WO2023039008A1 - Diagnostic methods for cancer using ephrinb2 expression - Google Patents

Diagnostic methods for cancer using ephrinb2 expression Download PDF

Info

Publication number
WO2023039008A1
WO2023039008A1 PCT/US2022/042812 US2022042812W WO2023039008A1 WO 2023039008 A1 WO2023039008 A1 WO 2023039008A1 US 2022042812 W US2022042812 W US 2022042812W WO 2023039008 A1 WO2023039008 A1 WO 2023039008A1
Authority
WO
WIPO (PCT)
Prior art keywords
cancer
treatment
ephrinb2
ephb4
inhibitor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2022/042812
Other languages
English (en)
French (fr)
Inventor
Jon COGAN
Valery Krasnoperov
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Vasgene Therapeutics Inc
Original Assignee
Vasgene Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Vasgene Therapeutics Inc filed Critical Vasgene Therapeutics Inc
Priority to CA3231533A priority Critical patent/CA3231533A1/en
Priority to EP22868022.9A priority patent/EP4398928A4/en
Priority to US18/689,553 priority patent/US20250123284A1/en
Priority to KR1020247011751A priority patent/KR20240053651A/ko
Priority to JP2024514635A priority patent/JP2024534935A/ja
Priority to AU2022343102A priority patent/AU2022343102A1/en
Priority to CN202280074020.6A priority patent/CN118510533A/zh
Publication of WO2023039008A1 publication Critical patent/WO2023039008A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/57557Immunoassay; Biospecific binding assay; Materials therefor for cancer of other specific parts of the body, e.g. brain
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • G01N33/5758Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites
    • G01N33/5759Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumours, cancers or neoplasias, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides or metabolites involving compounds localised on the membrane of tumour or cancer cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q1/00Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
    • C12Q1/68Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
    • C12Q1/6876Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes
    • C12Q1/6883Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material
    • C12Q1/6886Nucleic acid products used in the analysis of nucleic acids, e.g. primers or probes for diseases caused by alterations of genetic material for cancer
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6872Intracellular protein regulatory factors and their receptors, e.g. including ion channels
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/106Pharmacogenomics, i.e. genetic variability in individual responses to drugs and drug metabolism
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12QMEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
    • C12Q2600/00Oligonucleotides characterized by their use
    • C12Q2600/158Expression markers
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/52Predicting or monitoring the response to treatment, e.g. for selection of therapy based on assay results in personalised medicine; Prognosis

Definitions

  • cancer remains a major cause of death worldwide despite the numerous advanced diagnostic and therapeutic methods that have been developed.
  • cancers become established after a primary genetic event by a number of mechanisms that include, but are not limited to, increased cellular metabolism and growth rate, stimulation of angiogenesis thereby increasing blood supply to the tumor, and disregulation of signaling pathways and tumor suppressors.
  • Curative treatment protocols in clinical oncology remain reliant upon a combination of surgical resection, ionizing radiation, and cytotoxic chemotherapy.
  • the major barrier to successful treatment and prevention of cancer lies in the fact that many cancers still fail to respond to the current chemotherapeutic and immunotherapy intervention, and many individuals suffer a recurrence or death, even after aggressive therapy.
  • tumors may become resistant to anti-cancer drugs by a number of mechanisms that include, but are not limited to, expulsion of the drug from the cell, occurrence of mutations that prevent binding of the drug to its target, and occurrence of additional mutations in genes and their protein products unrelated to the drug target.
  • Immunotherapy using agonistic, antagonistic, or blocking antibodies to costimulatory or co-inhibitory molecules has been an area of extensive research and clinical evaluation.
  • Immune checkpoint proteins include CTLA-4, PD-1 , P D- L1 , LAG-3, and TIM-3 as well as several others (Sharpe et aL, Nat Immunol, 8:239-45, 2007).
  • immune checkpoints are crucial for the maintenance of self-tolerance (that is, the prevention of autoimmunity) and protect tissues from damage when the immune system is responding to pathogenic infection.
