc region.
  • VL1 refers to a first immunoglobulin light chain variable region
  • VL2 refers to a second immunoglobulin light chain variable region
  • VH1 refers to a first immunoglobulin heavy chain variable region
  • VH2 refers to a second immunoglobulin heavy chain variable region.
  • CH2 refers to an immunoglobulin heavy chain constant region 2
  • CH3 refers to an immunoglobulin heavy chain constant region 3.
  • 11, 12 and 13 refer to amino acid linkers.
  • LI, L2 and L3 refer to amino acid linkers.
  • the circle symbol refers to a knob-into-hole modification.
  • FIG. 7 shows SDS-PAGE results of Nickel-NTA (Ni-NTA)-purified bispecific molecules with histidine tags, as depicted in FIG. 6A.
  • FIGs. 8A-8B show ELISA results of bispecific molecule aCD19aCD38-His or isotype control (Control IgG) binding to CD 19 (FIG. 8 A) and CD38 (FIG. 8B).
  • FIG. 9 shows SDS-PAGE results of protein A-purified bispecific, tetravalent molecules with LALAPA Fc, as depicted in FIG. 6B.
  • FIGs. 10A-10B show ELISA results of bispecific, tetravalent aCD28aCD3LALAPAFc, aCD3aCD28LALAPAFc, or isotype control (Control IgG) binding to CD3 (FIG. 10A) and CD28 (FIG. 10B). Molecule structures are depicted in FIG. 6C.
  • FIG. 11 shows nuclear factor of activated T-cells (NF AT) pathway activation by bispecific, tetravalent aCD28aCD3LlLALAPAFc or aCD3aCD28LlLALAPAFc, or anti-CD3 and anti-CD28 mAbs using NF AT promoter-luciferase expressing human Jurkat T cells.
  • NF AT nuclear factor of activated T-cells
  • FIGs. 12A-12B show ELISA results of bispecific aCD28aCD3LALAPAFc or aCD3aCD28LALAPAFc, or isotype control (Control IgG) binding to CD3 (FIG. 12A) and CD28 (FIG. 12B) Molecule structures are depicted in FIG. 6C.
  • FIGs. 13A-13C show configurations of exemplary tetraspecific molecules of the invention.
  • VL1 refers to a first immunoglobulin light chain variable region.
  • VL2 refers to a second immunoglobulin light chain variable region.
  • VL3 refers to a third immunoglobulin light chain variable region.
  • VL4 refers to a fourth immunoglobulin light chain variable region.
  • VH1 refers to a first immunoglobulin heavy chain variable region.
  • VH2 refers to a second immunoglobulin heavy chain variable region.
  • VH3 refers to a third immunoglobulin heavy chain variable region.
  • VH4 refers to a fourth immunoglobulin heavy chain variable region.
  • CHI refers to an immunoglobulin heavy chain constant region 1.
  • CH2 refers to an immunoglobulin heavy chain constant region 2.
  • CH3 refers to an immunoglobulin heavy chain constant region 3.
  • CL refers to an immunoglobulin light chain constant region.
  • the circle symbol in FIGs. 13A-13C refers to a knob-into-hole modification.
  • FIGs. 14A-14D show ELISA results of tetraspecific aCD28aCD3 CD 19CD38LAL AP AFc, aCD3 aCD28CD 19CD38L AL AP AFc, aCD28aCD3CD19CD38LALAPAFc, or aCD28aCD3CD38CD19LALAPAFc, or isotype control (Control IgG) binding to CD3 (FIG. 14 A), CD28 (FIG. 14B), CD 19 (FIG. 14C), and CD38 (FIG. 14D). Molecule structures are depicted in FIG. 13A.
  • FIG. 15 shows NFKB pathway activation by tetraspecific aCD28aCD3/aCD19CD38LlLALAPAFc or aCD3aCD28/CD19CD38LlLALAPAFc, or anti- CD3 mAbs using NFKB promoter-luciferase expressing human Jurkat T cells.
  • FIGs. 16A-16B show activation (CD69+) by tetraspecific molecules aCD28aCD3/aCD19CD38LlLALAPAFc or aCD3aCD28/CD19CD38LlLALAPAFc, or anti- CD3 mAb, of CD4+ (FIG. 16A) or CD8+ (FIG. 16B) T cells from three different donors.
  • FIG. 17 shows both orientation and linker can affect expression of tetraspecific molecules.
  • FIGs. 18A-18D show ELISA results of tetraspecific aCD28aCD3CD19CD38LALAPAFc with different linker lengths as depicted in FIG. 17, or isotype control (Control IgG) binding to CD3 (FIG. 18 A), CD28 (FIG. 18B), CD 19 (FIG. 18C), and CD38 (FIG. 18D).
  • FIGs. 19A-19D show ELISA results of tetraspecific aCD28aCD3CHl/CD19CD38CL LALAPAFc with different linkers as depicted in FIG. 13B, or isotype control (Control IgG) binding to CD3 (FIG. 19 A), CD28 (FIG. 19B), CD38 (FIG. 19C), and CD 19 (FIG. 19D).
  • FIGs. 20A-20D show ELISA results of tetraspecific aCD28aCD3 CD38CD 19L ALAP AFc, aCD28aCD3 CD38CD 19LALAP AFc, aCD28aCD3CD38CD19LALAPAFc, or aCD3aCD28CD19CD38LALAPAFc, or isotype control (Control IgG) binding to CD3 (FIG. 20 A), CD28 (FIG. 20B), CD38 (FIG. 20C), and CD 19 (FIG. 20D). Molecule structures are depicted in FIG. 13C.
  • FIGs. 20E-20H show ELISA results of tetraspecific aCD28aCD3L l/aCD38aCD 19L 1 HHLL, aCD28aCD3L 1/aCD 19aCD38L 1 HHLL, aCD3aCD28Ll/aCD38aCD19Ll_HHLL, aCD3aCD28Ll/aCD19aCD38Ll_HHLL, or isotype control (Control HuIgG) binding to CD3 (FIG. 20E), CD28 (FIG. 20F), CD38 (FIG. 20G), and CD 19 (FIG. 20H).
  • FIGs. 21 A-21D show configurations of exemplary bispecific molecules of the invention.
  • VL1 refers to a first immunoglobulin light chain variable region.
  • VL2 refers to a second immunoglobulin light chain variable region.
  • VL3 refers to a third immunoglobulin light chain variable region.
  • VL4 refers to a fourth immunoglobulin light chain variable region.
  • VH1 refers to a first immunoglobulin heavy chain variable region.
  • VH2 refers to a second immunoglobulin heavy chain variable region.
  • VH3 refers to a third immunoglobulin heavy chain variable region.
  • VH4 refers to a fourth immunoglobulin heavy chain variable region.
  • CH3 refers to an immunoglobulin heavy chain constant region 3.
  • FIG. 22 shows non-limiting examples of different configurations of tetraspecific antibody molecules.
  • vLl is a first immunoglobulin light chain variable region.
  • vL2 is a second immunoglobulin light chain variable region.
  • vL3 is a third immunoglobulin light chain variable region.
  • vL4 is a fourth immunoglobulin light chain variable region.
  • vHl is a first immunoglobulin heavy chain variable region.
  • vH2 is a second immunoglobulin heavy chain variable region.
  • vH3 is a third immunoglobulin heavy chain variable region.
  • vH4 is a fourth immunoglobulin heavy chain variable region.
  • CH2 is an immunoglobulin heavy chain constant region 2.
  • CH3 is an immunoglobulin heavy chain constant region 3.
  • the circle symbol in the CH3 region indicates a knob-into-hole modification.
  • FIGs. 23 A-23D show ELISA results of tetraspecific aCD28aCD3LHaCD38/aCD19scFv, aCD28aCD3HLaCD38/aCD19scFv, or isotype control (Control IgG) binding to CD3 (FIG. 23 A), CD28 (FIG. 23B), CD38 (FIG. 23C), and CD19 (FIG. 23D). Molecule structures are depicted in FIG. 22.
  • FIG. 24 shows non-limiting examples of different configurations of pentaspecific antibody molecules.
  • vLl is a first immunoglobulin light chain variable region.
  • vL2 is a second immunoglobulin light chain variable region.
  • vL3 is a third immunoglobulin light chain variable region.
  • vL4 is a fourth immunoglobulin light chain variable region.
  • vL5 is a fifth immunoglobulin light chain variable region.
  • vHl is a first immunoglobulin heavy chain variable region.
  • vH2 is a second immunoglobulin heavy chain variable region.
  • vH3 is a third immunoglobulin heavy chain variable region.
  • vH4 is a fourth immunoglobulin heavy chain variable region.
  • vH5 is a fifth immunoglobulin heavy chain variable region.
  • CH2 is an immunoglobulin heavy chain constant region 2.
  • CH3 is an immunoglobulin heavy chain constant region 3.
  • the circle symbol in the CH3 region indicates a knob
  • FIGs. 25A-25D show ELISA results of tetraspecific aCD28aCD3LHaCD38/aCD 19aCD20, aCD28aCD3LHaCD38/aCD20aCD 19, aCD28aCD3HLaCD38/aCD19aCD20, aCD28aCD3HLaCD38/aCD20aCD19, or isotype control (Control IgG) binding to CD3 (FIG. 8 A), CD28 (FIG. 8B), CD38 (FIG. 8C), and CD 19 (FIG. 8D). Molecule structures are depicted in FIG. 24.
  • FIG. 26 shows additional non-limiting examples of different configurations of tetraspecific antibody molecules.
  • FIG. 27 depicts an exemplary configuration of a masked tetraspecific antibody.
  • Variable domains (Fv) of the antibody are shown as heavy chain/light chain pairs, with Fvl-Fv3 targetting tumor associated antigens (TAAs) or immune costimulatory receptors, and a fourth Fv targetting CD3 (aCD3 or aCD3).
  • TAAs tumor associated antigens
  • aCD3 or aCD3 fourth Fv targetting CD3
  • linkers between Fv3 and aCD3 contain one or more protease recognition sites.
  • FIG. 28 shows SDS-PAGE results of in vitro cleavage of exemplary masked tetraspecific molecules as depicted. Molecules were treated with either MTP or MMP9 protease as specified.
  • FIG. 29 shows ELISA binding results of exemplary masked tetraspecific molecules as depicted in FIG. 27, or negative isotype (Control IgGl), with or without protease treatment. Molecules cleaved or not cleaved by MTP or MMP9 as specified were tested for binding affinity to Trop2 and cMet.
  • FIG. 30 shows ELISA binding results of exemplary masked tetraspecific molecules as depicted in FIG. 27, or negative isotype (Control IgGl), with or without protease treatment. Molecules cleaved or not cleaved by MTP or MMP9 as specified were tested for binding affinity to CD28.
  • FIG. 31 shows ELISA binding results of exemplary masked tetraspecific molecules as depicted in FIG. 27, or negative isotype (Control IgGl), with or without protease treatment. Molecules cleaved or not cleaved by MTP or MMP9 as specified were tested for binding affinity to CD3.
  • FIG. 32 shows cytolysis of HCC1954 tumor cells by PBMCs (E:T:10: l) mediated by exemplary masked tetraspecific molecules as depicted in FIG. 27, or negative isotype (Control IgGl), from PBMCs of two donors (KP63250 and KP63251).
  • FIG. 33 shows ELISA binding results of exemplary non-masked tetraspecific molecules as depicted, or negative isotype (hIgGILALPA) control, to their respective targets of hTrop2, hcMet, hCD28, and hCD3.
  • hIgGILALPA negative isotype
  • FIG. 34 shows CD69+ activation by exemplary non-masked tetraspecific molecules, or negative isotype (IgGILALPA) control, of CD2+ T cells from PBMCs of two different donors.
  • FIG. 35 shows an additional non-limiting example of a tetraspecific antibody molecule.
  • FIG. 36A shows a further non-limiting example of a tetravalent, bispecific antibody configuration, called MX846.
  • MX846 was analyzed for binding to CD3 by biolayer interferometry (BLI) (FIG. 36B), and to CD20 by flow cytometry (FIG. 36C).
  • FIG. 37A shows a further non-limiting example of a tetravalent, trispecific antibody configuration, called MX855.
  • MX855 was analyzed for binding to CD3 and CD28 by biolayer interferometry (BLI) (FIG. 37B), and to CD20 by flow cytometry (FIG. 37C).
  • FIG. 38A shows a further non-limiting example of a tetraspecific antibody configuration, called MX851.
  • MX851 was analyzed for binding to CD3, CD28 and BCMA by biolayer interferometry (BLI) (FIG. 38B), and to CD20 by flow cytometry (FIG. 38C).
  • BLI biolayer interferometry
  • FIG. 38C shows a further non-limiting example of a tetraspecific antibody configuration
  • FIG. 39A shows a further non-limiting example of a tetraspecific antibody configuration, called MX853.
  • MX853 was analyzed for binding to CD3, CD28 and BCMA by biolayer interferometry (BLI) (FIG. 39B), and to CD20 by flow cytometry (FIG. 39C).
  • FIGs. 40A-40B show killing of Mantle Cell lymphoma cell line Z-138 by T-cells mediated by tetravalent, tetraspecific MX851 (FIG. 40A) and tetravalent, trispecific MX855 (FIG. 40B).
  • FIG. 41 A shows a further non-limiting example of a trispecific antibody configuration, called MX894 (VRC01scFv/PGT121xl0e8v4LlIgGlLS).
  • MX894 was analyzed for binding to 10e8 fusion peptide (FIG. 4 IB), and CD4 site-dependent (FIG. 41C) and CD4 site-independent (FIG. 4 ID) HIV spike protein by biolayer interferometry (BLI).
  • FIG. 42A shows a further non-limiting example of a tetraspecific antibody configuration, called MX873 (VRC26.25 x 10-1074L9/VRC01 x PGT121Ll IgGILS).
  • MX873 was analyzed for binding to CD4 site-dependent (FIG. 42B) and CD4 site-independent (FIG. 42C) HIV spike protein by biolayer interferometry (BLI).
  • FIG. 43 A shows a further non-limiting example of a tetraspecific antibody configuration, called MX875 (10-1074 x VRC26.25L9/VRC01 x PGT121L1 IgGILS).
  • MX875 was analyzed for binding to CD4 site-dependent (FIG. 43B) and CD4 site-independent (FIG. 43 C) HIV spike protein by biolayer interferometry (BLI).
  • FIG. 44A shows a further non-limiting example of a tetraspecific antibody configuration, called MX877 (STAR VRC26.25 x PGT128L9/STAR VRC01 x PGT121L1 IgGILS).
  • MX877 was analyzed for binding to CD4 site-dependent (FIG. 44B) and CD4 site-independent (FIG. 44C) HIV spike protein by biolayer interferometry (BLI).
  • FIG. 45A shows a further non-limiting example of a trivalent, bispecific antibody configuration, called MX848.
  • MX848 was analyzed for binding to CD3 by biolayer interferometry (BLI) (FIG. 45B), and binding to CD20 by flow cytometry (FIG. 45C).
  • FIG. 46A shows a further non-limiting example of a trispecific antibody configuration, called MX857.
  • MX857 was analyzed for binding to CD3 and CD28 by biolayer interferometry (BLI) (FIG. 46B), and binding to CD20 by flow cytometry (FIG. 46C).
  • FIG. 46D shows killing of Mantle Cell lymphoma cell line Z-138 by T-cells mediated by MX857.
  • the invention is directed to antigen binding polypeptides and antigen binding polypeptide complexes (e.g., antibodies or antigen binding fragments thereof) having improved features.
  • the invention enables the generation of multi specific and multifunctional antigen binding polypeptides and antigen binding polypeptide complexes through the expression of complementary self-assembling heavy and light chains expressed with a single polypeptide per arm and, optionally, with the addition of specific amino acid linkers.
  • antigen binding polypeptides and antigen binding polypeptide complexes of the invention can bind to specific combinations of target molecules for selectivity or breadth/neutralization, bring together two or more cell types, bring together targets and deliver activation signals, modify the disease microenvironment, and enhance avidity of binding for improved potency.
  • antigen binding polypeptide refers to a polypeptide having the ability to specifically bind to one or more substances that induce an immune response (i.e., one or more antigens or epitopes).
  • antigen binding polypeptide complex refers to a group of two, three, four, or more associated polypeptides, wherein at least one polypeptide has the ability to specifically bind to one or more antigens.
  • An antigen binding polypeptide complex includes, but is not limited to, an antibody or antigen binding fragment thereof.
  • the term "antibody” includes, without limitation, a glycoprotein immunoglobulin which binds specifically to an antigen and comprises at least two heavy (H) chains and two light (L) chains interconnected by disulfide bonds.
  • Each H chain comprises a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
  • the heavy chain constant region comprises three constant domains, CHI, CH2 and CH3.
  • Each light chain comprises a light chain variable region (abbreviated herein as VL) and a light chain constant region.
  • the light chain constant region comprises one constant domain, CL.
  • the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDRs complementarity determining regions
  • FR framework regions
  • Each VH and VL comprises three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • a heavy chain may have the C-terminal lysine or not.
  • the amino acids in the variable regions are numbered using the Kabat numbering system and those in the constant regions are
  • polyclonal antibody refers to a population of antibodies that are produced by different B-cells and bind to different epitopes of the same antigen.
  • antibody includes, by way of example, monoclonal and polyclonal antibodies; chimeric and humanized antibodies; human or non-human antibodies; wholly synthetic antibodies; and single chain antibodies.
  • a non-human antibody can be humanized by recombinant methods to reduce its immunogenicity in man.
  • the antibody can be an antibody that has been altered (e.g., by mutation, deletion, substitution, conjugation to a non-antibody moiety).
  • an antibody can include one or more variant amino acids (compared to a naturally occurring antibody) which change a property (e.g., a functional property) of the antibody.
  • a property e.g., a functional property
  • several such alterations are known in the art which affect, e.g., half-life, effector function, and/or immune responses to the antibody in a patient.
  • the term antibody also includes artificial polypeptide constructs which comprise at least one antibody-derived antigen binding site.
  • an "antigen binding fragment" of an antibody refers to one or more fragments or portions of an antibody that retain the ability to bind specifically to the antigen bound by the whole antibody. It has been shown that the antigen-binding function of an antibody can be performed by fragments or portions of a full-length antibody.
  • An antigen binding fragment can contain the antigenic determining regions of an intact antibody (e.g., the complementarity determining regions (CDRs)). Examples of antigen binding fragments of antibodies include, but are not limited to, Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, and single chain antibodies.
  • An antigen binding fragment of an antibody can be derived from any animal species, such as rodents (e.g., mouse, rat, or hamster) and humans or can be artificially produced.
  • the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be j oined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see, e.g., Bird et al. (1988) Science 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • single chain Fv single chain Fv
  • Such single chain antibodies are also intended to be encompassed within the term "antigen-binding fragment" of an antibody.
  • Antigen binding fragments are obtained using conventional techniques known to those with skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies. Antigen binding fragments can be produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins.
  • variable region typically refers to a portion of an antibody, generally, a portion of a light or heavy chain, typically about the amino-terminal 110 to 120 amino acids, or 110 to 125 amino acids in the mature heavy chain and about 90 to 115 amino acids in the mature light chain, which differ extensively in sequence among antibodies and are used in the binding and specificity of a particular antibody for its particular antigen.
  • the variability in sequence is concentrated in those regions called complementarity determining regions (CDRs) while the more highly conserved regions in the variable domain are called framework regions (FR).
  • CDRs complementarity determining regions
  • FR framework regions
  • variable region is a mammalian variable region, e.g., a human, mouse or rabbit variable region.
  • the variable region comprises rodent or murine CDRs and human framework regions (FRs).
  • the variable region is a primate (e.g., non-human primate) variable region.
  • the variable region comprises rodent or murine CDRs and primate (e.g., non-human primate) framework regions (FRs).
  • CDR complementarity determining region
  • Antibodies can comprise six CDRs, e.g., three in the VH and three in the VL.
  • VL VL region
  • VL domain VL domain
  • VL1 a VL region
  • VL2 a VL region
  • VL3 a third light chain variable region
  • An enumerated VL region e.g., VL1
  • VL2 can have the same or different antigen binding properties and/or the same or different sequence as another enumerated VL region (e.g., VL2).
  • VH VH region
  • VH domain VH domain
  • VH1 first heavy chain variable region
  • VH2 to denote a second heavy chain variable region
  • VH3 to denote a third heavy chain variable region
  • An enumerated VH region e.g., VH1
  • VH2 can have the same or different antigen binding properties and/or the same or different sequence as another enumerated VH region (e.g., VH2).
  • Kabat numbering and like terms are recognized in the art and refer to a system of numbering amino acid residues in the heavy and light chain variable regions of an antibody or antigen binding fragment thereof.
  • CDRs can be determined according to the Kabat numbering system (see, e.g., Kabat EA & Wu TT (1971) Ann NY Acad Sci 190: 382- 391 and Kabat EA et al., (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
  • CDRs within an antibody heavy chain molecule are typically present at amino acid positions 31 to 35, which optionally can include one or two additional amino acids, following 35 (referred to in the Kabat numbering scheme as 35A and 35B) (CDR1), amino acid positions 50 to 65 (CDR2), and amino acid positions 95 to 102 (CDR3).
  • CDRs within an antibody light chain molecule are typically present at amino acid positions 24 to 34 (CDR1), amino acid positions 50 to 56 (CDR2), and amino acid positions 89 to 97 (CDR3).
  • the terms “constant region” or “constant domain” are used interchangeably to refer to a portion of an antigen binding polypeptide, antigen binding polypeptide complex, antibody or antigen binding fragment thereof, e.g., a carboxyl terminal portion of a light and/or heavy chain which is not directly involved in binding of an antibody to antigen but which can exhibit various effector functions, such as interaction with the Fc region.
  • the constant region generally has a more conserved amino acid sequence relative to a variable region.
  • an antigen binding polypeptide, antigen binding polypeptide complex, antibody or antigen binding fragment thereof comprises a constant region or portion thereof that is sufficient for antibodydependent cell-mediated cytotoxicity (ADCC), antibody-dependent cellular phagocytosis (ADCP), and complement-dependent cytotoxicity (CDC).
  • ADCC antibody-mediated cytotoxicity
  • ADCP antibody-dependent cellular phagocytosis
  • CDC complement-dependent cytotoxicity
  • fragment crystallizable region As used herein, the terms “fragment crystallizable region,” “Fc region,” or “Fc domain” are used interchangeably herein to refer to the tail region of an antibody that interacts with cell surface receptors called Fc receptors and some proteins of the complement system.
  • Fc regions typically comprise CH2 and CH3 regions, and, optionally, an immunoglobulin hinge.
  • Examples of an Fc region include, but are not limited to, an amino acid sequence of any one of SEQ ID NOs:375-388, or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to any one of SEQ ID NOs:375-388.
  • Examples of a CH2 region include, but are not limited to, an amino acid sequence of any one of SEQ ID NOs:394-399, or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to any one of SEQ ID NOs:394-399.
  • Examples of a CH3 region include, but are not limited to, an amino acid sequence of any one of SEQ ID N0s:400-403, or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to any one of SEQ ID N0s:400-403.
  • immunoglobulin hinge As used herein, the terms “immunoglobulin hinge,” “hinge,” “hinge domain” or “hinge region” are used interchangeably to refer to a stretch of heavy chains between the Fab and Fc portions of an antigen binding polypeptide, antigen binding polypeptide complex, antibody or antigen binding fragment thereof.
  • a hinge provides structure, position and flexibility, which assist with normal functioning of antibodies (e.g., for crosslinking two antigens or binding two antigenic determinants on the same antigen molecule).
  • An immunoglobulin hinge is divided into upper, middle and lower hinge regions that can be separated based on structural and/or genetic components. An immunoglobulin hinge of the invention can contain one, two or all three of these regions.
  • the upper hinge region stretches from the C terminal end of CHI to the first hinge disulfide bond.
  • the middle hinge region stretches from the first cysteine to the last cysteine in the hinge.
  • the lower hinge region extends from the last cysteine to the glycine of CH2.
  • the cysteines present in the hinge form interchain disulfide bonds that link the immunoglobulin monomers.
  • Fab refers to a region of an antibody that binds to an antigen. It is typically composed of one constant and one variable domain of each of the heavy and the light chain.
  • the term "heavy chain” refers to a portion of an antigen binding polypeptide, antigen binding polypeptide complex, antibody or antigen binding fragment thereof typically composed of a heavy chain variable region (VH), a heavy chain constant region 1 (CHI), a heavy chain constant region 2 (CH2), and a heavy chain constant region 3 (CH3).
  • VH heavy chain variable region
  • CHI heavy chain constant region 1
  • CH2 heavy chain constant region 2
  • CH3 heavy chain constant region 3
  • a typical antibody is composed of two heavy chains and two light chains.
  • a heavy chain can refer to any distinct type, e.g., alpha (a), delta (6), epsilon (a), gamma (y), and mu (p), based on the amino acid sequence of the constant region, which gives rise to IgA, IgD, IgE, IgG, and IgM classes of antibodies, respectively, including subclasses of IgG, e.g., IgGl, IgG2, IgG3, and IgG4. Heavy chain amino acid sequences are known in the art. In some aspects, the heavy chain is a human heavy chain.
  • the term "light chain” refers to a portion of an antigen binding polypeptide, antigen binding polypeptide complex, antibody or antigen binding fragment thereof typically composed of a light chain variable region (VL) and a light chain constant region (CL).
  • VL light chain variable region
  • CL light chain constant region
  • a typical antibody is composed of two light chains and two heavy chains.
  • a light chain can refer to any distinct type, e.g., kappa (K) or lambda (X), based on the amino acid sequence of the constant region. Light chain amino acid sequences are known in the art. In some aspects, the light chain is a human light chain.
  • chimeric antibody or antigen binding fragment thereof refers to an antibody or antigen binding fragments thereof wherein the amino acid sequence is derived from two or more species.
  • the variable region of both light and heavy chains corresponds to the variable region of antibodies or antigen binding fragments thereof derived from one species of mammals (e.g., mouse, rat, rabbit, etc.) with the desired specificity, affinity and capability, while the constant regions are homologous to the sequences in antibodies or antigen binding fragments thereof derived from another (usually human) to avoid eliciting an immune response in that species.
  • humanized antibody or antigen binding fragment thereof refers to forms of non-human (e.g., murine) antibodies or antigen binding fragments that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human (e.g., murine) sequences.
  • humanized antibodies or antigen binding fragments thereof are human immunoglobulins in which residues from a complementary determining region (CDR) are replaced by residues from a CDR of a non-human species (e.g., mouse, rat, rabbit, hamster) that have the desired specificity, affinity, and capability (Jones et al., Nature 321 :522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science 239: 1534-1536 (1988)).
  • CDR complementary determining region
  • the Fv framework region (FR) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody or fragment from a non-human species that has the desired specificity, affinity, and capability.
  • the humanized antibody or antigen binding fragment thereof can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody or antigen-binding fragment thereof specificity, affinity, and/or capability.
  • a humanized antibody or antigen binding fragment thereof will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
  • a humanized antibody or antigen binding fragment thereof can also comprise at least a portion of a constant region, typically that of a human immunoglobulin. Examples of methods used to generate humanized antibodies are known and described, for example, in U.S. Pat. No. 5,225,539; Roguska et al., Proc. Natl. Acad. Sci., USA, 91(3):969-973 (1994), and Roguska et al., Protein Eng. 9(10):895-904 (1996).
  • human antibody or antigen binding fragment thereof means an antibody or antigen binding fragment thereof having an amino acid sequence derived from a human immunoglobulin gene locus, where such antibody or antigen binding fragment is made using recombinant techniques known in the art. This definition of a human antibody or antigen binding fragment thereof includes intact or full-length antibodies and fragments thereof.
  • a polypeptide, polypeptide complex, antibody, antigen binding fragment thereof, polynucleotide, vector, chimeric antigen receptor (CAR) or cell which is "isolated” is a polypeptide, polypeptide complex, antibody, antigen binding fragment thereof, polynucleotide, vector, CAR or cell which is in a form not found in nature.
  • Isolated polypeptides, polypeptide complexes, antibodies, antigen binding fragments thereof, polynucleotides, vectors, CARs or cells include those which have been purified to a degree that they are no longer in a form in which they are found in nature.
  • a polypeptide, polypeptide complex, antibody, antigen binding fragment thereof, polynucleotide, vector, CAR or cell which is isolated is substantially pure.
  • substantially pure refers to material which is at least 50% pure (i.e., free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure.
  • polypeptide polypeptide
  • the polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
  • the polypeptides of this invention are based upon antibodies, in some aspects, the polypeptides can occur as single chains or associated chains.
  • the term "about” refers to a value or composition that is within an acceptable error range for the particular value or composition as determined by one of ordinary skill in the art, which will depend in part on how the value or composition is measured or determined, i.e., the limitations of the measurement system.
  • “about” can mean within 1 or more than 1 standard deviation per the practice in the art.
  • “about” can mean a range of up to 10% or 20% (i.e., ⁇ 10% or ⁇ 20%).
  • about 3 mg can include any number between 2.7 mg and 3.3 mg (for 10%) or between 2.4 mg and 3.6 mg (for 20%).
  • the terms can mean up to an order of magnitude or up to 5-fold of a value.
  • the meaning of "about” should be assumed to be within an acceptable error range for that particular value or composition.
  • any numerical range, concentration range, percentage range, ratio range or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one-tenth and one-hundredth of an integer), unless otherwise indicated.
  • the invention is directed to antigen binding polypeptides and antigen binding polypeptide complexes having certain structural features.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1 or VH1-VH2-VL2-VL1 and a second polypeptide having a structure of VL3-VH3 or VH3-VL3.
  • an antigen binding polypeptide complex e.g., an antibody or antigen binding fragment thereof
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1 or VH1-VH2-VL2-VL1, a second polypeptide having a structure represented by VL3, and a third polypeptide having a structure represented by VH3.
  • the antigen binding polypeptide complex contains an amino acid linker between any two regions denoted in a structure described herein.
  • the antigen binding polypeptide complex contains an Fc region, CHI region, CL region, or any combination thereof.
  • the Fc region, CHI region, CL region and/or CH3 is located at the carboxy terminus of the antigen binding polypeptide, and is optionally linked to the polypeptide by at least one amino acid linker.
  • the Fc region comprises an amino acid sequence of any one of SEQ ID NOs:375-388 or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to any one of SEQ ID NOs:375-388.
  • the CHI region comprises an amino acid sequence of any one of SEQ ID NOs:389-393 or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to any one of SEQ ID NOs:389-393.
  • the CL region comprises an amino acid sequence of SEQ ID NO:404 or 405 or an amino acid sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identity to SEQ ID NO:404 or 405.
  • the antigen binding polypeptide complex is an antibody or antigen binding fragment thereof.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; V 1-L1-VL2-L2-VH2-L3- VH1; or VH1-L1-VH2-L2-VL2-L3-V 1; wherein the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; or VH3-L4-VL3; wherein VL1 is a first immunoglobulin light chain variable region; VL2 is a second immunoglobulin light chain variable region; VL3 is a third immunoglobulin light chain variable region; VH1 is a first immunoglobulin heavy chain variable region; VH2 is a second immunoglobulin heavy chain variable region; V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by V 1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VH3-VL3. In some aspects, the first polypeptide has a structure represented by V 1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-L4-VH3. In some aspects, the first polypeptide has a structure represented by VL1-VL2- VH2-VH1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-V 1 and the second polypeptide has a structure represented by VH3-VL3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-V 1 and the second polypeptide has a structure represented by VL3-L4-VH3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-V 1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-VH3.
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VH3-VL3.
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VH3- L4-VL3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL2-L3-VL1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VH3-VL3.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-L1-VL2-L2- VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL I -L I -VL2-L2-VH2-L3-VH I -L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VL3-VH3-Fc; VH3-VL3-Fc; VL3-L5-VH3-Fc; or VH3-L5-VL3-Fc;
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc and the second polypeptide has a structure represented by VL3-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc and the second polypeptide has a structure represented by VH3-VL3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc and the second polypeptide has a structure represented by VL3-L5-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc and the second polypeptide has a structure represented by VH3-L5- VL3-Fc. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1- Fc and the second polypeptide has a structure represented by VL3-VH3-Fc. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc and the second polypeptide has a structure represented by VH3-VL3-Fc.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc and the second polypeptide has a structure represented by VL3-L5-VH3-Fc. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc and the second polypeptide has a structure represented by VH3-L5- VL3-Fc. In some aspects, the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-Fc and the second polypeptide has a structure represented by VL3-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc and the second polypeptide has a structure represented by VH3-VL3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc and the second polypeptide has a structure represented by VL3-L5-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc and the second polypeptide has a structure represented by VH3-L5-VL3-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc and the second polypeptide has a structure represented by VL3-VH3-Fc. In some aspects, the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc and the second polypeptide has a structure represented by VH3-VL3-Fc. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2- L2-VL2-L3-VL1-Fc and the second polypeptide has a structure represented by VL3-L5-VH3-Fc.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3- VLl-Fc and the second polypeptide has a structure represented by VH3-L5-VL3-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- Fc and the second polypeptide has a structure represented by VL3-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3-VL3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-L5-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VH3-L5-VL3-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VL3-VH3-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VH3-VL3-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VL3-L5-VH3-Fc.
  • the first polypeptide has a structure represented by VH1-L1- VH2-L2-VL2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VH3-L5- VL3-Fc.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2- VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1- CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-VH2-VH2-VH1-CL-CH1; VL1-L1-VL2-L2-VH2-L3- VH1-L4-CH1; VH1-L1-VH2-L2-VL3-V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1 and the second polypeptide has a structure represented by VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1- VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VH3-L7-CL; VH3
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1- CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL- VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VH3-L7-CL; VH3-L6
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VH
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CH1-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CH1; VL3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CH1; VL3-L6-VH3-L7-CH1
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CL-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1-L4-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3- VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3- VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3- CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4- CH1-L5-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-CL; VH3- CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1-L4- CL-L5-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-CL; VH3- CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4- CL-L5-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-CL; VH3- CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VH1-VH2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-VH1-CL-CH1- F
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL- Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL-F
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL- Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL-Fc
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL- Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL-Fc
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-CL-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL- Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-CL-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL- Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL- Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL- Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3- VH3-CL-Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL- CHl-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3
  • VL3-L6-VH3-L7-CL-Fc VH3-L6-VL3-L7-CL-Fc; VL3-L6-VH3-L7-CH1-L8-CL-Fc; VH3-L6- VL3-L7-CH1-L8-CL-Fc; VH3-L6-VH3-L7-CL-L8-CH1-Fc; VH3-L6-VL3-L7-CL-L8-CH1-Fc; VL3 -L6-CL-L7-VH3 -L8-CH1 -Fc; VL3 -L6-CH1 -L7- VH3 -L8-CL-Fc; VH3 -L6-CH1 -L7-VL3 - L8-CL-Fc; VH3 -L6-CH1 -L7-VL3 - L8-CL-Fc; VH3 -
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL-Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3- CL-CHl-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3
  • VL3-L6-VH3-L7-CL-Fc VH3-L6-VL3-L7-CL-Fc; VL3-L6-VH3-L7-CH1-L8-CL-Fc; VH3-L6- VL3-L7-CH1-L8-CL-Fc; VH3-L6-VH3-L7-CL-L8-CH1-Fc; VH3-L6-VL3-L7-CL-L8-CH1-Fc; VL3 -L6-CL-L7-VH3 -L8-CH1 -Fc; VL3 -L6-CH1 -L7- VH3 -L8-CL-Fc; VH3 -L6-CH1 -L7-VL3 - L8-CL-Fc; VH3 -L6-CH1 -L7-VL3 - L8-CL-Fc; VH3 -
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CL-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL-Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3- CL-CHl-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-
  • VL3-L6-VH3-L7-CL-Fc VH3-L6-VL3-L7-CL-Fc; VL3-L6-VH3-L7-CH1-L8-CL-Fc; VH3-L6- VL3-L7-CH1-L8-CL-Fc; VH3-L6-VH3-L7-CL-L8-CH1-Fc; VH3-L6-VL3-L7-CL-L8-CH1-Fc; VL3 -L6-CL-L7-VH3 -L8-CH1 -Fc; VL3 -L6-CH1 -L7- VH3 -L8-CL-Fc; VH3 -L6-CH1 -L7-VL3 - L8-CL-Fc; VH3 -L6-CH1 -L7-VL3 - L8-CL-Fc; VH3 -
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CL-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL-Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3- CL-CHl-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-
  • VL3-L6-VH3-L7-CL-Fc VH3-L6-VL3-L7-CL-Fc; VL3-L6-VH3-L7-CH1-L8-CL-Fc; VH3-L6- VL3-L7-CH1-L8-CL-Fc; VH3-L6-VH3-L7-CL-L8-CH1-Fc; VH3-L6-VL3-L7-CL-L8-CH1-Fc; VL3 -L6-CL-L7-VH3 -L8-CH1 -Fc; VL3 -L6-CH1 -L7- VH3 -L8-CL-Fc; VH3 -L6-CH1 -L7-VL3 - L8-CL-Fc; VH3 -L6-CH1 -L7-VL3 - L8-CL-Fc; VH3 -
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- CL-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3- CHl-Fc; VL3-VH3-CL-Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VL3-CL-F
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1- L4-CH1-L5-CL-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL-Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3- CHl-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1- VH3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL-F
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CL-L5-CH1-Fc and the second polypeptide has a structure represented by VL3- VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL-Fc; VH3-VL3-CL-Fc; VL3-VH3-CH1-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CL-VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VL3-CL-Fc; VH3-CH1-VL3-CL-F
  • the first polypeptide has a structure represented by VH1-L1- VH2-L2-VL2-L3-VL1-L4-CL-L5-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3-CH1-Fc; VH3-VL3-CH1-Fc; VL3-VH3-CL-Fc; VH3-VL3-CL-Fc; VL3-VH3- CHl-CL-Fc; VH3-VL3-CH1-CL-Fc; VL3-VH3-CL-CH1-Fc; VH3-VL3-CL-CH1-Fc; VL3-CL- VH3-CH1-Fc; VL3-CL- VH3-CH1-Fc; VL3-CH1-VH3-CL-Fc; VH3-CH1-VH3-CL-Fc; VH3-CH1-VL3-CL-F
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1-VL2-L2-VH2-L3- VH1; VH1-L1-VH2-L2-VL2-L3-VL1; VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL I- L 1 - VL2-L2- VH2-L3 - VH 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VL 1 -Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VL3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-CH1; V
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-CH1; VL3-CL-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL- CH1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4- VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3- VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3- CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-VH3-CL-CH1; VL3-V
  • the first polypeptide has a structure represented by VH1-VH2- VL2-VL1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3- CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3- Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3- VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3- VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4- VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VH1-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3- L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3- VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1- CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-CH1; VL3-CL-CH1; VL
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1 and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-CH1; VL3-CL-VH3-CH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3- CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-CH1; VH3-VL3-CL-CH1
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VH1-CH1-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3- CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-V
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-CL and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-CH1; VL3-CL-VH3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-V
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-CH1; VL3-CL-VH3
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4- VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3- L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3- VH3-CL-CH1; VH3-VL3-CH1-CL; VL3- VH3-CL-CH1; VH3-VL3-CH
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-CL and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-CH1; V
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CH1-L5-CL and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CH1-L5-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VH3-CL- CH1; VH3-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-L4-CL-L5-CH1 and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CL-L5-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VL3-CH1-CL; VL3-
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-CHl-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3- CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-CH1; VL3-CH1-V
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-Fc and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-CH1; VL3-CL-VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-V
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3- L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VL3-CH1-CL; VL3- VH3-CL-CH1; VH3-VL3-CH1-CL; VL3- VH3-CL-CH1; VH3-V
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-CH1-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3- L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1- CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL- CH1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1- Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL-CH1-Fc and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-VH3-CH1; VL
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VH3-CL- CH1; VH3-VL
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL2-L3-VL1-L4-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3- L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1- CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VL3-CL- CH1; VH3-VL3
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL2-L3-VL1-L4-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3- L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1- CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-V
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VL3-CH1-CL; V
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL2-L3-VL1-L4-CH1-L5-CL-Fc and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-CH1; VL3-CL
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CL-L5-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VL3-CH1-CL; V
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL2-L3-VL1-L4-CL-L5-CH1-Fc and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-CH1; VL3-CL
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1- VL2-L2-VH2-L3-VH1; or VH1-L1-VH2-L2-VL2-L3-VL1; wherein the second polypeptide has a structure represented by VL3; wherein the third polypeptide has a structure represented by VH3; wherein VL1 is a first immunoglobulin light chain variable region; VL2 is a second immunoglobulin light chain variable region; VL3 is a third immunoglobulin light chain variable region; VH1 is a first immunoglobulin heavy chain variable region; VH2 is a second immunoglobulin heavy chain variable region; VH3 is a third immunoglobulin light chain variable region
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL 1 -L 1 - VL2-L2- VH2-L3 -VH1 -Fc; VH1 -L 1 - VH2-L2- VL2-L3 -VL 1 -Fc; VL 1 -L 1 -VL2-L2- VH2- L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VL3-Fc or VL3-Ll-Fc; wherein the third polypeptide has a structure represented by VH3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3-L1.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3-L1.
  • the first polypeptide has a structure represented by VH1- VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3-L1.
  • the first polypeptide has a structure represented by VH1- VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3-L1.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3-L1.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3-L1.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VH1-L1- VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3-L1.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3- Ll.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3- VH1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3-L1.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3- Ll.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3- VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3-L1.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3- Ll.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL 1 -L 1 - VL2-L2- VH2-L3 -VH1 -Fc; VH1 -L 1 - VH2-L2- VL2-L3 -VL 1 -Fc; VL 1 -L 1 -VL2-L2- VH2- L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VL3 or VL3-L1; wherein the third polypeptide has a structure represented by VH3-Fc or VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3- Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1- VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc
  • the second polypeptide has a structure represented by VL3- Ll
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1- Ll-VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-L1- Fc.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4- Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2- VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2- VH2-L3 - VH 1 -L4-CH 1 ; VH 1 -L 1 -
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3- CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3- CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3- L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-CH1
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1- CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1- CH1
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1- CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-CL
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CL
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1- CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1- VH2-VL2-VL1-CL
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1- CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CL
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CH1-CL
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CH1-CL
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-CL
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CH1-CL
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-CL
  • the second polypeptide has a structure represented by VL3- CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2- VL2-V 1-CH1-CL
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CH1-CL
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CH1-CL
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CL-CH1
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3- CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CL-CH1
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CL-CH1
  • the second polypeptide has a structure represented by VL3-L1- CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2- VL2-V 1-CL-CH1
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CL-CH1
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CL-CH1
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CL-CH1
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1-L4-CH1
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3- CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3- CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL2-L3-VL1-L4-CH1
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1- CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-V 1-L4-CH1
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1- L4-CH1
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1- L4-CH1
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1- L4-CL
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1-L4- CL
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CL
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1-L4-CL
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1-L4-CL
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1-L4-CL
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1-L4-CL
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1-L4-CL
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5-CL
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5-CL
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5-CL
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- CL
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4- CH1-L5-CL
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1- L4-CH1-L5-CL
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1- L4-CH1-L5-CL
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1- L4-CH1-L5-CL
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CL-L5-CH1
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CL-L5-CH1
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CL-L5-CH1
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CL-L5-CH1
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1- L4-CL-L5-CH1
  • the second polypeptide has a structure represented by VL3-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1- L4-CL-L5-CH1
  • the second polypeptide has a structure represented by VL3-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1- L4-CL-L5-CH1
  • the second polypeptide has a structure represented by VL3-L1-CH1
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1- L4-CL-L5-CH1
  • the second polypeptide has a structure represented by VL3-L1-CL
  • the third polypeptide has a structure represented by VH3-CH1; VH3-CL; VH3-L1-CH1; or VH3-L1-CL.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1- VL2-L2-VH2-L3-VH1; VH1-L1-VH2-L2-VL2-L3-VL1; VL1-VL2-VH2-VH1-Fc; VH1-VH2- VL2-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VH1-Ll-VH2-L2-VL3-VL1-Fc; VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CHI -CL, CL-CH1, CHl-Fc, CL- Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHI -CL-Fc region is linked to the carboxy terminus of the second polypeptide via one or more amino acid linker, and wherein the CHI,
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHI -CL-Fc at the carboxy terminus of the first, second and/or third polypeptide, wherein the CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc region is linked to the carboxy terminus of the third polypeptide via one or more amino acid linker, and wherein the CHI,
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc region is linked to the carboxy terminus of the second and third polypeptide via one or more amino acid linker, and wherein the CHI
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CHI- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHI -CL-Fc, wherein the CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CH
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1-CL, CL-CH1, CHl- Fc, CL-Fc, CL-CHl-Fc, or CHl-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl- Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL- CHl-Fc, or CHl-
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHI -CL-Fc, wherein the CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc region
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc region is linked to
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc region is
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-
  • the first polypeptide has a structure represented by VH1- L1-VH2-L2-VL2-L3-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CH
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CH1- Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL- CHl-Fc, or CHl-
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; and a second polypeptide having a structure represented by VL3-VH3-Fc, VL3-L5-VH3-Fc, VH3-VL3-Fc, or VH3-L5-VL3-Fc;
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and a second polypeptide having a structure represented by VL3-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and a second polypeptide having a structure represented by VL3-L5-VH3-Fc, In some aspects, the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-V
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; and a second polypeptide having a structure represented by VH3-L5-VL3-Fc.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; a second polypeptide having a structure represented by VH3-CH1-Fc, VH3-Ll-CH1-Fc, VL3-CH1-Fc, or VL3-Ll-CH1-Fc; and a third polypeptide having a structure represented
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-CH1-Fc, and a third polypeptide having a structure represented by VL3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2- VLl-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-CH1-Fc, and a third polypeptide having a structure represented by VL3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-CH1-Fc, and a third polypeptide having a structure represented by VH3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3- CHl-Fc, and a third polypeptide having a structure represented by VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2- VLl-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VL3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VL3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3- Ll-CHl-Fc, and a third polypeptide having a structure represented by VH3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2- VLl-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2- VL2-L3 - VH 1 -Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4-Fc, or VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4- Fc, a second polypeptide having a structure represented by VL3-CH1-Fc, and a third polypeptide having a structure represented by VL3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3- CHl-Fc, and a third polypeptide having a structure represented by VL3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2- VLl-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3-CH1-Fc, and a third polypeptide having a structure represented by VH3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3-CH1-Fc, and a third polypeptide having a structure represented by VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3- Ll-CHl-Fc, and a third polypeptide having a structure represented by VL3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2- VLl-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VL3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2- VL2-L3 - VH 1 -Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4-Fc, or VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4- Fc, a second polypeptide having a structure represented by VL3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VH3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VH3-L1-CL.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3 - VH 1 -Fc, VH 1 -L 1 - VH2-L2- VL2-L3 - VH 1 -Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; and a second polypeptide having a structure represented by CL-VL3-VH3-CH1-Fc, CL-Ll-VL3-L2-VH3-L3-CH1-Fc, CL
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1- VH2-L2-VL2-L3-VH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L1-VH2-L2-VL2- L3-VL1-L4-Fc, and a second polypeptide having a structure represented by CL-VL3-VH3-CH1- Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2-L3-VH1- Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and a second polypeptide having a structure represented by CL-Ll-VL3-L2-VH3-L3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2- VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc; VL1-L1- VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and a second polypeptide having a structure represented by CL-VH3-VL3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -Fc, VH 1 -L 1 - VH2-L2- VL2-L3 - VH 1 -Fc; VL 1 -L 1 - VL2-L2- VH2- L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and a second polypeptide having a structure represented by CL-Ll-VH3-L2-VL3-L3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2- L2- VH2-L3 - VH 1 -Fc, VH 1 -L 1 - VH2-L2- VL2-L3 - VH 1 -Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4- Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and a second polypeptide having a structure represented by CH1-VL3-VH3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1- L1-VH2-L2-VL2-L3-VL1-L4-FC, and a second polypeptide having a structure represented by CH1-Ll-VL3-L2-VH3-L3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and a second polypeptide having a structure represented by CH1-VH3-VL3-CL-Fc.
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1- VH2-L2-VL2-L3-VH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L1-VH2-L2-VL2- L3-VL1-L4-Fc, and a second polypeptide having a structure represented by CH1-L1-VH3-L2- VL3-L3-CL-Fc.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and a second polypeptide having a structure represented by VL3-CL-VH3-CH1-Fc, VL3-Ll-CL-L2-VH3-L3-CH1-Fc, VH3-CL-VL3-CH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2-L3-VH1- Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-CL-VH3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-Ll-CL-L2-VH3-L3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2- L2- VH2-L3 - VH 1 -Fc, VH 1 -L 1 - VH2-L2- VL2-L3 - VH 1 -Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4- Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-CL-VL3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-Ll-CL-L2-VL3-L3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3- CH1-VH3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2- VL2-L3 - VH 1 -Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4-Fc, or VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4- Fc and a second polypeptide having a structure represented by VL3-Ll-CH1-L2-VH3-L3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2-L3-VH1- Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-CH1-VL3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-Ll-CH1-L2-VL3-L3-CL-Fc.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; and a second polypeptide having a structure represented by VL3-VH3-CL-CH1-Fc, VL3-Ll-VH3-L2-CL-CH1-Fc, VH3-VL3-CL-CH1-F
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2-L3-VH1- Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-VH3-CL-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-Ll-VH3-L2-CL-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-VL3-CL-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1- VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-L1-VH2-L2-VL2- L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-L1-VL3-L2-CL- CHl-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-VH3-CH1-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2- VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-Ll-VH3-L2-CH1-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-VL3-CH1-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-L1-VH2-L2-VL2-L3-VL1-L4-FC and a second polypeptide having a structure represented by VH3-Ll-VL3-L2-CH1-CL-Fc, [0140]
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-CH1-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-CH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2- VHl-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-L1- VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VL3- VH3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-CHl-Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CH1-Fc, VH1-L1- VH2-L2-VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VL3-Ll-VH3-L2-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2-VL1- CH1 -Fc, VL 1 -LI -VL2-L2-VH2-L3-VH1 -CHI -Fc, VH1 -L 1 -VH2-L2-VL2-L3-VH1 -CHI -Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-L1-VL2-L2-VH2-L3-VH1-CL- Fc, or VH1-Ll-VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VH3-VL3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-CHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1- VH2-VL2-VL1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-L1-VH2-L2-VL2-L3- VHl-CL-Fc and a second polypeptide having a structure represented by VH3-Ll-VL3-L2-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1- Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CH1-Fc, VH1-L1-VH2-L2- VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VL3-VH3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2-VL1- CH1 -Fc, VL 1 -LI -VL2-L2-VH2-L3-VH1 -CHI -Fc, VH1 -L 1 -VH2-L2-VL2-L3-VH1 -CHI -Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-L1-VL2-L2-VH2-L3-VH1-CL- Fc, or VH1-Ll-VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VL3-Ll-VH3-L2-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-CH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-L1-VH2-L2-VL2- L3-VH1-CL-Fc and a second polypeptide having a structure represented by VH3-VL3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1 - VH2- VL2-VL 1 -CHI -Fc, VL 1 -L 1 - VL2-L2-VH2-L3 -VH 1 -CHI -Fc, VH1 -L 1 - VH2-L2- VL2- L3-VH1-CH1-Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VH3-Ll-VL3-L2-CH1-Fc.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-CL-CH1-Fc, VL1-L1-VL2-L2-VH2-L3-VH1-CL- CHl-Fc, VH1-VH2-VL2-VL1-CL-CH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VL1-CL-CH1-Fc, VL1- VL2-VH2-VH1-CH1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CH1-CL-Fc, VH1-VH2-VL2- VLl-CHl-CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-CH1-CL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL- CHl-Fc, VL1-L1-VL2-L2-VH2-L3-VH1 -CL-CH 1-Fc, VH1-VH2-VL2-VL1-CL-CH1-Fc, VH1- L 1 - VH2-L2- VL2-L3 - VL 1 -CL-CH 1 -Fc, VL 1 - VL2- VH2- VH 1 -CH 1 -CL-Fc, VL 1 -L 1 -VL2-L2- VH2-L3-VH1-CH1-CL-Fc, VH1-VH2-VL2-VL1 -CHI -CL-Fc, or VH1-L1-VH2-L2-VL2-L3- VL1 -CHI -CL-Fc and a second polypeptide having a structure represented by VL3-VH3-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 -CL-CH 1- Fc, VL 1 -L1-VL2-L2-VH2-L3-VH1 -CL-CH 1-Fc, VH1-VH2-VL2-VL1-CL-CH1-Fc, VH1-L1- VH2-L2- VL2-L3 - VL 1 -CL-CH 1 -Fc, VL 1 - VL2- VH2- VH 1 -CH 1 -CL-Fc, VL 1 -L 1 - VL2-L2- VH2- L3-VH1 -CHI -CL-Fc, VH1-VH2-VL2-VL1 -CHI -CL-Fc, or VH1-L1-VH2-L2-VL2-L3-VL1- CHl-CL-Fc and a second polypeptide having a structure represented by VL3-Ll-V