  • tumors co-opt certain immune-checkpoint pathways as a major mechanism of immune resistance, particularly against T cells that are specific for tumor antigens (Pardoll DM., Nat Rev Cancer, 12:252-64, 2012).
  • immune checkpoint molecules including, e.g., CTLA-4 (ipilimumab), PD-1 (nivolumab; pembrolizumab; pidilizumab) and PD-L1 (BMS-936559; MPLD3280A; MEDI4736; MSB0010718C)(see, e.g, Philips and Atkins, International Immunology, 27(1); 39-46, Oct 2014), and OX-40, CD137, GITR, LAG3, TIM-3, and VISTA (see, e.g., Sharon et aL, Chin J Cancer., 33(9): 434-444, Sep 2014; Hodi et aL, N Engl J Med, 2010; Topa
  • checkpoint inhibitor therapy has become the preferred first, second, or third-line therapy for many cancers, and PD1/PDL1 antibodies have changed the treatment paradigm for several cancers.
  • PD1/PDL1 antibodies have changed the treatment paradigm for several cancers.
  • checkpoint inhibitor therapy remains limited by concerns over potential severe side effects and the fact that many tumors lack the targeted antigen and will therefore evade treatment.
  • about 20% of patients with various cancers respond to PD-1/PD-L1 antibodies or CTLA-4 antibodies and overall survival remains less than a year in most instances and objective response rates are modest, underscoring the large unmet need for nearly 70-80% of these patients.
  • Eph (Erythropoietin Producing Hepatoma) receptor and ligand are part of the largest family of receptor tyrosine kinases (RTKs). The family is subdivided into class A and class B, based on sequence homology and binding affinity for two distinct types of membrane-anchored ephrin ligands. Each Eph receptor and ligand can bind to multiple ligands and receptors and certain receptors have been postulated as putative tumor suppressors and others as tumor promoters (Vaught et al, Breast Cancer Res, 10(6):217- 224, 2008).
  • EphrinB2 and its high affinity cognate receptor, EphB4, are transmembrane proteins that are induced in tumor vessels and regulate immune cell trafficking. Inhibition of the EphB4-EphrinB2 interaction has a direct inhibitory effect on tumor cell proliferation in vitro and ex-vivo.
  • Polypeptide agents that inhibit EphB4 or EphrinB2 mediated functions have been previously described by the present inventors (see, e.g., US 7,381 ,410; US 7,862,816; US 7,977,463; US 8,063,183; US 8,273,858; US 8,975,377; US 8,981 ,062; US 9,533,026; each hereby incorporated by reference in their entirety for all purposes).
  • the present inventors have determined that soluble extracellular fragment of EphB4 fused to albumin (sEphB4-HSA) blocks interaction between Ephrin-B2 and EphB4, and blocks bidirectional signaling, thus promoting immune cell trafficking, and inducing an anti-tumor immune response in various cancers.
  • the present inventors are developing an EphB4-EphrinB2 inhibitor, “sEphB4-HSA” (soluble extracellular fragment of EphB4 tyrosine kinase receptor fused to Human Serum Albumin) for the treatment of various cancers.
  • sEphB4-HSA consists of the extracellular domain of human EphB4 receptor (sEphB4) fused in frame with human serum albumin (HSA). This fusion with HSA enhances the pharmacokinetics of sEphB4.
  • sEphB4-HSA binds to the ligand of EphB4 tyrosine kinase receptor: the transmembrane protein Ephrin-B2. Through this binding, it blocks endogenous EphB tyrosine kinase receptors from interacting with EphrinB2.
  • EphB4-HSA reduces angiogenesis in tumors - thus starving tumors of blood and inhibits EphrinB2’s ability to suppress recruitment of T cells to tumors - thus increasing T cell recruitment.
  • EphB4 is a survival factor in several tumor types such as squamous cell carcinoma, urothelial carcinoma, colon cancer, lung cancer, mesothelioma, ovarian cancer, pancreatic cancer, prostate cancer and others.
  • EphrinB2 is a survival factor in some tumors such as Kaposi’s sarcoma. Blocking bidirectional signaling blocks activation of EphB4 and thus forward signaling leading to cell stasis or cell death.
  • the present invention is directed, in part, to the use of EphrinB2 expression as a biomarker to evaluate the efficacy of treatment and to assist physicians in deciding on the course of a treatment in an individual suffering from a metastatic cancer.
  • EphrinB2 expression appears to correlate with response to EphrinB2 targeted therapy as a single agent and/or in combination therapy using a polypeptide agent that inhibits EphB4 or EphrinB2 mediated functions (“EphB4-EphrinB2 inhibitors”)(e.g., sEphB4-HSA) in combination with an immune stimulating drug (including but not limited to antagonistic antibodies to PD-1/PD-L1 , CTLA-4, LAG3, TIM3, TIG IT, 0X40 ligand) as front-line therapy in locally advanced or metastatic urothelial/bladder cancer; and 2) higher EphrinB2 expression appears to correlate with a lower response to monotherapy using an immune stimulating drug (e.g., a PD-1/PD-L1 antagonistic antibody) in a metastatic urothelium carcinoma post systemic chemotherapy study.
  • an immune stimulating drug e.g., a PD-1/PD-L1 antagonistic antibody
  • the present invention describes the use of EphrinB2 expression as a biomarker to evaluate the efficacy of treatment and to assist physicians in deciding on the course of a treatment in an individual suffering from a metastatic cancer.
  • the invention provides methods to diagnose and select a subject with cancer for treatment using an EphB4-EphrinB2 inhibitor, or an EphB4-EphrinB2 inhibitor in combination with an immune stimulating drug, as front-line therapy for treatment of cancers.
  • the invention provides methods to diagnose and select a subject with cancer for treatment using an EphB4-EphrinB2 inhibitor, or an EphB4-EphrinB2 inhibitor in combination with an immune stimulating drug, for treatment of a number of cancers where standard therapies have been shown to be ineffective, result in relapse, or are not even considered for use due to the type of cancer and related tumors.
  • the invention provides methods to diagnose and select a subject with cancer for treatment using an EphB4-EphrinB2 inhibitor, or an EphB4-EphrinB2 inhibitor in combination with an immune stimulating drug, for treatment of a number of cancers wherein the subject is currently on a course of treatment with an immune stimulating drug.
  • the individual suffers from a platinum resistant metastatic cancer.
  • the individual has not received prior platinum chemotherapy, or is too unhealthy to receive platinum chemotherapy.
  • the method of diagnosing and selecting a subject with cancer for treatment using an EphB4-EphrinB2 inhibitor in combination with an immune stimulating drug comprises: i) detecting the level of EphrinB2 expression in a biological sample from a subject who has been diagnosed with a cancer; ii) selecting the subject for treatment using an EphB4-EphrinB2 inhibitor in combination with an immune stimulating drug as front-line therapy when EphrinB2 expression is 1% or greater.
  • the method of diagnosing and selecting a subject with cancer for treatment using an EphB4-EphrinB2 inhibitor comprises: i) detecting the level of EphrinB2 expression in a biological sample from a subject who has been diagnosed with a cancer; ii) selecting the subject for treatment using an EphB4-EphrinB2 inhibitor as front-line therapy when EphrinB2 expression is 1% or greater.
  • the method of diagnosing a subject with cancer comprises: i) detecting the level of EphrinB2 expression in a biological sample from a subject who has been diagnosed with a cancer and is currently on a course of treatment with an immune stimulating drug; and ii) changing therapy when EphrinB2 expression is 1% or greater.
  • the polypeptide agent that inhibits EphB4 or EphrinB2 mediated functions is a monomeric ligand binding portion of the EphB4 protein or EphrinB2 protein, or an antibody that binds to and affects EphB4 or EphrinB2.
  • the polypeptide agent is a soluble EphB4 (sEphB4) polypeptide that binds specifically to an EphrinB2 polypeptide and comprises an amino acid sequence of an extracellular domain of an EphB4 protein.