  • the first polypeptide has a structure represented by VL 1-VL2-VH2-VH1 -CL-CH 1-Fc, VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -CL-CH1 -Fc, VH1 - VH2- VL2-VL 1 -CL-CH 1-Fc, VH1 -L 1 - VH2- L2- VL2-L3 - VL 1 -CL-CH 1 -Fc, VL 1 - VL2- VH2- VH 1 -CH 1 -CL-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -CHI -CL-Fc, VH1-VH2-VL2-VL1 -CHI -CL-Fc, or VH1-L1-VH2-L2-VL2-L3-VL1-CH1- CL-Fc and a second polypeptide having a structure represented by VL 1-V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 -CL-CH 1-Fc, VL1-L1- VL2-L2-VH2-L3-VH1 -CL-CH 1-Fc, VH1-VH2-VL2-VL1 -CL-CH 1-Fc, VH1-L1-VH2-L2-VL2- L3 - VL 1 -CL-CH 1-Fc, VL 1 - VL2- VH2- VH 1 -CH 1 -CL-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -CH 1 - CL-Fc, VH1-VH2-VL2-VL1 -CHI -CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-CH1-CL-Fc and a second polypeptide having a structure represented by VH3-Ll-VL
  • any one of the first polypeptides described herein may be combined with any one of the second and/or third polypeptides described herein to form an antigen binding polypeptide complex of the invention.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention does not specifically bind to an antigen associated with human immunodeficiency virus (HIV) (e.g., an HIV envelope protein) and/or an antigen associated with severe acute respiratory syndrome (SARS).
  • HIV human immunodeficiency virus
  • SARS severe acute respiratory syndrome
  • the invention is directed to antigen binding polypeptides or antigen binding polypeptide complexes (e.g., antibodies or antigen binding fragments thereof) that specifically bind a viral peptide, protein, polypeptide, or a fragment thereof.
  • the viral peptide, protein, polypeptide, or a fragment thereof is influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type
  • glycoprotein gB 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus III (gpC), pseudorabies virus glycoprotein H, pseudorabies virus glycoprotein E, transmissible gastroenteritis glycoprotein 195, transmissible gastroenteritis matrix protein, swine rotavirus glycoprotein 38, swine parvovirus capsid protein, Serpulinahydodysenteriae protective antigen, bovine viral diarrhea glycoprotein 55, Newcastle disease virus hemagglutinin- neuraminidase, swine flu hemagglutinin, swine flu neuraminidase, foot and mouth disease virus, hog colera virus, swine influenza virus, African swine fever virus, Myco
  • bovine parainfluenza virus type 3 hemagglutinin neuraminidase bovine E viral diarrhoea virus glycoprotein 48 and glycoprotein 53, glycoprotein E of Dengue virus, or glycoprotein E1E2 of human hepatitis C virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on at least one viral protein selected from: influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to a viral peptide, protein, polypeptide, or a fragment thereof such as influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatit
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL2 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL4 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL5 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL6 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH1 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH2 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH3 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH4 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH5 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH6 that specifically binds to influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD, and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepatitis B surface antigen, diptheria toxin, streptococcus 24M epitope, gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus
  • the antigen binding polypeptide described herein or the polypeptides of the antigen binding polypeptide complex described herein may comprise any combination of VH1, VH2, VH3, VH4, VH5, VH6, VL1, VL2, VL3, VL4, VL5 and/or VL6 that bind the targets described herein.
  • the antigen binding polypeptide or antigen binding polypeptide complex e.g., antibodies or antigen binding fragments thereof
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of influenza virus hemagglutinin.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of a human respiratory syncytial virus (RSV)-viral protein.
  • RSV human respiratory syncytial virus
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of RSV F glycoprotein. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of RSV G glycoprotein.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of a herpes simplex virus (HSV) viral protein.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of the herpes simplex virus glycoprotein gB, gC, gD, or gE.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of chlamydia MOMP. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of a PorB antigen.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of core protein, matrix protein or other protein of Dengue virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of measles virus hemagglutinin.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of simplex virus type 2 glycoprotein gB. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of poliovirus 1 VP1.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of an envelope glycoprotein of HIV 1.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of hepatitis B surface antigen.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of diptheria toxin. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of streptococcus 24M epitope.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of gonococcal pilin. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of pseudorabies virus g50 (gpD).
  • gpD pseudorabies virus g50
  • the antigen binding polypeptide or antigen binding polypeptide complex e.g., antibodies or antigen binding fragments thereof specifically binds to a viral peptide, protein, polypeptide, or a fragment of pseudorabies virus II (gpB).
  • the antigen binding polypeptide or antigen binding polypeptide complex e.g., antibodies or antigen binding fragments thereof specifically binds to a viral peptide, protein, polypeptide, or a fragment of pseudorabies virus III (gpC).
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of pseudorabies virus glycoprotein H.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of pseudorabies virus glycoprotein E.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of transmissible gastroenteritis glycoprotein 195. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of transmissible gastroenteritis matrix protein.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of swine rotavirus glycoprotein 38.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of swine parvovirus capsid protein.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of Serpulinahydodysenteriae protective antigen.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of bovine viral diarrhea glycoprotein 55.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of Newcastle disease virus hemagglutinin- neuraminidase.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of swine flu hemagglutinin.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of swine flu neuraminidase. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of foot and mouth disease virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of hog colera virus. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of swine influenza virus. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of African swine fever virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex e.g., antibodies or antigen binding fragments thereof specifically binds to a viral peptide, protein, polypeptide, or a fragment of African swine fever virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of Mycoplasma liyopneutiioniae.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of infectious bovine rhinotracheitis virus. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of infectious bovine rhinotracheitis virus glycoprotein E.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of glycoprotein G. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of infectious laryngotracheitis virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of an infectious laryngotracheitis virus glycoprotein G or glycoprotein I.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of a glycoprotein of La Crosse virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of neonatal calf diarrhoea virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of Venezuelan equine encephalomyelitis virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of punta toro virus. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of murine leukemia virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of mouse mammary tumor virus. In some aspects, the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of hepatitis B virus core protein or hepatitis B virus surface antigen.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of equine influenza virus or equine herpes virus, such as equine influenza virus type A/ Alaska 91 neuraminidase, equine influenza virus typeA/Miami 63 neuraminidase, equine influenza virus type A/Kentucky 81 neuraminidase equine herpes virus type 1 glycoprotein B, and equine herpes virus type 1 glycoprotein D.
  • a viral peptide, protein, polypeptide, or a fragment of equine influenza virus or equine herpes virus such as equine influenza virus type A/ Alaska 91 neuraminidase, equine influenza virus typeA/Miami 63 neuraminidase, equine influenza virus type A/Kent
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of bovine respiratory syncytial virus or bovine parainfluenza virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of bovine respiratory syncytial virus attachment protein (BRSV G).
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of bovine respiratory syncytial virus fusion protein (BRSV F).
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of bovine respiratory syncytial virus nucleocapsid protein (BRSVN).
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of bovine parainfluenza virus type 3 fusion protein.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of ovine parainfluenza virus type 3 hemagglutinin neuraminidase.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of bovine E viral diarrhoea virus glycoprotein 48 or glycoprotein 53.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of glycoprotein E of Dengue virus.
  • the antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibodies or antigen binding fragments thereof) specifically binds to a viral peptide, protein, polypeptide, or a fragment of glycoprotein E1E2 of human hepatitis C virus.
  • Any of the antigen binding polypeptide structures and any of the antigen binding polypeptide complex structures described herein may be used to target one or more of the viral targets described herein.
  • Sequences from antibodies or antibody fragments to known spike protein epitopes on any virus or overexpressed receptors on a cancer cell can be inserted into the constructs disclosed herein to produce multispecific multivalent polypeptides and polypeptide complexes which bind to the epitopes on the virus or virus variants and to T cells which engage the virus or cancer cell.
  • the Immune Epitope Database and Analysis Resource provides lists of epitope sequences associated with specific antigens and infectious organism.
  • Known VL/VH pairs and CDRs are selected and chosen to insert into a plasmid or plasmids encoding a fully functional multispecific multivalent antibody.
  • the source of a preferred initial antibody or monoclonal antibody is from a highly resistant subject that has developed broadly neutralizing antibodies resistant across evolving infectious viruses or cancer cells.
  • Viral antigens present in Influenza A virus include matrix protein 1, hemagglutinin, nucleoprotein RNA-directed RNA polymerase catalytic subunit, polymerase acidic protein, nuclear export protein, and polymerase basic protein 2.
  • Epitope sequences are inclusive of, for example, those selected from GILGFVFTL (SEQ ID NO:406); PKYVKFQNTLKLAT (SEQ ID NO:407); SRYWAIRTR (SEQ ID NO:408); CTELKLSDY (SEQ ID NO:409); ELRSRYWAI (SEQ ID NO:410); ILRGSVAHK (SEQ ID NO:411); VSDGGPNLY (SEQ ID NO:412); FMYSEFHFI (SEQ ID NO:413); AIMDKNIIL (SEQ ID NOAM); NMLSTVLGV (SEQ ID NO:415); FLKDVMESM (SEQ ID NO:416); LPFEKSTVM (SEQ ID NO:417); and FVRQCFNPM (SEQ ID NO:418) etc. as disclosed in the above database.
  • Viral antigens present in Influenza B virus are selected from the group consisting of nucleoprotein, hemagglutinin; non- structural protein 1; neuraminidase and matrix protein 1.
  • Epitopes from such proteins are selected from, for example, KLGEFYNQMM (SEQ ID NO:419); AVLLSNEGIINSEDE (SEQ ID NO:420); AVLLSNEGIINSEDEH (SEQ ID NO:421); AYDQSGRL (SEQ ID NO:422); AYDQSGRL V (SEQ ID NO:423); FPIMHDRTKI + OX(M4) (SEQ ID NO:424); ITKNLNSLSELEVKN (SEQ ID NO:425); ITKNLNSLSELEVKNLQ (SEQ ID NO:426); L AVLLSNEGIINSEDE (SEQ ID NO:427); L AVLLSNEGIINSEDEH (SEQ ID NO:428); and LPQSGRIVV
  • Antigens are selected from the group consisting of Influenza viruses and surface glycoproteins: H5N1 influenza: H1N1 : H1N2:H3N2: HA (hemagglutinin surface glycoprotein); NA (neuraminidase surface glycoprotein); H5 and H7. Others include: Respiratory syncytial virus (RSV). Antigens associated with RSV include protein M2-1; matrix protein, fusion glycoprotein F0; nucleoprotein and small hydrophobic protein.
  • RSV Respiratory syncytial virus
  • Epitopes present on these proteins are inclusive of SYIGSINNI (SEQ ID NO:430); NAITNAKII (SEQ ID NO:431); KYKNAVTEL (SEQ ID NO:432); NSELLSLINDMPITNDQKKLMSNN (SEQ ID NO:433); NPKASLLSL (SEQ ID NO:434); VYNTVISYI (SEQ ID NO:435); TYMLTNSELL (SEQ ID NO:436): WAICKRIPNKKPG (SEQ ID NO:437); and KNRGIIKTFSN (SEQ ID NO:438) etc.;
  • Chlamydia Antigens associated with chlamydia trachomatis include major outer membrane porin, serovar D; chaperonin GroEL; uncharacterized protein (UniProt:Q9Z7F3) probably oxidoreductase CT 610 and inclusion membrane protein A.
  • Epitope sequences include, for example, TLNPTI (SEQ ID NO:439); ATLVVNRIRGGF (SEQ ID NO:440); LNPTIA (SEQ ID NO:441); SANNDAEIGNLI (SEQ ID NO:442); PETISDPENRNKPSAE (SEQ ID NO:443); AEGQLG (SEQ ID NO:444); ARKLLLDNL (SEQ ID NO:445); ASFVNPIYL (SEQ ID NO:446); DVVDGMNFNRGY (SEQ ID NO:447); NMFTPYIGV (SEQ ID NO:448), and NLVGLIGVKGSSIAADQLPNVGIT (SEQ ID NO:449) etc.;
  • Adenovirdiae Antigens associated with human adenovirus C include early El A protein; hexon protein; DNA-binding protein; E1B 55 kDa protein and DNA polymerase. Epitope sequences include, for example, SGPSNTPPEI (SEQ ID NO:450), TDLGQNLLY (SEQ ID NO:451); LTDLGQNLLY (SEQ ID NO:452); FALSNAEDL (SEQ ID NO:453); DEPTLLYVLFEVFDV (SEQ ID NO:454); KYSPSNVKI (SEQ ID NO:455); MPNRNYIAF (SEQ ID NO:456); VDCYINLGARWSLDY (SEQ ID NO:457); VNIRNCCYI (SEQ ID NO:458); RNFQPMSRQVVDDTKYKDYQQVGILHQHNN (SEQ ID NO:459); LPKLTPFAL (SEQ ID NO:460); and FQRPTISSNSHAI
  • Mastadenovirus Human mastadenovirus C has various antigens associated with viral infection. These include early E1A protein; hexon protein; DNA binding protein; E1B 55 kDa protein; DNA polymerase and fiber protein. Epitope sequences are inclusive of, for example, SGPSNTPPEI (SEQ ID NO:462); TDLGQNLLY (SEQ ID NO:463); LTDLGQNLLY (SEQ ID NO:464); FALSNAEDL (SEQ ID NO:465); DEPTLLYVLFEVFDV (SEQ ID NO:466); KYSPSNVKI (SEQ ID NO:467); MPNRPNYIAF (SEQ ID NO:468); VDCYINLGARWSLDY (SEQ ID NO:469); LPKLTPFAL (SEQ ID NO:470); FQRPTISSNSHAIFR (SEQ ID NO:471) and GKYTTETFATNSYTPSYIAQE (SEQ ID NO:472) etc;
  • Fowl adenovirus C has hexon protein as one of the antigens with epitopes DYDDYNIGTT (SEQ ID NO:473); KISGVFPNP (SEQ ID NO:474); PLAPKESMFN (SEQ ID NO:475); and ETLLIEDDVSGQGKELGVNLNPAGPITADEQGL (SEQ ID NO:476) etc;
  • Herpesviridae Antigens depend upon particular organism with human herpesvirus 5 (human cytomegalovirus) and human herpesvirus 4 (Epstein Barr Virus) being predominant focus with antigens ranging from 65 kDa phosphoprotein; mRNA export factor ICP27 homolog; envelope glycoprotein B; latent membrane protein 2; Epstein-Barr nuclear antigen 3; M123; trans- activitor protein BZLF1; immediate early protein IE1; Epstein-Barr nuclear antigen 4; Epstein - Barr nuclear antigen 1; DNA polymerase processivity factor; ribonucleoside-diphosphate reductase large subunit-like protein; replication and transcription activator; and latent membrane protein 1 with epitope sequences selected from, for example, NLVPMVATV (SEQ ID NO:477); GLCTLVAML (SEQ ID NO:478); TPRVTGGGAM (SEQ ID NO:479); SSIEFARL (SEQ ID NO:480); CL
  • Herpes simplex virus 1 human herpesvirus 1).
  • Antigens include envelope glycoprotein B; ribonucleoside-diphosphate reductase large subunit; envelope glycoprotein D; tegument protein UL46; mRNA export factor; capsid vertex component 2 and ribonucleoside-diphosphate reductase small subunit.
  • Epitope sequences include SSIEFARL (SEQ ID NO:502); QTFDRGRL (SEQ ID NO:503); SLKMADPNRFRGKDLP (SEQ ID NO:504);
  • QPPSLPITVYYAVLERACTSVLLNAPSEAPQIVR (SEQ ID NO:505); RLNELLAYV (SEQ ID NO:506); RMLGDVMAV (SEQ ID NO:507); KYALADASLKMADPNRFRGKDLP (SEQ ID NOA08); SLPITVTTA (SEQ ID NO:509); DPEDSALL (SEQ ID NO:510); and DYATLGVGV (SEQ ID NO: 511) etc;
  • Herpes simplex virus 2 human herpesvirus 2).
  • Antigens include Tegument protein VP22; envelope glycoprotein B; tegument protein VP16; Tegument protein UL47; tegument protein UL46; tegument protein VP 16; envelope glycoprotein G; capsid vertex component 2; capsid scaffolding protein; envelope glycoprotein D; mRNA export factor; major viral transcription factor ICP4 homolog with antigen epitope sequences selected from, for example, RPRGEVRFL (SEQ ID NO:512); SSIEFARL (SEQ ID NO:513); EEVDMTPADALDDFD (SEQ ID NOAM); GLADTVVAC (SEQ ID NOAM); ASDSLNNEY (SEQ ID NOAM); DFEFEQMFTDAMG (SEQ ID NOA17); EVDMTPADAL (SEQ ID NOAM); PEEFEGAGDGEPPEDDDS (SEQ ID NOAM); FLWEDQTLL (SEQ ID NOA20);
  • Herpes simplex virus 5 human herpesvirus 5
  • Antigens include 65 kDa phosphoprotein; immediate early protein IE1; envelope glycoprotein H; other human herpesvirus 5 protein and envelope glycoprotein B.
  • Epitope sequences include NLVPMVATV (SEQ ID NOA37); TMYGGISLL (SEQ ID NOA38); VLEETSVML (SEQ ID NOA39); LDPHAFHLLL (SEQ ID NOA40); RIFAELEGV (SEQ ID NOA41); RPHERNGFTVL (SEQ ID NOA42); VFPTKDVAL (SEQ ID NOA43); VLAELVKQI (SEQ ID NOA44); VLPHETRLL (SEQ ID NOA45); KRLDVCRAKMGYM (SEQ ID NOA46); GGGAMAGASTSAGRKRKS (SEQ ID NOA47); AALFFFDID (SEQ ID NOA48); AGILARNLVPMVATV (SEQ ID NOA49); ALFFFDIDLL (SEQ
  • antigens include Herpes simplex virus 6; Leviviridae; Levivirus; Enterobacteria phase MS2; Allolevirus; Poxviridae; Chordopoxvirinae (cowpox virus or vaccinia virus); antigens include CPXV202 protein; intermediate transcription factor 3 small subunit; putative nuclease G5; interferon antagonist C7; protein A47; major core protein 4b; DNA directed RNA polymerase 147 kDa polypeptide; mRNA capping enzyme regulatory subunit; envelope protein H3; protein B6; telomere binding protein II; protein K3; poxin; protein A19; assembly protein G7; frotein F12; protein A46; protein A6; DNA polymerase; profiling; RNA binding protein E3; and serine protease inhibitor 1.
  • the antigens have epitope sequences selected from TSYKFESV (SEQ ID NO:562); ITYRFYLI (SEQ ID NO:563); ILDDNLYKV (SEQ ID NO:564); KVDDTFYYV (SEQ ID NO:565); AAFEFINSL (SEQ ID NO:566); KSYNYMLL (SEQ ID NO:567); MPAYIRNTL (SEQ ID NO:568); RVYEALYYV (SEQ ID NO:569); IGMFNLTFI (SEQ ID NO:570); SLSAYIIRV (SEQ ID NO:571); LMYDIINSV (SEQ ID NO:572); RLYDYFTRV (SEQ ID NO:573); YSLPNAGDVI (SEQ ID NO:574); YSQVNKRYI (SEQ ID NO:575); VSLDYINTM (SEQ ID NO:576); TLPEVISTI (SEQ ID NO:577); FLTSVI
  • Parapoxvirus (orf virus). Antigens include uncharacterized protein; ORFOl l putative EEV envelope phospholipase; ORF052 putative IMV membrane protein; ORF110 EEV glycoprotein; ORF094 putative phosphorylated IMV membrane protein; ORF056RNA polymerase subunit RPO147; ORF 101 RNA polymerase subunit RPO132 having epitope sequences AAFEFRDL (SEQ ID NO:587); AIIKYTDL (SEQ ID NO:588); AIYAFRLT (SEQ ID NO:589); AIYGFGVTF (SEQ ID NO:590); ANVDFMEYV (SEQ ID NO:591); and EQFSFSNV (SEQ ID NO:592).
  • antigens and their associated antibodies and antibody fragments which bind to epitopes include Avipoxvirus; Capripoxvirus; Leporiipoxvirus; Suipoxvirus; Molluscipoxvirus; Entomopoxvirinae; Papovaviridae; Polyomavirus; Papillomavirus; Paramyxoviridae; Paramyxovirus; Parainfluenza virus 1; Morbillivirus; Measles virus; Rubulavirus; Mumps virus; Pneumonovirinae; Pneumovirus; Metapneumovirus; Avian pneumovirus; Human metapneumovirus; Picornaviridae, and Enterovirus (enterovirus A, coxsackievirus A).
  • Antigen includes genome polyprotein having epitopes selected from TYTFGEHKQEKDLEY (SEQ ID NO:593); TEDSHPPYKQTQPGA (SEQ ID NO:594); PESRESLAWQTATNP (SEQ ID NO:595); FGEHKQEKDL (SEQ ID NO:596); AGGTGTEDSHPPYKQ (SEQ ID NO:597); FGEHKQEKDL (SEQ ID NO:598); AGGTGTEDSHPPYKQ (SEQ ID NO:599); FGEHKQEKDLEYGAC (SEQ ID NO: 600); HYRAHARDGVFDYYT (SEQ ID NO: 601); KQEDK (SEQ ID NO:602); GDPIADMIDQTVNNQ (SEQ ID NO:603); YPTFGEHLQANDLDY (SEQ ID NO:604); LEGTTNPNT (SEQ ID NO:605);
  • VSSHRLDDTGEVPALQ (SEQ ID NO:606); RIYMRMKHVR (SEQ ID NO:607);
  • TSKSKYPLVV (SEQ ID NO:608); and DGYPTFGEHKQEKDL (SEQ ID NO:609) etc.
  • Rhinovirus and Hepatovirus Human hepatitis A virus (hepatovirus A) with genome polyproteins as an antigen with epitopes YMYAVSGAL (SEQ ID NO:610); FWRGDLVFDFQV (SEQ ID NO:611); MNMSKQGIFQTVGSGLDHILSLA (SEQ ID NO:612); TVSTEQNVPDPQVGI (SEQ ID NO:613); ASICQMFCFWRGDLVFDFQV (SEQ ID NO:614); DHMSIYKFMGRSHFLCTFTF (SEQ ID NO:615); FPELKPGESTHTSDHMSIYK (SEQ ID NO:616) and as additionally disclosed in the IED.
  • YMYAVSGAL SEQ ID NO:610
  • FWRGDLVFDFQV SEQ ID NO:611
  • MNMSKQGIFQTVGSGLDHILSLA SEQ ID NO:612
  • TVSTEQNVPDPQVGI SEQ ID NO:
  • Cardiovirus Andapthovirus, Reoviridae, Orthoreovirus; Orbivirus; Rotavirus; Cypovirus; Fijivirus, phytoreovirus; oryzavirus; retroviridae; mammalian type B retrovirus; mammalian type C retroviruses; avian type C retroviruses; type D retrovirus group; BLV-HTLV retroviruses; Lentivirus; Human immunodeficiency virus 1; Human immunodeficiency virus 2; HTLV-I and II viruses; Herpes simplex virus; Epstein Barr virus; Cytomegalovirus; Hepatitis virus (HCV, HAV, HBV, HDV, HEV); Toxoplasma gondii virus, Treponema pallidium virus; Human T- lymphotrophic virus; Encephalitis virus; West Nile virus; Dengue virus; Varicella Zoster virus; Rubeola, mumps, rubella, spumavirus, flaviviridae, hepatit
  • the recited multispecific and multivalent antibody constructs have embedded sequences that target and bind to epitopes on viral peptides, proteins, polypeptides or glycosylated versions thereof in a subject in need of treatment thereof, wherein said viral peptides, proteins, polypeptides or glycosylated versions thereof are selected from the group consisting of influenza virus neuraminidase, influenza virus hemagglutinin, human respiratory syncytial virus (RSV)-viral proteins, RSV F glycoprotein, RSV G glycoprotein, herpes simplex virus (HSV) viral proteins, herpes simplex virus glycoproteins gB, gC, gD and gE, chlamydia MOMP and PorB antigens, core protein, matrix protein or other protein of Dengue virus, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus 1 VP1, envelope glycoproteins of HIV 1, hepati
  • said viral peptides, proteins, polypeptides or glycosylated versions thereof are selected from the group consisting of: influenza virus neuraminidase, influenza virus hemagglutinin, herpes simplex virus (HSV) viral proteins, core protein, matrix protein or other protein of Dengue virus, and swine influenza viral proteins.
  • influenza virus neuraminidase influenza virus hemagglutinin
  • HSV herpes simplex virus
  • All the antigen binding polypeptide structures described herein and all the antigen binding polypeptide complex structures described herein can specifically bind to one or more of the viral antigen targets described herein, namely one or more of (such as two or more, three or more or four of): influenza virus neuraminidase, influenza virus hemagglutinin, herpes simplex virus (HSV) viral proteins, core protein, matrix protein or other protein of Dengue virus, and swine influenza viral proteins.
  • influenza virus neuraminidase influenza virus hemagglutinin
  • HSV herpes simplex virus
  • the antigen binding polypeptide and the antigen binding polypeptide complex can specifically bind to influenza virus neuraminidase.
  • the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VL1 that specifically binds to influenza virus neuraminidase. In some aspects, the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VL2 that specifically binds to influenza virus neuraminidase. In some aspects, the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VH1 that specifically binds to influenza virus neuraminidase. In some aspects, the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VH2 that specifically binds to influenza virus neuraminidase.
  • the antigen binding polypeptide and the antigen binding polypeptide complex can specifically bind to influenza virus hemagglutinin.
  • the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VL1 that specifically binds to influenza virus hemagglutinin.
  • the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VL2 that specifically binds to influenza virus hemagglutinin.
  • the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VH1 that specifically binds to influenza virus hemagglutinin.
  • the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VH2 that specifically binds to influenza virus hemagglutinin. In some aspects, the antigen binding polypeptide and the antigen binding polypeptide complex can specifically bind to herpes simplex virus (HSV) viral proteins. In some aspects, the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VL1 that specifically binds to herpes simplex virus (HSV) viral proteins. In some aspects, the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VL2 that specifically binds to herpes simplex virus (HSV) viral proteins.
  • HSV herpes simplex virus
  • the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VH1 that specifically binds to herpes simplex virus (HSV) viral proteins. In some aspects, the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VH2 that specifically binds to herpes simplex virus (HSV) viral proteins. In some aspects, the antigen binding polypeptide and the antigen binding polypeptide complex can specifically bind to gue virus. In some aspects, the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VL1 that specifically binds to Dengue virus. In some aspects, the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VL2 that specifically binds to Dengue virus.
  • the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VH1 that specifically binds to Dengue virus. In some aspects, the antigen binding polypeptide or the antigen binding polypeptide complex comprises a VH2 that specifically binds to Dengue virus. In some aspects, the antigen binding polypeptide and the antigen binding polypeptide complex can specifically bind to swine influenza virus. In some aspects, the antigen binding polypeptide described herein or the antigen binding polypeptide complex described herein comprises a VL1 that specifically binds to swine influenza virus.
  • the antigen binding polypeptide described herein or the antigen binding polypeptide complex described herein comprises a VL2 that specifically binds to swine influenza virus. In some aspects, the antigen binding polypeptide described herein or the antigen binding polypeptide complex described herein comprises a VH1 that specifically binds to swine influenza virus. In some aspects, the antigen binding polypeptide described herein or the antigen binding polypeptide complex described herein comprises a VH2 that specifically binds to swine influenza virus.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex (e.g., antibody or antigen binding fragment thereof) that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 16 A, CD 19, CD20, CD24, CD27, CD28, CD30, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on at least one antigen selected from the group consisting of A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL2 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL3 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF- 1, CSF-2, C
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL4 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL5 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL6 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF- 1, CSF-2, C
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH1 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH2 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH3 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF- 1, CSF-2, C
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH4 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH5 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH6 that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF- 1, CSF-2, C
  • the antigen binding polypeptide described herein or the polypeptides of the antigen binding polypeptide complex described herein may comprise any combination of VH1, VH2, VH3, VH4, VH5, VH6, VL1, VL2, VL3, VL4, VL5 and/or VL6 that bind the targets described herein.
  • VH1, VH2, VH3, VH4, VH5, VH6, VL1, VL2, VL3, VL4, VL5 and/or VL6 may specifically bind one or more of: CD3, CD28, CD38, CD19, CD20, Trop2 and cMet.
  • VL1 may specifically bind CD3.
  • VL1 may specifically bind CD19.
  • VL1 may specifically bind HER2.
  • VL1 may specifically bind CD20.
  • VL1 may specifically bind CD28.
  • VL1 may specifically bind CD38.
  • VL1 may specifically bind Trop2.
  • VL1 may specifically bind cMet.
  • VL2 may specifically bind CD3.
  • VL2 may specifically bind CD19.
  • VL2 may specifically bind HER2.
  • VL2 may specifically bind CD20.
  • VL2 may specifically bind CD28.
  • VL2 may specifically bind CD38.
  • VL2 may specifically bind Trop2.
  • VL2 may specifically bind cMet.
  • VL3 may specifically bind CD3.
  • VL3 may specifically bind CD19.
  • VL3 may specifically bind HER2.
  • VL3 may specifically bind CD20.
  • VL3 may specifically bind CD28.
  • VL3 may specifically bind CD38.
  • VL3 may specifically bind Trop2.
  • VL3 may specifically bind cMet.
  • VL4 may specifically bind CD3.
  • VL4 may specifically bind CD19.
  • VL4 may specifically bind HER2.
  • VL4 may specifically bind CD20.
  • VL4 may specifically bind CD28.
  • VL4 may specifically bind CD38.
  • VL4 may specifically bind Trop2.
  • VL4 may specifically bind cMet.
  • VL5 may specifically bind CD3.
  • VL5 may specifically bind CD19.
  • VL5 may specifically bind HER2.
  • VL5 may specifically bind CD20.
  • VL5 may specifically bind CD28.
  • VL5 may specifically bind CD38.
  • VL5 may specifically bind Trop2.
  • VL5 may specifically bind cMet.
  • VL6 may specifically bind CD3.
  • VL6 may specifically bind CD19.
  • VL6 may specifically bind HER2.
  • VL6 may specifically bind CD20.
  • VL6 may specifically bind CD28.
  • VL6 may specifically bind CD38.
  • VL6 may specifically bind Trop2.
  • VL6 may specifically bind cMet.
  • VH1 may specifically bind CD3.
  • VH1 may specifically bind CD19.
  • VH1 may specifically bind HER2.
  • VH1 may specifically bind CD20.
  • VH1 may specifically bind CD28.
  • VH1 may specifically bind CD38.
  • VH1 may specifically bind Trop2.
  • VH1 may specifically bind cMet.
  • VH2 may specifically bind CD3.
  • VH2 may specifically bind CD19.
  • VH2 may specifically bind HER2.
  • VH2 may specifically bind CD20.
  • VH2 may specifically bind CD28.
  • VH2 may specifically bind CD38.
  • VH2 may specifically bind Trop2.
  • VH2 may specifically bind cMet.
  • VH3 may specifically bind CD3.
  • VH3 may specifically bind CD19.
  • VH3 may specifically bind HER2.
  • VH3 may specifically bind CD20.
  • VH3 may specifically bind CD28.
  • VH3 may specifically bind CD38.
  • VH3 may specifically bind Trop2.
  • VH3 may specifically bind cMet.
  • VH4 may specifically bind CD3.
  • VH4 may specifically bind CD19.
  • VH4 may specifically bind HER2.
  • VH4 may specifically bind CD20.
  • VH4 may specifically bind CD28.
  • VH4 may specifically bind CD38.
  • VH4 may specifically bind Trop2.
  • VH4 may specifically bind cMet.
  • VH5 may specifically bind CD3.
  • VH5 may specifically bind CD19.
  • VH5 may specifically bind HER2.
  • VH5 may specifically bind CD20.
  • VH5 may specifically bind CD28.
  • VH5 may specifically bind CD38.
  • VH5 may specifically bind Trop2.
  • VH5 may specifically bind cMet.
  • VH6 may specifically bind CD3.
  • VH6 may specifically bind CD19.
  • VH6 may specifically bind HER2.
  • VH6 may specifically bind CD20.
  • VH6 may specifically bind CD28.
  • VH6 may specifically bind CD38.
  • VH6 may specifically bind Trop2.
  • VH6 may specifically bind cMet.
  • the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD38.
  • the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD28, VH2 and VL2 specifically bind to CD38, and VH3 and VL3 specifically bind to CD3.
  • the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD3, VH2 and VL2 specifically bind to CD38, and VH3 and VL3 specifically bind to CD28.
  • the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD38.
  • the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD38, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD3. In some aspects, the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD38, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD28.
  • the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD28, VH2 and VL2 specifically bind to CD19, and VH3 and VL3 specifically bind to CD38. In some aspects, the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD28, VH2 and VL2 specifically bind to CD38, and VH3 and VL3 specifically bind to CD 19.
  • the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD 19, VH2 and VL2 specifically bind to CD38, and VH3 and VL3 specifically bind to CD28. In some aspects, the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD 19, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD38. In some aspects, the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD38, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD 19.
  • the VH1 and VL1 of the antigen binding polypeptide or antigen binding polypeptide complex specifically binds to CD38, VH2 and VL2 specifically bind to CD 19, and VH3 and VL3 specifically bind to CD28.
  • Any of the antigen binding polypeptide structures and any of the antigen binding polypeptide complex structures described herein may be used to target one or more of the targets described herein.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to EGFR and cMet.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to GP100 and CD3.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to CD20 and CD3.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to BCMA and CD3.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to PDL1 and CTLA4.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to PD1 and LAG3.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to PD1 and VEGF
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to DLL4 and VEGF.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to EGFR and HER3.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to HER2.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to EpCAM and CD3.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to PDL1 and TGFbeta.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to PDL1 and TGFbeta.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to GPRC5D and CD3.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to CD123 and CD3.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to CD30 and CD16A.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to DLL3 and CD3.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of EGFR and cMet.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of GP100 and CD3.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of CD20 and CD3.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of BCMA and CD3.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of PDL1 and CTLA4.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of PD1 and LAG3.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of PD1 and VEGF.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of DLL4 and VEGF.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of EGFR and HER3.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on HER2.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of EpCAM and CD3.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of PDL1 and TGFbeta.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of PDL1 and TGF beta.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of GPRC5D and CD3.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of CD123 and CD3.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of CD30 and CD 16 A.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of DLL3 and CD3.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to EGFR and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to cMet.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to GP100 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CD3.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CD20 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CD3.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to PDL1 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CTLA4.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to PD1 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to LAG3.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to PD1 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to VEGF.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to DLL4 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to VEGF.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to EGFR and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to HER3.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to HER.2 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to HER2.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to EpCAM and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CD3.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to PDL1 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to TGFbeta.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to PDL1 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to TGFbeta.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to GPRC5D and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CD3.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CD123 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CD3.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CD30 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CD 16 A.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to DLL3 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to CD3.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to Ang-2 and VEGF-A.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of Ang-2 and VEGF-A.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to Ang-2 and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to VEGF-A.
  • the invention is directed to an antigen binding polypeptide or antigen binding polypeptide complex that specifically binds to Factor IXa and Factor X.
  • the antigen binding polypeptide or antigen binding polypeptide complex specifically binds at least one epitope on each of Factor IXa and Factor X.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to Factor IXa and a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to Factor X.
  • Antigen binding sequences for A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF
  • sequences include, but are not limited to, GenBank Accession Nos. AAA39272.1, AAA39159.1, ABN79462.1, AVW80143.1, AVW80142.1, AVW80141.1, AAB34430.1, AAB34429.1, CAD45042.1, 4CMH_C and 4CMH_B.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1-VL2-L2-VH2-L3- VH1; or VH1-L1-VH2-L2-VL2-L3-VL1; wherein the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; or VH3-L4-VL3; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by V 1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VH3-VL3. In some aspects, the first polypeptide has a structure represented by V 1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-L4-VH3. In some aspects, the first polypeptide has a structure represented by V 1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2- VL1 and the second polypeptide has a structure represented by VH3-VL3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-V 1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VH3-L4-VL3. In some aspects, the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VH3-VL3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VL3-VH3.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1 and the second polypeptide has a structure represented by VH3- VL3.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-V 1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CX
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-L1-VL2-L2- VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VL3-VH3-Fc; VH3-VL3-Fc; VL3-Ll-VH3-Fc; or VH3-Ll-VL3-VL1-L4-Fc;
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-L1-VL2-L2-VH2-L3- VHl-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1- L1-VH2-L2-VL2-L3-VL1-L4-FC and the second polypeptide has a structure represented by VL3- VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc; VH1-VH2-VL2-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1-L1-VH2-L2-VL2- L3-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VH3-VL3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL 1 -L 1 - VL2-L2- VH2-L3 -VH1 -Fc; VH1 -L 1 - VH2-L2- VL2-L3 -VL 1 -Fc; VL 1 -L 1 -VL2-L2- VH2- L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VL3-Ll-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-L1-VL2-L2-VH2-L3- VHl-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VH3- Ll-VL3-Fc.
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF- 3, CXCL1, C
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2- VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1- CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-VH2-VH2-VH1-CL-CH1; VL1-L1-VL2-L2-VH2-L3- VH1-L4-CH1; VH1-L1-VH2-L2-VL3-V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3- VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3- CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VL3-L7-CL; VH3
  • the first polypeptide has a structure represented by VH1- VH2-VL2-VL1-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3- VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3- CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VL3-L7-CL; VH3
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VH3-L7-CL; VH3-L6
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VH
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CH1-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CH1; VL3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CH1; VL3-L6-VH3-L7-CH1
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CL-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1-L4-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3- VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3- VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3- CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4- CH1-L5-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-CL; VH3- CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-
  • the first polypeptide has a structure represented by V 1-L1-VL2-L2-VH2-L3-VH1-L4- CL-L5-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-CL; VH3- CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4- CL-L5-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-CL; VH3- CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CX
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VH1-VH2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-VH1-CL-CH1- F
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2- VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2- VHl-CHl-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1- VH2- VL2- VL 1 -CL-CH1 -Fc; VL 1 -L 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2-VL3 - VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2- VHl-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2- VLl-CHl-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1- L 1 - VL2-L2- VH2-L3 - VH 1 -L4-CH 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 -Fc; VH 1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1- VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2- VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1-VH2- L2- VL3 - VL 1 -L4-CH 1 -Fc; VH1-L1-VH2- L2- VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL- Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1 -
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2- VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1 -CHI -CL-Fc; VL1- VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-L2-VH2-L3- VH1-L4-CH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CH1-Fc; VL1-L1-VL2-VL3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2- VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1 -CHI -CL-Fc; VL1- VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-L2-VH2-L3- VH1-L4-CH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CH1-Fc; VL1-L1-VL2-VL3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2- VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1- VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-VH2-L3- VH1-L4-CH1-Fc; VH1-Ll-VH2-L2-VL3-VL1-L4-CH1-Fc; VH1-Ll-VH2-L2-VL3-VL1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2- VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1- VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-VH2-L3- VH1-L4-CH1-Fc; VH1-Ll-VH2-L2-VL3-VL1-L4-CH1-Fc; VH1-Ll-VH2-L2-VL3-VL1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1- VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-VH2- L3 - VH 1 -L4-CH 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 -Fc; VH 1 -L 1 - VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2- VLl-CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1- CHl-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2- VL 1 -CL-CH1 -Fc; VH1-VH2- VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2-VL3 - VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL- Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1 -
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2- VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL I -VL2-VH2- VH1 -CHI -CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1- VH2- VL2- VL 1 -CL-CH1 -Fc; VL 1 -L 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 -
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1 -CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1 -CHI -CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1- CHl-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL- Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1- CL-CHl-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH 1 -L 1 - VH2-L2- VL3 -VH1-L4-CH1-Fc; VH 1 -L 1 - VH2-L2-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL- Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1 -
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1- VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2- VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1-VH2- L2- VL3 - VL 1 -L4-CH 1 -Fc; VH1-L1-VH2- L2- VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1- CHl-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL- Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1- CL-CHl-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH 1 -L 1 - VH2-L2- VL3 -VH1-L4-CH1-Fc; VH 1 -L 1 - VH2-L2-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1- VH2-VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1 -CHI -CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-L2-VH2- L3 - VH 1 -L4-CH 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 -Fc; VH 1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2- VLl-CHl-Fc; VL1-VL2-VH2-VH1 -CL-Fc; VH1-VH2-VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1- CHl-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2- VL 1 -CL-CH1 -Fc; VH1-VH2- VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 -
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1 -CHI -CL-Fc; VH1-VH2-VL2-VL1-CH1-CL- Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2- VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2- VH1 -CHI -CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1- VH2- VL2- VL 1 -CL-CH1 -Fc; VL 1 -L 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2- VHl-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2- VL1 -CHI -CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1- L 1 - VL2-L2- VH2-L3 - VH 1 -L4-CH 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 -Fc; VH 1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1- VL2-VH2-VH1 -CHI -CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1- Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1- VH2-L2- VL3 - VL 1 -L4-CH1-Fc; VH1-L1- VH2-L2-L3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2- VHl-CL-Fc; VH1-VH2-VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1 -CHI -CL-Fc; VH1-VH2-VL2- VLl-CHl-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1- L 1 - VL2-L2- VH2-L3 - VH 1 -L4-CH 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 -Fc; VH 1 -L
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CX
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1-VL2-L2-VH2-L3- VH1; VH1-L1-VH2-L2-VL2-L3-VL1; VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL I- L 1 - VL2-L2- VH2-L3 - VH 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VL 1 -Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3- Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3- VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-CL; V
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-CH1; VL3-CL-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3- CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-CH1; VH3-VL3-CL-CH
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-V
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2- VH2-L3-VH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3- CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-CH1; VL3
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3- Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3- VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VL3-CH1-CL; VL3-VH3-CH
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3- VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4- VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-VH3
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3- L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3- VH3-CL-CH1; VH3-VL3-CH1-CL; VL3- VH3-CL-CH1; VH3-VL3-CH1-CL; VL3- VH3
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3- CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-V
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3- L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1- CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-V
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL3-V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1 and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-VH3-CH1; VL3-CL
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-V
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- L4-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3- L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3- VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VH3-VL3-CH1- CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CH
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3- CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4- VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3- VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3- CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CL-CH1; VL3-VH3-
  • the first polypeptide has a structure represented by VH1-L1- VH2-L2-VL2-L3-VL1-L4-CL and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-CH1; V
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5-CL and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VL3-CL- CH1; VH3-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL2-L3-VL1-L4-CH1-L5-CL and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CL-L5-CH1 and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-VL3-CH1-CL; VL3-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL2-L3-VL1-L4-CL-L5-CH1 and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VL3-
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3- L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1- CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-V
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-CL- Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-CL-Fc and the second polypeptide has a structure represented by VL3- VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3- CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CL-CH1; VL3-CL-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3- VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL- CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL- CH1
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CL-CH1- Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VL
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3- CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VH
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4- VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3- L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VL3-CH1-CL; VL3- VH3-CL-CH1; VH3-VL3-CH1-CL; VL3- VH3
  • the first polypeptide has a structure represented by VL1-L1- VL2-L2-VH2-L3-VH1-L4-CH1-L5-CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4- VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; V
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CH1-L5- CL-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4- VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3- VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VH3-VL3-CH1- CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; V
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CL-L5-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3- CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; V
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CL-L5- CHl-Fc and the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3- L4-VH3; VH3-L4-VL3; VL3-VH3-Fc; VH3-VL3-Fc; VL3-L4-VH3-Fc; VH3-L4-VL3-Fc; VL3- VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1- CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VH3-VL3-CL-CH1; V
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1- VL2-L2-VH2-L3-VH1; or VH1-L1-VH2-L2-VL2-L3-VL1; wherein the second polypeptide has a structure represented by VL3; wherein the third polypeptide has a structure represented by VH3; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7,
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CX
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL 1 -L 1 - VL2-L2- VH2-L3 -VH1 -Fc; VH1 -L 1 - VH2-L2- VL2-L3 -VL 1 -Fc; VL 1 -L 1 -VL2-L2- VH2- L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VL3-Fc or VL3-Ll-Fc; wherein the third polypeptide has a structure represented by VH3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1- Fc; VH1-VH2-VL2-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1-L1-VH2-L2-VL2-L3- VLl-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc; VH1-VH2-VL2-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1-L1-VH2-L2-VL2- L3-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Fc
  • the third polypeptide has a structure represented by VH3-L1.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1- Ll-VH2-L2-VL2-L3-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-L1-VH2-L2- VL3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3-Ll-Fc
  • the third polypeptide has a structure represented by VH3.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-L1-VL2-L2- VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, the second polypeptide has a structure represented by VL3-Ll-Fc, and the third polypeptide has a structure represented by VH3-L1.
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CX
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL 1 -L 1 - VL2-L2- VH2-L3 -VH1 -Fc; VH1 -L 1 - VH2-L2- VL2-L3 -VL 1 -Fc; VL 1 -L 1 -VL2-L2- VH2- L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VL3 or VL3-L1; wherein the third polypeptide has a structure represented by VH3-Fc or VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1- Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-FC
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-FC
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1- Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1- Ll-VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3- Ll-Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1-L4-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3- Fc.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1-L4-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3- Ll-Fc.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3- Fc.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3-Ll-Fc.
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc
  • the second polypeptide has a structure represented by VL3-L1
  • the third polypeptide has a structure represented by VH3- Ll-Fc.
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF- 3, CXCL1, C
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2- VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2- VH2-L3 - VH 1 -L4-CH 1 ; VH 1 -L 1 -
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2- VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1-CL; VL1-VL2-VH2- VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1; VH1- L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VH 1 -L4-CH 1 ; VL 1 -L 1 - VL2-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2- VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1- VL2-L2- VH2-L3 - VH 1 -L4-CH 1 ; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH I -VH2-VL2- VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1-CL; VL I -VL2-VH2-VH I - CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1; VH1-L1- VH2-L2-VL2-L3-VL1-L4-CH1; VL1-L1-VH2-L2-VH2-L3-VL1-L4-CH1; VL1-L1-VL2-L2-VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2- VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1- VL2-L2- VH2-L3 - VH 1 -L4-CH 1 ; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2- VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1-CL; VL1-VL2-VH2- VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1; VH1- L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VH 1 -L4-CH 1 ; VL 1 -L 1 - VL2-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2- VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1- VL2-L2- VH2-L3 - VH 1 -L4-CH 1 ; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH I -VH2-VL2- VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1-CL; VL I -VL2-VH2-VH I - CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1; VH1-L1- VH2-L2-VL2-L3-VL1-L4-CH1; VL1-L1-VH2-L2-VH2-L3-VL1-L4-CH1; VL1-L1-VL2-L2-VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2- VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1- VL2-L2- VH2-L3 - VH 1 -L4-CH 1 ; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2- VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1-CL; VL1-VL2-VH2- VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1; VH1- L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VH 1 -L4-CH 1 ; VL 1 -L 1 - VL2-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2- VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1- VL2-L2- VH2-L3 - VH 1 -L4-CH 1 ; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH I -VH2-VL2- VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1-CL; VL I -VL2-VH2-VH I - CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1; VH1-L1- VH2-L2-VL2-L3-VL1-L4-CH1; VL1-L1-VH2-L2-VH2-L3-VL1-L4-CH1; VL1-L1-VL2-L2-VH
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1- CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1- VH2-VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1- L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH1 ; VH1 -L 1 -VH2-L2-VL2-L3 - VL 1 -L4-CH1 ; VL 1 -L 1 -VH2-L2-VL3 - VL 1 -L4-CH1 ; VL 1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2- VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1-CL; VL1-VL2-VH2- VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1; VH1- L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VH 1 -L4-CH 1 ; VL 1 -L 1 - VL2-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2- VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1- VL2-L2- VH2-L3 - VH 1 -L4-CH 1 ; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH I -VH2-VL2- VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1-CL; VL I -VL2-VH2-VH I - CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1; VH1-L1- VH2-L2-VL2-L3-VL1-L4-CH1; VL1-L1-VH2-L2-VH2-L3-VL1-L4-CH1; VL1-L1-VL2-L2-VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2-VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2- VL2-VL1-CH1-CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1- VL2-L2- VH2-L3 - VH 1 -L4-CH 1 ; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH 1 ; VL 1 -L 1
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF- 1, CSF-2, CSF-3, CXCL1, C
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1- VL2-L2-VH2-L3-VH1; VH1-L1-VH2-L2-VL2-L3-VL1; VL1-VL2-VH2-VH1-Fc; VH1-VH2- VL2-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VH1-Ll-VH2-L2-VL3-VL1-Fc; VH
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CHI -CL, CL-CH1, CHl-Fc, CL- Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc region is linked to the carboxy terminus of the second polypeptide via one or more amino acid linker, and wherein the CHI, CL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide, wherein the CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc region is linked to the carboxy terminus of the third polypeptide via one or more amino acid linker, and wherein the CHI, CL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHI -CL-Fc region is linked to the carboxy terminus of the second and third polypeptide via one or more amino acid linker, and wherein the
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1-CL, CL-CH1, CH1- Fc, CL-Fc, CL-CHl-Fc, or CHl-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl- Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL- CHl-Fc, or CHl-
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1- CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc region is
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc region is linked to
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc region is
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, CHl-CL-Fc at the carboxy terminus of the first, second and/or third polypeptide.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-
  • the first polypeptide has a structure represented by VH1- L1-VH2-L2-VL2-L3-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CHI -CL, CL-CH1, CHl-Fc, CL-Fc, CL-CHl-Fc, or CH
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1
  • the second polypeptide has a structure represented by VL3
  • the third polypeptide has a structure represented by VH3; optionally wherein the first, second and/or third polypeptide comprises at least one of an Fc region, a CL region, and a CHI region at the carboxy terminus of the first, second and/or third polypeptide, wherein the at least one Fc region, CL region and CHI region is linked to the carboxy terminus of the first, second and/or third polypeptide via one or more amino acid linker, or wherein the first, second and/or third polypeptide comprises a CH1-CL, CL-CH1, CHl- Fc, CL-Fc, CL-CHl-Fc, or CHl-CL-Fc, wherein the CH1-CL, CL-CH1, CHl-Fc, CL-Fc, CL- CHl-Fc, or CHl-
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CX
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; and a second polypeptide having a structure represented by VL3-VH3-Fc, VL3-Ll-VH3-Fc, VH3-VL3-Fc, or VH3-Ll-VL3-Fc;
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD19.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD19.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2- VL2-L3 - VH 1 -Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4-Fc, or VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4- Fc and a second polypeptide having a structure represented by VL3-Ll-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2- VLl-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-VL3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-Ll-VL3-Fc.
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF- 1, CSF-2, CSF-3, CXCL1, C
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; a second polypeptide having a structure represented by VH3-CH1-Fc, VH3-Ll-CH1-Fc, VL3-CH1-Fc, or VL3-Ll-CH1-Fc; and a third polypeptide having a structure represented
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD19.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD19.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-CH1-Fc, and a third polypeptide having a structure represented by VL3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-CH1-Fc, and a third polypeptide having a structure represented by VL3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3- CHl-Fc, and a third polypeptide having a structure represented by VH3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-CH1-Fc, and a third polypeptide having a structure represented by VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VL3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3- Ll-CHl-Fc, and a third polypeptide having a structure represented by VL3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2- VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VH3-CL.
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1- VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-L1-VH2-L2-VL2- L3-VL1-L4-Fc, a second polypeptide having a structure represented by VH3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3-CH1-Fc, and a third polypeptide having a structure represented by VL3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3-CH1-Fc, and a third polypeptide having a structure represented by VL3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3- CHl-Fc, and a third polypeptide having a structure represented by VH3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3-CH1-Fc, and a third polypeptide having a structure represented by VH3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VL3-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3- Ll-CHl-Fc, and a third polypeptide having a structure represented by VL3-L1-CL.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2- VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VH3-CL.
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1- VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-L1-VH2-L2-VL2- L3-VL1-L4-Fc, a second polypeptide having a structure represented by VL3-Ll-CH1-Fc, and a third polypeptide having a structure represented by VH3-L1-CL.
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CX
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; and a second polypeptide having a structure represented by CL-VL3-VH3-CH1-Fc, CL-Ll-VL3-L2-VH3-L3-CH1-Fc, CL-VH3-VL3-CH
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD19.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD19.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by CL-VL3-VH3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by CL-Ll-VL3-L2-VH3-L3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by CL- VH3-VL3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2- VL2-L3 - VH 1 -Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4-Fc, or VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4- Fc and a second polypeptide having a structure represented by CL-Ll-VH3-L2-VL3-L3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2-L3-VH1- Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by CH1-VL3-VH3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by CH1-Ll-VL3-L2-VH3-L3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2- L2- VH2-L3 - VH 1 -Fc, VH 1 -L 1 - VH2-L2- VL2-L3 - VH 1 -Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4- Fc, or VH1-L1-VH2-L2-VL2-L3-VL1-L4-FC and a second polypeptide having a structure represented by CH1-VH3-VL3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- L1-VH2-L2-VL2-L3-VL1-L4-FC and a second polypeptide having a structure represented by CH1-Ll-VH3-L2-VL3-L3-CL-Fc.
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, C
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; and a second polypeptide having a structure represented by VL3-CL-VH3-CH1-Fc, VL3-Ll-CL-L2-VH3-L3-CH1-Fc, VH3-CL-VL3-CH
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD19.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD19.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-CL-VH3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-Ll-CL-L2-VH3-L3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-CL-VL3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1- VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1- VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-L1-VH2-L2-VL2- L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-L1-CL-L2-VL3- L3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-CH1-VH3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2- VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-Ll-CH1-L2-VH3-L3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2- VLl-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1-VL2- L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-CH1-VL3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2- L2- VH2-L3 - VH 1 -Fc, VH 1 -L 1 - VH2-L2- VL2-L3 - VH 1 -Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4- Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-Ll-CH1-L2-VL3-L3-CL-Fc.
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CX
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; and a second polypeptide having a structure represented by VL3-VH3-CL-CH1-Fc, VL3-Ll-VH3-L2-CL-CH1-Fc, VH3-VL3-CL-CH1-F
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD19.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD 19.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1- L1-VH2-L2-VL2-L3-VH1-FC, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-L1-VH2-L2- VL3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-VH3-CL- CHl-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-Ll-VH3-L2-CL-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2- VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-L4-FC, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-VL3-CL-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -Fc, VH1 -L 1 - VH2-L2- VL2-L3 - VH1 -Fc, VL 1 -L 1 - VL2-L2-VH2- L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-Ll-VL3-L2-CL-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-VH3-CH1-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1- VH2-L2-VL2-L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-L1-VH2-L2-VL2- L3-VL1-L4-Fc and a second polypeptide having a structure represented by VL3-L1-VH3-L2- CHl-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc, VH1-VH2-VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-L1-VH2-L2-VL2- L3-VH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-VL3-CH1-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc, VH1-VH2- VL2-VL1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-L4-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and a second polypeptide having a structure represented by VH3-Ll-VL3-L2-CH1-CL-Fc,
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-CH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2- VHl-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-L1- VH2-L2-VL2-L3-VH1-CL-Fc; and a second polypeptide having a structure represented by VL3
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD19.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD19.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2- VLl-CHl-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CH1-Fc, VH1-L1-VH2-L2-VL2-L3-VH1-CH1- Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-L1-VL2-L2-VH2-L3-VH1- CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VL3-VH3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-L1-VL2-L2-VH2-L3- VHl-CHl-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1- VH2-VL2-VL1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-L1-VH2-L2-VL2-L3- VHl-CL-Fc and a second polypeptide having a structure represented by VL3-Ll-VH3-L2-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1- Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CH1-Fc, VH1-L1-VH2-L2- VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VH3-VL3-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2-VL1- CH1 -Fc, VL 1 -LI -VL2-L2-VH2-L3-VH1 -CHI -Fc, VH1 -L 1 -VH2-L2-VL2-L3-VH1 -CHI -Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-L1-VL2-L2-VH2-L3-VH1-CL- Fc, or VH1-Ll-VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VH3-Ll-VL3-L2-CL-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-CH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-L1-VH2-L2-VL2- L3-VH1-CL-Fc and a second polypeptide having a structure represented by VL3-VH3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1 - VH2- VL2-VL 1 -CHI -Fc, VL 1 -L 1 - VL2-L2-VH2-L3 -VH 1 -CHI -Fc, VH1 -L 1 - VH2-L2- VL2- L3-VH1-CH1-Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-L1-VL2-L2- VH2-L3-VH1-CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VL3-Ll-VH3-L2-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-L1- VL2-L2-VH2-L3-VH1-CH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2- VHl-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-L1- VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VH3- VL3-CH1-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-CHl-Fc, VH1-VH2-VL2-VL1-CH1-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CH1-Fc, VH1-L1- VH2-L2-VL2-L3-VH1-CH1-Fc, VL1-VL2-VH2-VH1-CL-Fc, VH1-VH2-VL2-VL1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VH1-CL-Fc and a second polypeptide having a structure represented by VH3-Ll-VL3-L2-CH1-Fc.
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD 160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CX
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1-CL-CH1-Fc, VL1-L1-VL2-L2-VH2-L3-VH1-CL- CHl-Fc, VH1-VH2-VL2-VL1-CL-CH1-Fc, VH1-Ll-VH2-L2-VL2-L3-VL1-CL-CH1-Fc, VL1- VL2-VH2-VH1-CH1-CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CH1-CL-Fc, VH1-VH2-VL2- VLl-CHl-CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-CH1-CL
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD3, VH2 and VL2 specifically bind to CD28, and VH3 and VL3 specifically bind to CD19.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD38.
  • VH1 and VL1 specifically bind to CD28, VH2 and VL2 specifically bind to CD3, and VH3 and VL3 specifically bind to CD19.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 -CL-CHl-Fc, VL1-L1-VL2- L2-VH2-L3-VH1-CL-CH1-Fc, VH1-VH2-VL2-VL1-CL-CH1-Fc, VH1-L1-VH2-L2-VL2-L3- VL 1 -CL-CH1 -Fc, VL 1 -VL2-VH2-VH1 -CHI -CL-Fc, VL1 -L 1 -VL2-L2-VH2-L3-VH1 -CHI -CL- Fc, VH1-VH2-VL2-VL1 -CHI -CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-CH1-CL-Fc and a second polypeptide having a structure represented by VL3-VH3-Fc
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1 -CL-CH1 -Fc, VH1 -VH2-VL2-VL 1 -CL-CH1 -Fc, VH1 -L 1 -VH2-L2-VL2-L3-VL 1 - CL-CHl-Fc, VL1-VL2-VH2-VH1 -CHI -CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CH1-CL-Fc, VH1-VH2-VL2-VL1 -CHI -CL-Fc, or VH1-L1-VH2-L2-VL2-L3-VL1 -CHI -CL-Fc and a second polypeptide having a structure represented by VL3-Ll-V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1-Fc, VL1-L1-VL2-L2- VH2-L3-VH1 -CL-CH1 -Fc, VH1 -VH2-VL2-VL 1 -CL-CH1 -Fc, VH1 -L 1 -VH2-L2-VL2-L3-VL 1 - CL-CHl-Fc, VL1-VL2-VH2-VH1 -CHI -CL-Fc, VL1-Ll-VL2-L2-VH2-L3-VH1-CH1-CL-Fc, VH1-VH2-VL2-VL1 -CHI -CL-Fc, or VH1-L1-VH2-L2-VL2-L3-VL1 -CHI -CL-Fc and a second polypeptide having a structure represented by VH3-VL3-VL3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1-Fc, VL1-L1-VL2-L2-VH2-L3- VH1 -CL-CHl-Fc, VH1-VH2-VL2-VL1 -CL-CHl-Fc, VH 1 -LI- VH2-L2-VL2-L3-VL1 -CL-CHl- Fc, VL1-VL2-VH2-VH1 -CHI -CL-Fc, VL I -L I -VL2-L2-VH2-L3-VH I -CH I -CL-Fc, VH1-VH2- VL2-VL1 -CHI -CL-Fc, or VH1-Ll-VH2-L2-VL2-L3-VL1-CH1-CL-Fc and a second polypeptide having a structure represented by VH3-Ll-VL3
  • VL1, VL2, VL3, VH1, VH2, and/or VH3 may specifically bind to A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H3, B7H4, B7H5, B7H6, B7H7, B7RP1, B7-4, C3, C5, CCL2, CCL3, CCL4, CCL5, CCL7, CCL8, CCL11, CCL15, CCL17, CCL19, CCL20, CCL21, CCL25 CCR3, CCR4, CD3, CD 19, CD20, CD24, CD27, CD28, CD38, CD39, CD40, CD40L, CD47, CD52, CD70, CD80, CD86, CD123, CD133, CD137, CD137L, CD160, CD272, CEACAM5, CLEC9, CLEC91, CRTH2, CSF-1, CSF-2, CSF-3, CXCL1, CX
  • the antigen binding polypeptide complex structures described herein can be combined with any one or more of the targets described herein. Any and all disclosure herein in relation to targets for antigen binding polypeptides of the invention is generally applicable, and applies equally and without reservation to each and every antigen binding polypeptide and antigen binding polypeptide complex described herein.
  • the VL1, VL2, VL3, VH1, VH2, and/or VH3 of each and every antigen binding polypeptide and antigen binding polypeptide complex described herein may independently bind to any one of said particularly preferred targets.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:20-25 and 76.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a first polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:20-25 and 76, and a second polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:20-25 and 76.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a first polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to two or more of SEQ ID NOs:20-25 and 76, and a second polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:20-25 and 76.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprise a polypeptide having an amino acid sequence having at least 90% identity to any one of SEQ ID NOs:20-25 and 76.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention may comprise a polypeptide having an amino acid sequence of any one of SEQ ID NOs:20-25 and 76.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:26-31 and 77.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a first polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:26-31 and 77, and a second polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:26-31 and 77.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a first polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to two or more of SEQ ID NOs:26-31 and 77, and a second polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:26-31 and 77.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprise a polypeptide having an amino acid sequence having at least 90% identity to any one of SEQ ID NOs:26-31 and 77.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention may comprise a polypeptide having an amino acid sequence of any one of SEQ ID NOs:26-31 and 77.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:20-25 and 76 and a polypeptide having an amino acid sequence having polypeptide having at least 90% identity, at least 95% identity or 100% identity to one or more of SEQ ID NOs:26-31 and 77.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a first polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to two or more of SEQ ID NOs:20-25 and 76 and an amino acid sequence having at least 90% identity, at least 95% identity or 100% identity to two or more of SEQ ID NOs:26-31 and 77, and a second polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:20-25 and 76 and an amino acid sequence having at least 90% identity, at least 95% identity or 100% identity to one or more of SEQ ID NOs:26-31 and 77.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprise a polypeptide having an amino acid sequence having at least 90% identity to any one of SEQ ID NOs:20-25 and 76. At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention may comprise a polypeptide having an amino acid sequence of any one of SEQ ID NOs:20-25 and 76.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprise a polypeptide having an amino acid sequence having at least 90% identity to any one of SEQ ID NOs:26-31 and 77. At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention may comprise a polypeptide having an amino acid sequence of any one of SEQ ID NOs:26-31 and 77.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:32-41, 58-66, 78- 92, 673, 675, 677, 679, 681, 683, 685, 687, 689, 691, 693 and 695, or a polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to the amino acid sequence of SEQ ID NOs:32 or 33 that does not contain the eight histidine residues at the C-terminus.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a first polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:32-41, 58-66, 91 and 92 or a polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to the amino acid sequence of SEQ ID NOs:32 or 33 that does not contain the eight histidine residues at the C-terminus; and a second polypeptide having an amino acid sequence having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:78-92.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprise a polypeptide having an amino acid sequence having at least 90% identity to any one of SEQ ID NOs: 32-41, 58-66, 78-92, 673, 675, 677, 679, 681, 683, 685, 687, 689, 691, 693 and 695, or a polypeptide having an amino acid sequence having at least 90% identity to the amino acid sequence of SEQ ID NOs:32 or 33.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention may comprise a polypeptide having an amino acid sequence of any one of SEQ ID NOs: 32-41, 58-66, 78-92, 673, 675, 677, 679, 681, 683, 685, 687, 689, 691, 693 and 695, or a polypeptide having an amino acid sequence of SEQ ID NOs:32 or 33.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprise a polypeptide having an amino acid sequence having at least 90% identity to any one of SEQ ID NOs: 32-41, 58-66, 91 and 92 or a polypeptide having an amino acid sequence having at least 90% identity to the amino acid sequence of SEQ ID NOs:32 or 33.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention may comprise a polypeptide having an amino acid sequence of any one of SEQ ID NOs: 32-41, 58-66, 91 and 92 or a polypeptide having an amino acid sequence of SEQ ID NOs:32 or 33.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a polypeptide encoded by a polynucleotide having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:42-51, 67-75, 93-107, 674, 676, 678, 680, 682, 684, 686, 688, 690, 692, 694 and 696.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprises a first polypeptide encoded by a polynucleotide having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:42-51, 67-75, 106 and 107; and a second polypeptide encoded by a polynucleotide having at least 90% identity, at least 95% identity, or 100% identity to one or more of SEQ ID NOs:93-107.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention comprise a polypeptide having an amino acid sequence having at least 90% identity to any one of SEQ ID NOs: 42-51, 67-75, 93-107, 674, 676, 678, 680, 682, 684, 686, 688, 690, 692, 694 and 696.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • an antigen binding polypeptide or antigen binding polypeptide complex of the invention may comprise a polypeptide having an amino acid sequence of any one of SEQ ID NOs: 42-51, 67-75, 93-107, 674, 676, 678, 680, 682, 684, 686, 688, 690, 692, 694 and 696.
  • VH1 comprises a CDR1 comprising SEQ ID NO: 108 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 108; a CDR2 comprising SEQ ID NO: 109 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 109; and a CDR3 comprising SEQ ID NO: 110 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 110; and VL1 comprises a CDR1 comprising SEQ ID NO: 111 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 111; a CDR2 comprising SEQ ID NO: 112 or a sequence having at least 90% identity or 95% identity to SEQ ID NO: 112; and a CDR3 comprising SEQ ID NO: 113 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 113.
  • VH1 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 108; a CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 109; and/or a CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 110;
  • VL1 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 110;
  • CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 112; and/or CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 113.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • VH1 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 108; CDR2 comprising the amino acid sequence of SEQ ID NO: 109; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 110;
  • VL1 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:112; CDR2 comprising the amino acid sequence of SEQ ID NO:26; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 113.
  • VH2 comprises a CDR1 comprising SEQ ID NO: 108 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 108; a CDR2 comprising SEQ ID NO: 109 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 109; and a CDR3 comprising SEQ ID NO: 110 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 110; and VL2 comprises a CDR1 comprising SEQ ID NO: 111 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 111; a CDR2 comprising SEQ ID NO: 112 or a sequence having at least 90% identity or 95% identity to SEQ ID NO: 112; and a CDR3 comprising SEQ ID NO: 113 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 113.
  • VH2 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 108; CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 109; and/or CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 110; and VL2 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 111; CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 112; and CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 113.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • VH2 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 108; CDR2 comprising the amino acid sequence of SEQ ID NO: 109; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 110.
  • VL2 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:111; CDR2 comprising the amino acid sequence of SEQ ID NO: 112; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 112.
  • VH1 comprises a CDR1 comprising SEQ ID NO: 114 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 114; a CDR2 comprising SEQ ID NO: 115 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 115; and a CDR3 comprising SEQ ID NO: 116 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 116; and VL1 comprises a CDR1 comprising SEQ ID NO: 117 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 117; a CDR2 comprising SEQ ID NO: 118 or a sequence having at least 90% identity or 95% identity to SEQ ID NO: 118; and a CDR3 comprising SEQ ID NO: 119 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 119.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • VH1 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 114; CDR2 comprising the amino acid sequence of SEQ ID NO: 115; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 116.
  • VL1 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 117; CDR2 comprising the amino acid sequence of SEQ ID NO: 118; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 119.
  • VH2 comprises a CDR1 comprising SEQ ID NO: 114 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 114; a CDR2 comprising SEQ ID NO: 115 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 115; and a CDR3 comprising SEQ ID NO: 116 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 116; and VL2 comprises a CDR1 comprising SEQ ID NO: 117 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 117; a CDR2 comprising SEQ ID NO: 118 or a sequence having at least 90% identity or 95% identity to SEQ ID NO: 118; and a CDR3 comprising SEQ ID NO: 119 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 119.
  • VH2 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 114; CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:115; and/or CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 116; VL2 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 117; CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 118; and/or CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 119.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • VH2 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 114; CDR2 comprising the amino acid sequence of SEQ ID NO: 115; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 116.
  • VL2 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 117; CDR2 comprising the amino acid sequence of SEQ ID NO: 118; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 119.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • VH1 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:52; CDR2 comprising the amino acid sequence of SEQ ID NO:53; and/or CDR3 comprising the amino acid sequence of SEQ ID NO:54.
  • VL1 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:55; CDR2 comprising the amino acid sequence of SEQ ID NO:56; and/or CDR3 comprising the amino acid sequence of SEQ ID NO:57.
  • VH2 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:52; CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:53; and/or CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:54; VL2 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:55; CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:56; and/or CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:57.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • VH2 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:52; CDR2 comprising the amino acid sequence of SEQ ID NO:53; and/or CDR3 comprising the amino acid sequence of SEQ ID NO:54.
  • VL2 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO:55; CDR2 comprising the amino acid sequence of SEQ ID NO:56; and/or CDR3 comprising the amino acid sequence of SEQ ID NO:57.
  • VH1 comprises a CDR1 comprising SEQ ID NO: 120 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 120; a CDR2 comprising SEQ ID NO: 121 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 121; and a CDR3 comprising SEQ ID NO: 122 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 122; and VL1 comprises a CDR1 comprising SEQ ID NO: 123 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 123; a CDR2 comprising SEQ ID NO: 124 or a sequence having at least 90% identity or 95% identity to SEQ ID NO: 124; and a CDR3 comprising SEQ ID NO: 125 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 125.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • VH1 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 120; CDR2 comprising the amino acid sequence of SEQ ID NO: 121; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 122.
  • VL1 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 123; CDR2 comprising the amino acid sequence of SEQ ID NO: 124; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 125.
  • VH2 comprises a CDR1 comprising SEQ ID NO: 120 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 120; a CDR2 comprising SEQ ID NO: 121 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 121; and a CDR3 comprising SEQ ID NO: 122 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 122; and VL2 comprises a CDR1 comprising SEQ ID NO: 123 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 123; a CDR2 comprising SEQ ID NO: 124 or a sequence having at least 90% identity or 95% identity to SEQ ID NO: 124; and a CDR3 comprising SEQ ID NO: 125 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 125.
  • VH2 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 120; CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO:121; and/or CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 122; VL2 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 123; CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 124; and/or CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 125.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • VH2 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 120; CDR2 comprising the amino acid sequence of SEQ ID NO: 121; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 122.
  • VL2 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 123; CDR2 comprising the amino acid sequence of SEQ ID NO: 124; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 125.
  • VH1 comprises a CDR1 comprising SEQ ID NO: 126 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 126; a CDR2 comprising SEQ ID NO: 127 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 127; and a CDR3 comprising SEQ ID NO: 128 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 128; and VL1 comprises a CDR1 comprising SEQ ID NO: 129 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 129; a CDR2 comprising SEQ ID NO: 130 or a sequence having at least 90% identity or 95% identity to SEQ ID NO: 130; and a CDR3 comprising SEQ ID NO: 131 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 131.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • VH1 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 126; CDR2 comprising the amino acid sequence of SEQ ID NO: 127; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 128.
  • VL1 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 129; CDR2 comprising the amino acid sequence of SEQ ID NO: 130; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 131.
  • VH2 comprises a CDR1 comprising SEQ ID NO: 126 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 126; a CDR2 comprising SEQ ID NO: 127 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 127; and a CDR3 comprising SEQ ID NO: 128 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 128; and VL2 comprises a CDR1 comprising SEQ ID NO: 129 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 129; a CDR2 comprising SEQ ID NO: 130 or a sequence having at least 90% identity or 95% identity to SEQ ID NO: 130; and a CDR3 comprising SEQ ID NO: 131 or a sequence having at least 90% identity or at least 95% identity to SEQ ID NO: 131.
  • VH2 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 126; CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 127; and/or CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 128; VL2 may comprise a CDR1 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 129; CDR2 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 130; and/or CDR3 comprising an amino acid sequence having at least 90% identity to SEQ ID NO: 131.
  • At least 90% identity may include at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the reference polypeptide sequence.
  • VH2 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 126; CDR2 comprising the amino acid sequence of SEQ ID NO: 127; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 128.
  • VL2 may comprise a CDR1 comprising the amino acid sequence of SEQ ID NO: 129; CDR2 comprising the amino acid sequence of SEQ ID NO: 130; and/or CDR3 comprising the amino acid sequence of SEQ ID NO: 131.
  • the antigen binding polypeptide complex of the invention specifically bind to an HIV protein.
  • the HIV protein specifically bound by the antigen binding polypeptide complex of the invention may be selected from: Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the antigen binding polypeptide complex specifically binds at least one epitope on at least HIV protein selected from: Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the antigen binding polypeptide comprised within the antigen binding complex may comprise a VL1, VL2, VL3, VL4, VL5, VL6, VH1, VH2, VH3, VH4, VH5 and/or VH6 that specifically binds to one or more of: Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the polypeptide comprised within the antigen binding complex may comprise a VL1 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VL1 may specifically bind to Env.
  • the VL1 may specifically bind to gpl60.
  • the VL1 may specifically bind to gpl20.
  • the VL1 may specifically bind to gp41.
  • the VL1 may specifically bind to pl7.
  • the VL1 may specifically bind to p24.
  • the VL1 may specifically bind to p7.
  • the VL1 may specifically bind to p55.
  • the VL1 may specifically bind to p66.
  • the VL1 may specifically bind to p31.
  • the VL1 may specifically bind to Nef.
  • the VL1 may specifically bind to Tat.
  • the VL1 may specifically bind to Rev.
  • the VL1 may specifically bind to Vif.
  • the VL1 may specifically bind to Vpr. or example, the VL1 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL2 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VL2 may specifically bind to Env.
  • the VL2 may specifically bind to gpl60.
  • the VL2 may specifically bind to gpl20.
  • the VL2 may specifically bind to gp41.
  • the VL2 may specifically bind to pl7.
  • the VL2 may specifically bind to p24.
  • the VL2 may specifically bind to p7.
  • the VL2 may specifically bind to p55.
  • the VL2 may specifically bind to p66.
  • the VL2 may specifically bind to p31.
  • the VL2 may specifically bind to Nef.
  • the VL2 may specifically bind to Tat.
  • the VL2 may specifically bind to Rev.
  • the VL2 may specifically bind to Vif.
  • the VL2 may specifically bind to Vpr. or example, the VL2 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL3 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VL3 may specifically bind to Env.
  • the VL3 may specifically bind to gpl60.
  • the VL3 may specifically bind to gpl20.
  • the VL3 may specifically bind to gp41.
  • the VL3 may specifically bind to pl7.
  • the VL3 may specifically bind to p24.
  • the VL3 may specifically bind to p7.
  • the VL3 may specifically bind to p55.
  • the VL3 may specifically bind to p66.
  • the VL3 may specifically bind to p31.
  • the VL3 may specifically bind to Nef.
  • the VL3 may specifically bind to Tat.
  • the VL3 may specifically bind to Rev.
  • the VL3 may specifically bind to Vif.
  • the VL3 may specifically bind to Vpr. or example, the VL3 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL4 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VL4 may specifically bind to Env.
  • the VL4 may specifically bind to gpl60.
  • the VL4 may specifically bind to gpl20.
  • the VL4 may specifically bind to gp41.
  • the VL4 may specifically bind to pl 7.
  • the VL4 may specifically bind to p24.
  • the VL4 may specifically bind to p7.
  • the VL4 may specifically bind to p55.
  • the VL4 may specifically bind to p66.
  • the VL4 may specifically bind to p31.
  • the VL4 may specifically bind to Nef.
  • the VL4 may specifically bind to Tat.
  • the VL4 may specifically bind to Rev.
  • the VL4 may specifically bind to Vif.
  • the VL4 may specifically bind to Vpr. or example, the VL4 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL5 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VL5 may specifically bind to Env.
  • the VL5 may specifically bind to gpl60.
  • the VL5 may specifically bind to gpl20.
  • the VL5 may specifically bind to gp41.
  • the VL5 may specifically bind to pl7.
  • the VL5 may specifically bind to p24.
  • the VL5 may specifically bind to p7.
  • the VL5 may specifically bind to p55.
  • the VL5 may specifically bind to p66.
  • the VL5 may specifically bind to p31.
  • the VL5 may specifically bind to Nef.
  • the VL5 may specifically bind to Tat.
  • the VL5 may specifically bind to Rev.
  • the VL5 may specifically bind to Vif.
  • the VL5 may specifically bind to Vpr. or example, the VL5 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VL6 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VL6 may specifically bind to Env.
  • the VL6 may specifically bind to gpl60.
  • the VL6 may specifically bind to gpl20.
  • the VL6 may specifically bind to gp41.
  • the VL6 may specifically bind to pl7.
  • the VL6 may specifically bind to p24.
  • the VL6 may specifically bind to p7.
  • the VL6 may specifically bind to p55.
  • the VL6 may specifically bind to p66.
  • the VL6 may specifically bind to p31.
  • the VL6 may specifically bind to Nef.
  • the VL6 may specifically bind to Tat.
  • the VL6 may specifically bind to Rev.
  • the VL6 may specifically bind to Vif.
  • the VL6 may specifically bind to Vpr. or example, the VL6 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH1 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VH1 may specifically bind to Env.
  • the VH1 may specifically bind to gpl60.
  • the VH1 may specifically bind to gpl20.
  • the VH1 may specifically bind to gp41.
  • the VH1 may specifically bind to pl7.
  • the VH1 may specifically bind to p24.
  • the VH1 may specifically bind to p7.
  • the VH1 may specifically bind to p55.
  • the VH1 may specifically bind to p66.
  • the VH1 may specifically bind to p31.
  • the VH1 may specifically bind to Nef.
  • the VH1 may specifically bind to Tat.
  • the VH1 may specifically bind to Rev.
  • the VH1 may specifically bind to Vif.
  • the VH1 may specifically bind to Vpr. or example, the VH1 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH2 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VH2 may specifically bind to Env.
  • the VH2 may specifically bind to gpl60.
  • the VH2 may specifically bind to gpl20.
  • the VH2 may specifically bind to gp41.
  • the VH2 may specifically bind to pl7.
  • the VH2 may specifically bind to p24.
  • the VH2 may specifically bind to p7.
  • the VH2 may specifically bind to p55.
  • the VH2 may specifically bind to p66.
  • the VH2 may specifically bind to p31.
  • the VH2 may specifically bind to Nef.
  • the VH2 may specifically bind to Tat.
  • the VH2 may specifically bind to Rev.
  • the VH2 may specifically bind to Vif.
  • the VH2 may specifically bind to Vpr. or example, the VH2 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH3 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VH3 may specifically bind to Env.
  • the VH3 may specifically bind to gpl60.
  • the VH3 may specifically bind to gpl20.
  • the VH3 may specifically bind to gp41.
  • the VH3 may specifically bind to pl7.
  • the VH3 may specifically bind to p24.
  • the VH3 may specifically bind to p7.
  • the VH3 may specifically bind to p55.
  • the VH3 may specifically bind to p66.
  • the VH3 may specifically bind to p31.
  • the VH3 may specifically bind to Nef.
  • the VH3 may specifically bind to Tat.
  • the VH3 may specifically bind to Rev.
  • the VH3 may specifically bind to Vif.
  • the VH3 may specifically bind to Vpr. or example, the VH3 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH4 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VH4 may specifically bind to Env.
  • the VH4 may specifically bind to gpl60.
  • the VH4 may specifically bind to gpl20.
  • the VH4 may specifically bind to gp41.
  • the VH4 may specifically bind to pl7.
  • the VH4 may specifically bind to p24.
  • the VH4 may specifically bind to p7.
  • the VH4 may specifically bind to p55.
  • the VH4 may specifically bind to p66.
  • the VH4 may specifically bind to p31.
  • the VH4 may specifically bind to Nef.
  • the VH4 may specifically bind to Tat.
  • the VH4 may specifically bind to Rev.
  • the VH4 may specifically bind to Vif.
  • the VH4 may specifically bind to Vpr. or example, the VH4 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH5 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VH5 may specifically bind to Env.
  • the VH5 may specifically bind to gpl60.
  • the VH5 may specifically bind to gpl20.
  • the VH5 may specifically bind to gp41.
  • the VH5 may specifically bind to pl7.
  • the VH5 may specifically bind to p24.
  • the VH5 may specifically bind to p7.
  • the VH5 may specifically bind to p55.
  • the VH5 may specifically bind to p66.
  • the VH5 may specifically bind to p31.
  • the VH5 may specifically bind to Nef.
  • the VH5 may specifically bind to Tat.
  • the VH5 may specifically bind to Rev.
  • the VH5 may specifically bind to Vif.
  • the VH5 may specifically bind to Vpr. or example, the VH5 may specifically bind to Vpu.
  • the antigen binding polypeptide or polypeptide comprised within the antigen binding complex may comprise a VH6 that specifically binds to Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • the VH6 may specifically bind to Env.
  • the VH6 may specifically bind to gpl60.
  • the VH6 may specifically bind to gpl20.
  • the VH6 may specifically bind to gp41.
  • the VH6 may specifically bind to pl7.
  • the VH6 may specifically bind to p24.
  • the VH6 may specifically bind to p7.
  • the VH6 may specifically bind to p55.
  • the VH6 may specifically bind to p66.
  • the VH6 may specifically bind to p31.
  • the VH6 may specifically bind to Nef.
  • the VH6 may specifically bind to Tat.
  • the VH6 may specifically bind to Rev.
  • the VH6 may specifically bind to Vif.
  • the VH6 may specifically bind to Vpr. or example, the VH6 may specifically bind to Vpu.
  • an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1-VL2-L2-VH2-L3-VH1; or VH1-L1-VH2-L2-VL2-L3-VL1; wherein the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; or VH3-L4-VL3; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consist
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VH3-VL3. In some aspects, the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VH3-L4-VL3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VH3-VL3.
  • the first polypeptide has a structure represented by VH1-VH2-VL2- VL1 and the second polypeptide has a structure represented by VL3-L4-VH3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VH3-L4-VL3. In some aspects, the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-VH3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VH3- VL3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VH3-VL3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VL3- L4-VH3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL3-VL1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1-VL2-L2-VH2- L3-VH1; or VH1-L1-VH2-L2-VL2-L3-VL1; wherein the second polypeptide has a structure represented by VL3; wherein the third polypeptide has a structure represented by VH3; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of A2AR, APRIL, ATPDase, BAFF, BAFFR, BCMA, BlyS, BTK, BTLA, B7DC, B7H1, B7H2, B7H
  • SEQ ID NO: 5 SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 665, SEQ ID NO: 666, SEQ ID NO: 667, SEQ ID NO: 668, SEQ ID NO: 669, SEQ ID NO: 670, SEQ ID NO: 671, or SEQ ID NO: 672, or a sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% identity to any one of SEQ ID NOs: l-19 and 665-672; (iv) a linker selected from LI, L2 or L3 which is non-immunogenic; (v) a linker selected from LI, L2 or L3 wherein said linker does
  • the invention is directed to an antigen binding polypeptide complex (e.g., an antibody or antigen binding fragment thereof) comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1 or VH1-VH2-VL2-VL1 and a second polypeptide having a structure of VL3-VH3 or VH3-VL3, wherein the antigen binding polypeptide complex specifically binds to an HIV protein.
  • an antigen binding polypeptide complex e.g., an antibody or antigen binding fragment thereof
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide having a structure represented by VL1-VL2-VH2-VH1 or VH1-VH2-VL2-VL1; a second polypeptide having a structure represented by VL3; and a third polypeptide having a structure represented by VH3, wherein the antigen binding polypeptide complex specifically binds to an HIV protein.
  • the antigen binding polypeptide complex contains an amino acid linker between any two regions denoted in a structure described herein.
  • the antigen binding polypeptide complex contains an Fc region, CHI region, CL region, or any combination thereof.
  • the antigen binding polypeptide complex is an antibody or antigen binding fragment thereof.
  • HIV protein is selected from the group consisting of an HIV envelope protein, an HIV structural protein, an HIV functional protein, or an HIV accessory protein.
  • HIV envelope protein is HIV envelope glycoprotein (Env), HIV envelope glycoprotein gpl60, HIV envelope surface glycoprotein gpl20, or HIV transmembrane envelope protein gp41.
  • the HIV structural protein is pl7, p24, p7 or p55.
  • the HIV functional protein is p66, HIV-1 protease (PR) or p31.
  • the HIV accessory protein is Nef, Tat, Rev, Vif, Vpr or Vpu.
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • VL1 is a first immunoglobulin light chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • VL2 is a second immunoglobulin light chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • VL3 is a third immunoglobulin light chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu.
  • VH1 is a first immunoglobulin heavy chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu;
  • VH2 is a second immunoglobulin heavy chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, p31, Nef, Tat, Rev, Vif, Vpr and Vpu;
  • VH3 is a third immunoglobulin heavy chain variable region that specifically binds to at least one epitope on at least one antigen selected from
  • an antigen binding polypeptide complex comprises a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL I -VL2-VH2-VH I ; VH I -VH2-VL2-VL I ; VL1-L1-VL2-L2-VH2-L3-VH1; or VH1-L1- VH2-L2-VL2-L3-VL1; wherein the second polypeptide has a structure represented by VL3-VH3; VH3-VL3; VL3-L4-VH3; or VH3-L4-VL3; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VH3-VL3. In some aspects, the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VH3-L4-VL3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VH3-VL3.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-L4-VH3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VH3-L4-VL3. In some aspects, the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-VH3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VH3-VL3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VH3- L4-VL3.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2- VL2-L3-VL1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VH3-VL3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VL3-L4-VH3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • an antigen binding polypeptide complex comprises a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1-VL2-L2-VH2- L3-VH1; or VH1-L1-VH2-L2-VL2-L3-VL1; wherein the second polypeptide has a structure represented by VL3; wherein the third polypeptide has a structure represented by VH3; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to at least one epitope on at least one antigen selected from the group consisting of Env, gpl60, gpl20, gp41, pl7, p24, p7, p55, p66, HIV-1 protease, p31, Ne
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VH3-VL3. In some aspects, the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VH3-L4-VL3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2- VL1 and the second polypeptide has a structure represented by VH3-VL3.
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-L4-VH3. In some aspects, the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VH3-L4-VL3. In some aspects, the first polypeptide has a structure represented by VL1-L1-VL2- L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-VH3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VH3-VL3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-L4-VH3.
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VL3-VH3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VH3- VL3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1 and the second polypeptide has a structure represented by VL3-L4-VH3. In some aspects, the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VH3-L4-VL3.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-L1-VL2-L2- VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL I -L I -VL2-L2-VH2-L3-VH I -L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VL3-VH3-Fc; VH3-VL3-Fc; VL3-L5-VH3-Fc; VH3-L5-VL3-F
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1-L1-VH2-L2- VL2-L3 - VL 1 -Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH 1 -L4-Fc; or VH 1 -L 1 - VH2-L2- VL3 - VL 1 -L4- Fc, and the second polypeptide has a structure represented by VL3-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1- Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL1-L1-VL2-L2- VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and the second polypeptide has a structure represented by VH3-VL3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-L1-VL2-L2-VH2-L3- VHl-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1- Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and the second polypeptide has a structure represented by VL3- L5-VH3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2- VHl-Fc; VH1-VH2-VL2-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1-L1-VH2-L2-VL2- L3-VL1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and the second polypeptide has a structure represented by VH3-L5-VL3-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1- Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL1-L1-VL2-L2- VH2-L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and the second polypeptide has a structure represented by VL3-L5-VH3-L6-Fc.
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1-L1-VL2-L2- VH2-L3-VH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-Fc; VL I -L I -VL2-L2-VH2-L3-VH I -L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc, and the second polypeptide has a structure represented by VH3-L5-VL3-L6-Fc.
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1; VH1-VH2-VL2-VL1-CH1; VL1-VL2-VH2- VH1-CL; VH1-VH2-VL2-VL1-CL; VL1-VL2-VH2-VH1-CH1-CL; VH1-VH2-VL2-VL1-CH1- CL; VL1-VL2-VH2-VH1-CL-CH1; VH1-VH2-VL2-VL1-CL-CH1; VL1-L1-VL2-VH2-VH2-VH1-CL-CH1; VL1-L1-VL2-L2-VH2-L3- VH1-L4-CH1; VH1-L1-VH2-L2-VL3-V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL- VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7- CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VL3-L7-CL;
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1- CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3- CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3- L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VL3-L7-CL; VH3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL and the second polypeptide has a structure represented by VL3-VH3- CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1- VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VL3-L7-CL; VH3-
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1- CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL- VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VL3- L7-CL; VL3-L3
  • the first polypeptide has a structure represented by V 1-VL2-VH2-VH1-CH1-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6-VL3-L7-CL; VH3
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1-CH1-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CH1; VL3
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CL-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CH1; VL3-L6-VH3-L7-CH1
  • the first polypeptide has a structure represented by VH1-VH2-VL2-V 1-CL-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3-CL; VH3- VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6- VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-CL; VH3-L6
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-V 1-L4-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3-VH3- CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3-VL3- CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-L7-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3-CH1; VL3- VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL-CH1; VH3- VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CH1-VL3-CL; VH3-CL-VL3- CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4- CH1-L5-CL and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-CL; VH3- CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4- CL-L5-CH1 and the second polypeptide has a structure represented by VL3-VH3-CH1; VH3-VL3- CH1; VL3-VH3-CL; VH3-VL3-CL; VL3-VH3-CH1-CL; VH3-VL3-CH1-CL; VL3-VH3-CL- CH1; VH3-VL3-CL-CH1; VL3-CL-VH3-CH1; VL3-CH1-VH3-CL; VH3-CH1-VL3-CL; VH3-CL-CL; VH3- CL-VL3-CH1; VL3-L6-VH3-L7-CH1; VH3-L6-VL3-L7-CH1; VL3-L6-VH3-
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VH1-VH2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-VH1-CL-CH1- F
  • the first polypeptide has a structure represented by VL1-VL2- VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2- VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1- VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-L1-VL2-L2-VH2-L3- VH1-L4-CH1-Fc; VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CH1-Fc; VL1-Ll-VH2-L2-VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1- CHl-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL- Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1- CL-CHl-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH 1 -L 1 - VH2-L2- VL3 -VH1-L4-CH1-Fc; VH 1 -L 1 - VH2-L2-
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1 -CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1- VL2-VH2-VH1 -CHI -CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1- Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1- VH2-L2- VL3 - VL 1 -L4-CH1-Fc; VH1-L1- VH2-L2-V
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL- CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH 1 -Fc; VH1 -L 1 -VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1- VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1- VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1- Fc; VL 1 -L 1 - VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2- VL3 - VL 1 -L4-CH1 -Fc; VH1 -L 1
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL- CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH 1 -Fc; VH1 -L 1 -VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL- CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH 1 -Fc; VH1 -L 1 -VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL- CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH 1 -Fc; VH1 -L 1 -VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL- CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH 1 -Fc; VH1 -L 1 -VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL- CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH 1 -Fc; VH1 -L 1 -VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL- CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH 1 -Fc; VH1 -L 1 -VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL- CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH 1 -Fc; VH1 -L 1 -VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL- CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH 1 -Fc; VH1 -L 1 -VH2-L2-VL3 - VL 1 -L4-CH1 -Fc; VH1 -L
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1- VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2- VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1-VH2- L2- VL3 - VL 1 -L4-CH 1 -Fc; VH1-L1-VH2- L2- VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1- VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2- VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1-VH2- L2- VL3 - VL 1 -L4-CH 1 -Fc; VH1-L1-VH2- L2- VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1- VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2- VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1-VH2- L2- VL3 - VL 1 -L4-CH 1 -Fc; VH1-L1-VH2- L2- VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1- VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2- VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1-VH2- L2- VL3 - VL 1 -L4-CH 1 -Fc; VH1-L1-VH2- L2- VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1- VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2- VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1-VH2- L2- VL3 - VL 1 -L4-CH 1 -Fc; VH1-L1-VH2- L2- VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1- VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2- VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1-VH2- L2- VL3 - VL 1 -L4-CH 1 -Fc; VH1-L1-VH2- L2- VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1- VH2-VL2-VL1-CH1-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2- VH2-VH1-CH1-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2-VL1-CL-CH1-Fc; VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-Fc; VH1-L1-VH2- L2- VL3 - VL 1 -L4-CH 1 -Fc; VH1-L1-VH2- L2- VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2- VLl-CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1- CHl-CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2- VL 1 -CL-CH1 -Fc; VH1-VH2- VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2- VH2-L3 - VH1 -L4-CH1 -Fc; VH1 -L 1 - VH2-L2-VL3 - VL
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1-CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL2-L3-VL 1 - L4
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-CH1-Fc; VH1-VH2-VL2-VL1- CHl-Fc; VL1-VL2-VH2-VH1-CL-Fc; VH1-VH2-VL2-VL1 -CL-Fc; VL1-VL2-VH2-VH1-CH1- CL-Fc; VH1-VH2-VL2-VL1-CH1-CL-Fc; VL1-VL2-VH2-VH1-CL-CH1-Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VH1-VH2-VL2- VL 1 -CL-CH1 -Fc; VL 1 -L 1 -VL2-L2-VH2-L3-VH1 -L4-CH1 -Fc; VH1 -LI -VH2-L2-VL
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide and a second polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1-VL2-L2-VH2-L3- VH1; VH1-L1-VH2-L2-VL2-L3-VL1; VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL1- L 1 - VL2-L2- VH2-L3 - VH 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -Fc; VH 1 -L 1 - VH2-L2- VL3 - VL 1 -Fc; VL 1 -L 1 - VH2-L2- VL3 - VL 1 -
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3- L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3- CH1-L7-VL3, or VH3-CL-L7-VL3; optionally wherein the first and/or
  • the first polypeptide has a structure represented by VL1-VL2-VH2-VH1 and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3- L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3- CH1-L7-VL3, or VH3-CL-L7-VL3; optionally wherein the first and/or
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1 and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL- VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3- CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3- L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CL-L7-VL3; optional
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7- CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L3, VH3- L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8- VL3, VH3-CH1-L7-VL3, or VH3-CL
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3, VL3-L7- VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8- VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3- CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CL-L7
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CL and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3- CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CL-L7-
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CL-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7- CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CL-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1-L4-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3- L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8- VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3- CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CL
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- CL and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4- VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL- L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3- CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CH1
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CL-L5-CH1 and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CH1
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CL-L5-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2- L3-VH1-L4-CH1-L5-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7- CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CH
  • the first polypeptide has a structure represented by VL1-L1-VL2-L2-VH2-L3-VH1-L4-CH1-L5- CL-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3- L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3- CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CL-L5-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CH1-L5-CL-L6-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL- VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3- CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3- L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, V
  • the first polypeptide has a structure represented by VL1-Ll-VL2-L2-VH2-L3-VH1-L4-CL-L5-CH1-L6-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL- VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3- CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3- L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, V
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3- L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3- CH1-L7-VL3, or VH3-CL-L7-VL3; optionally wherein the first and/or
  • the first polypeptide has a structure represented by VH1-VH2-VL2-VL1 and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3- L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3- CH1-L7-VL3, or VH3-CL-L7-VL3; optionally wherein the first and/or
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1 and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL- VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3- CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3- L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CL-L7-VL3; optional
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7- CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L3, VH3- L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8- VL3, VH3-CH1-L7-VL3, or VH3-CL
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1-L4-CH1 and the second polypeptide has a structure represented by VL3-VH3, VL3-L7- VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8- VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3- CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CL-L7
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CL and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3- CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CL-L7-CL and
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CH1-L5-CL and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1-L4-CL-L5-CH1 and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7- CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CH1
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CH1-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L3, VH3-CH1-L7-VL3, or VH3-CL-CL-VL3, V
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CL-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7- CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CL-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1-L4-CH1-L5-CL-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7- CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CL-L5- CHl-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3- L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3- CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CH1-L5-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3- CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL-L8-VL3, VH3-CH1-L7-VL3, or VH3-CH
  • the first polypeptide has a structure represented by VH1-Ll-VH2-L2-VL2-L3-VL1-L4-CL-L5-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2- L3-VL1-L4-CH1-L5-CL-L6-Fc and the second polypeptide has a structure represented by VL3- VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3- L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4- VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL3, VH3-L4- VL3, VH3-CH1-VL3,
  • the first polypeptide has a structure represented by VH1-L1-VH2-L2-VL2-L3-VL1-L4-CL-L5- CH1-L6-Fc and the second polypeptide has a structure represented by VL3-VH3, VL3-L7-VH3, VL3-L4-VH3, VL3-CL-VH3, VL3-CH1-VH3, VL3-L7-CL-L8-VH3, VL3-L7-CH1-L8-VH3, VL3-CL-L7-VH3, VL3-CH1-L7-VH3, VH3-VL3, VH3-L7-VL3, VH3-L4-VL3, VH3-CH1-VL3, VH3-CL-VL3, VH3-L7-CH1-L8-VL3, VH3-L7-CL3, VH3-L4-VL3, VH3-CH1-VL3,
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1; VH1-VH2-VL2-VL1; VL1-L1- VL2-L2-VH2-L3-VH1; or VH1-L1-VH2-L2-VL2-L3-VL1; wherein the second polypeptide has a structure represented by VL3; wherein the third polypeptide has a structure represented by VH3; wherein VL1 is a first immunoglobulin light chain variable region that specifically binds to an HIV protein; VL2 is a second immunoglobulin light chain variable region that specifically binds to an HIV protein; VL3 is a third immunoglobulin light chain variable region that specifically binds to an HIV protein; VH1 is a first immunoglobulin heavy chain
  • the invention is directed to an antigen binding polypeptide complex comprising a first polypeptide, a second polypeptide, and a third polypeptide; wherein the first polypeptide has a structure represented by VL1-VL2-VH2-VH1-Fc; VH1-VH2-VL2-VL1-Fc; VL 1 -L 1 - VL2-L2- VH2-L3 -VH1 -Fc; VH1 -L 1 - VH2-L2- VL2-L3 -VL 1 -Fc; VL 1 -L 1 -VL2-L2- VH2- L3-VH1-L4-Fc; or VH1-Ll-VH2-L2-VL2-L3-VL1-L4-Fc; wherein the second polypeptide has a structure represented by VL3; or VL3-L5; wherein the third polypeptide has a structure represented by VH3-Fc; or

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Virology (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Communicable Diseases (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Microbiology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Hematology (AREA)
  • General Engineering & Computer Science (AREA)
  • Pulmonology (AREA)
  • AIDS & HIV (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2022/077201 2021-09-29 2022-09-28 Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof Ceased WO2023056313A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
MX2024003807A MX2024003807A (es) 2021-09-29 2022-09-28 Polipeptidos de union a antigeno, complejos de polipeptidos de union a antigeno y metodos de uso de los mismos.
AU2022354068A AU2022354068A1 (en) 2021-09-29 2022-09-28 Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof
KR1020247014151A KR20240099224A9 (ko) 2021-09-29 2022-09-28 항원 결합 폴리펩티드, 항원 결합 폴리펩티드 복합체 및 이의 사용 방법
CN202280078695.8A CN118317979A (zh) 2021-09-29 2022-09-28 抗原结合多肽、抗原结合多肽复合物及其使用方法
IL311758A IL311758A (en) 2021-09-29 2022-09-28 Antigen-binding polypeptides, antigen-binding polypeptide complexes and methods of using them
JP2024519821A JP2024537826A (ja) 2021-09-29 2022-09-28 抗原結合ポリペプチド、抗原結合ポリペプチド複合体、及びそれらを使用する方法
EP22877540.9A EP4408897A4 (en) 2021-09-29 2022-09-28 ANTIGEN-BINDING POLYPEPTIDES, ANTIGEN-BINDING POLYPEPTIDE COMPLEXES, AND METHODS OF USE THEREOF
CA3232357A CA3232357A1 (en) 2021-09-29 2022-09-28 Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof

Applications Claiming Priority (12)

Application Number Priority Date Filing Date Title
US202163249919P 2021-09-29 2021-09-29
US202163249794P 2021-09-29 2021-09-29
US202163249833P 2021-09-29 2021-09-29
US202163249722P 2021-09-29 2021-09-29
US63/249,833 2021-09-29
US63/249,794 2021-09-29
US63/249,722 2021-09-29
US63/249,919 2021-09-29
US202163291305P 2021-12-17 2021-12-17
US63/291,305 2021-12-17
US202163292382P 2021-12-21 2021-12-21
US63/292,382 2021-12-21

Publications (1)

Publication Number Publication Date
WO2023056313A1 true WO2023056313A1 (en) 2023-04-06

Family

ID=85783604

Family Applications (3)

Application Number Title Priority Date Filing Date
PCT/US2022/077201 Ceased WO2023056313A1 (en) 2021-09-29 2022-09-28 Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof
PCT/US2022/077202 Ceased WO2023056314A1 (en) 2021-09-29 2022-09-28 Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof
PCT/US2022/077200 Ceased WO2023056312A1 (en) 2021-09-29 2022-09-28 Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof

Family Applications After (2)

Application Number Title Priority Date Filing Date
PCT/US2022/077202 Ceased WO2023056314A1 (en) 2021-09-29 2022-09-28 Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof
PCT/US2022/077200 Ceased WO2023056312A1 (en) 2021-09-29 2022-09-28 Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof

Country Status (11)

Country Link
US (3) US20230227553A1 (cg-RX-API-DMAC7.html)
EP (3) EP4408469A4 (cg-RX-API-DMAC7.html)
JP (3) JP2024537804A (cg-RX-API-DMAC7.html)
KR (3) KR20240099225A (cg-RX-API-DMAC7.html)
AU (3) AU2022354068A1 (cg-RX-API-DMAC7.html)
CA (3) CA3232364A1 (cg-RX-API-DMAC7.html)
CL (3) CL2024000907A1 (cg-RX-API-DMAC7.html)
IL (3) IL311765A (cg-RX-API-DMAC7.html)
MX (2) MX2024003808A (cg-RX-API-DMAC7.html)
TW (3) TW202330594A (cg-RX-API-DMAC7.html)
WO (3) WO2023056313A1 (cg-RX-API-DMAC7.html)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025212973A1 (en) * 2024-04-03 2025-10-09 Modex Therapeutics, Inc. Antigen binding polypeptides, polypeptide complexes and methods of use thereof
EP4452317A4 (en) * 2021-12-21 2025-12-10 Modex Therapeutics Inc CONDITIONALLY ACTIVATED ANTIGEN-BINDING POLYPEPTIDE COMPLEXES AND THEIR METHODS OF USE

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111201030B (zh) 2017-07-25 2024-11-01 真和制药有限公司 通过阻断tim-3和其配体的相互作用治疗癌症
WO2020160156A2 (en) 2019-01-30 2020-08-06 Immutics, Inc. Anti-gal3 antibodies and uses thereof
EP4157338A4 (en) 2020-05-26 2024-11-13 TrueBinding, Inc. METHOD FOR TREATING INFLAMMATORY DISEASES BY GALECTIN-3 BLOCKING
CN119948053A (zh) * 2022-06-30 2025-05-06 摩德斯医疗股份有限公司 抗SARS-CoV-2抗原结合多肽、多肽复合物及其使用方法
US12195546B2 (en) 2022-12-19 2025-01-14 Sanofi CD28/OX40 bispecific antibodies
WO2025076131A1 (en) * 2023-10-03 2025-04-10 Revopsis Therapeutics, Inc. Compostions of multispecific antigen binding polypeptides and methods of use
CN119775368B (zh) * 2024-12-06 2025-11-07 扬州大学 基于gE蛋白保守的B细胞表位肽及其在猪伪狂犬病病毒抗体诊断中的应用
CN120399043B (zh) * 2025-04-17 2026-01-27 唯泰科生物科技(武汉)有限公司 抗猪伪狂犬病毒糖蛋白gB的抗体及其应用

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140322236A1 (en) * 2013-03-15 2014-10-30 Sdix, Llc Anti-human adora2a antibodies
US20180230225A1 (en) * 2015-08-11 2018-08-16 Nanjing Legend Biotech Co., Ltd. Chimeric antigen receptors based on single-domain antibodies and methods of use thereof
US20210061925A1 (en) * 2016-04-13 2021-03-04 Sanofi Trispecific and/or trivalent binding proteins

Family Cites Families (17)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2006232287B2 (en) * 2005-03-31 2011-10-06 Chugai Seiyaku Kabushiki Kaisha Methods for producing polypeptides by regulating polypeptide association
EP2158221B1 (en) * 2007-06-21 2018-08-29 MacroGenics, Inc. Covalent diabodies and uses thereof
US9216189B2 (en) * 2010-01-25 2015-12-22 Icahn School Of Medicine At Mount Sinai Antibodies which bind type I cannabinoid receptor/angiotensis II receptor heteromers
TWI743461B (zh) * 2011-03-28 2021-10-21 法商賽諾菲公司 具有交叉結合區定向之雙重可變區類抗體結合蛋白
US9458244B2 (en) * 2012-12-28 2016-10-04 Abbvie Inc. Single chain multivalent binding protein compositions and methods
EP3092250A4 (en) * 2014-01-08 2017-05-24 Moderna Therapeutics, Inc. Polynucleotides for the in vivo production of antibodies
MX2017003847A (es) * 2014-09-25 2017-12-15 Amgen Inc Proteinas biespecificas activables por proteasas.
EP3156417A1 (en) * 2015-10-13 2017-04-19 Affimed GmbH Multivalent fv antibodies
RS62437B1 (sr) * 2015-10-25 2021-11-30 Sanofi Sa Trispecifični i/ili trivalentni vezujući proteini za prevenciju ili lečenje hiv infekcije
WO2018075564A1 (en) * 2016-10-17 2018-04-26 University Of Maryland, College Park Multispecific antibodies targeting human immunodeficiency virus and methods of using the same
AU2018414456B2 (en) * 2018-03-22 2025-09-11 Universität Stuttgart Multivalent binding molecules
EP3802798A4 (en) * 2018-05-31 2022-05-11 Washington University CHIMERIC ANTIGEN RECEPTOR T CELLS (CAR-T) FOR TREATMENT OF CANCER
JP7599205B2 (ja) * 2018-06-01 2024-12-13 アンヘレス セラピューティクス インコーポレイテッド 細胞療法のための多様な抗原結合ドメイン、新規プラットフォームおよびその他の強化
US12365722B2 (en) * 2018-10-19 2025-07-22 University Of Maryland, College Park Multispecific antibodies targeting multiple epitopes on the HIV-1 envelope
AU2019372673A1 (en) * 2018-11-01 2021-05-27 Gracell Biotechnologies (Shanghai) Co., Ltd. Compositions and methods for T cell engineering
TW202104274A (zh) * 2019-04-09 2021-02-01 法商賽諾菲公司 用於治療hiv感染之三特異性及/或三價結合蛋白
CN115066274A (zh) * 2019-09-25 2022-09-16 斯图加特大学 三价结合分子

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20140322236A1 (en) * 2013-03-15 2014-10-30 Sdix, Llc Anti-human adora2a antibodies
US20180230225A1 (en) * 2015-08-11 2018-08-16 Nanjing Legend Biotech Co., Ltd. Chimeric antigen receptors based on single-domain antibodies and methods of use thereof
US20210061925A1 (en) * 2016-04-13 2021-03-04 Sanofi Trispecific and/or trivalent binding proteins

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4408897A4 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4452317A4 (en) * 2021-12-21 2025-12-10 Modex Therapeutics Inc CONDITIONALLY ACTIVATED ANTIGEN-BINDING POLYPEPTIDE COMPLEXES AND THEIR METHODS OF USE
WO2025212973A1 (en) * 2024-04-03 2025-10-09 Modex Therapeutics, Inc. Antigen binding polypeptides, polypeptide complexes and methods of use thereof

Also Published As

Publication number Publication date
IL311765A (en) 2024-05-01
MX2024003807A (es) 2024-06-11
EP4408897A4 (en) 2025-10-15
AU2022356387A1 (en) 2024-04-18
CL2024000907A1 (es) 2024-10-11
WO2023056314A1 (en) 2023-04-06
KR20240099223A (ko) 2024-06-28
IL311758A (en) 2024-05-01
IL311757A (en) 2024-05-01
EP4408469A1 (en) 2024-08-07
AU2022358512A1 (en) 2024-04-18
JP2024537828A (ja) 2024-10-16
KR20240099224A (ko) 2024-06-28
EP4408882A4 (en) 2025-10-15
KR20240099223A9 (ko) 2025-12-10
TW202330594A (zh) 2023-08-01
CA3232357A1 (en) 2023-04-06
CL2024000896A1 (es) 2025-01-24
JP2024537826A (ja) 2024-10-16
EP4408882A1 (en) 2024-08-07
US20230227553A1 (en) 2023-07-20
JP2024537804A (ja) 2024-10-16
CA3232349A1 (en) 2023-04-06
EP4408897A1 (en) 2024-08-07
US20230203199A1 (en) 2023-06-29
TW202325745A (zh) 2023-07-01
AU2022354068A1 (en) 2024-04-18
KR20240099224A9 (ko) 2025-12-10
TW202330595A (zh) 2023-08-01
KR20240099225A (ko) 2024-06-28
CA3232364A1 (en) 2023-04-06
CL2024000898A1 (es) 2024-10-11
MX2024003808A (es) 2024-06-11
WO2023056312A1 (en) 2023-04-06
EP4408469A4 (en) 2025-11-19
US20230235092A1 (en) 2023-07-27

Similar Documents

Publication Publication Date Title
US20230235092A1 (en) Antigen binding polypeptides, antigen binding polypeptide complexes and methods of use thereof
JP7195929B2 (ja) 三重特異性および/または三価結合タンパク質
CN118317979A (zh) 抗原结合多肽、抗原结合多肽复合物及其使用方法
TW202128756A (zh) 用於癌症治療之多重專一性結合蛋白
US20240034808A1 (en) Antigen binding polypeptide complexes containing extracellular domains of tnfsf ligands
US20250197481A1 (en) Antigen Binding Polypeptides, Antigen Binding Polypeptide Complexes and Methods of Use Thereof in HIV
BR122024005246A2 (pt) Método de purificação de uma proteína de ligação produzida por uma célula hospedeira

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22877540

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 3232357

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 311758

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2024519821

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: AU2022354068

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2022354068

Country of ref document: AU

Date of ref document: 20220928

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202417032967

Country of ref document: IN

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022877540

Country of ref document: EP

Effective date: 20240429

WWE Wipo information: entry into national phase

Ref document number: 202280078695.8

Country of ref document: CN