  • the sEphB4 polypeptide comprises a globular domain of an EphB4 protein.
  • the agent that inhibits EphB4 or EphrinB2 mediated functions is a nucleic acid therapeutic agent.
  • the nucleic acid therapeutic agent that inhibits EphB4 or EphrinB2 mediated functions is oligonucleotide DNA or siRNA which targets EphrinB2 or EphB4.
  • the sEphB4 polypeptide comprises a sequence selected from the group consisting of a sequence that is at least 90% identical to residues 1-522, at least 90% identical to residues 1-412, and at least 90% identical to residues 1-311 of the amino acid sequence of SEQ ID NO: 1 .
  • the sEphB4 polypeptide may comprise a sequence encompassing the globular (G) domain (amino acids 29-197 of SEQ ID NO; 1), and optionally additional domains, such as the cysteine-rich domain (amino acids 239-321 of SEQ ID NO: 1), the first fibronectin type 3 domain (amino acids 324-429 of SEQ ID NO: 1) and the second fibronectin type 3 domain (amino acids 434-526 of SEQ ID NO: 1).
  • the sEphB4 polypeptide will comprise amino acids 1-537 of SEQ ID NO: 1.
  • the sEphB4 polypeptide will comprise amino acids 1-427 of SEQ ID NO: 1 . In some embodiments, the sEphB4 polypeptide will comprise amino acids 1-326 of SEQ ID NO: 1. In some embodiments, the sEphB4 polypeptide will comprise amino acids 1-197, 29-197, 1-312, 29-132, 1-321 , 29-321 , 1-326, 29-326, 1-412, 29-412, 1 -427, 29-427, 1 -429, 29-429, 1-526, 29-526, 1-537 and 29-537 of SEQ ID NO: 1.
  • the sEphB4 polypeptide will comprise amino acids 16-197, 16-312, 16-321 , 16-326, 16-412, 16-427, 16-429, 16-526, and 16-537 of SEQ ID NO: 1 .
  • a sEphB4 polypeptide may be prepared in a multimeric form, by, for example, expressing as an Fc fusion protein or fusion with another multimerization domain.
  • the sEphB4 polypeptide will further comprise an additional component that confers increased serum half-life while still retaining EphrinB2 binding activity.
  • the sEphB4 polypeptides are monomeric and are covalently linked to one or more polyoxyaklylene groups (e.g., polyethylene, polypropylene).
  • the sEphB4 polypeptide is covalently linked to a polyethylene glycol (PEG) group(s) (hereinafter “sEphB4-PEG”).
  • PEG polyethylene glycol
  • the sEphB4 polypeptide is stably associated with a second stabilizing polypeptide that confers improved half-life without substantially diminishing EphrinB2 binding.
  • the stabilizing polypeptide is immunocompatible with human patients (or animal patients, where veterinary uses are contemplated) and will have little or no significant biological activity.
  • the sEphB4 polypeptide is associated covalently or non-covalently with an albumin selected from the group consisting of a human serum albumin (HSA) (hereinafter “sEphB4-HSA”) and bovine serum albumin (BSA”) (hereinafter “sEphB4-BSA”).
  • HSA human serum albumin
  • BSA bovine serum albumin
  • the sEphB4-HSA comprises residues 16-197 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-312 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4- HSA comprises residues 16-321 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-326 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2.
  • the sEphB4-HSA comprises residues 16-412 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-427 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-429 of SEQ ID NO: 1 directly fused to residues 25- 609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-526 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2.
  • the sEphB4-HSA comprises residues 16-537 of SEQ ID NO: 1 directly fused to residues 25- 609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises the amino acid sequence set forth in SEQ ID NO: 3. In some embodiments, the sEphB4-HSA comprises the amino acid sequence set forth in SEQ ID NO: 4. In some embodiments, the sEphB4-HSA comprises the amino acid sequence set forth in SEQ ID NO: 5.
  • a sEphB4 polypeptide may be prepared in a multimeric form, by, for example, expressing as a fusion protein with a molecule that blocks signaling or blocks EphrinB2 interaction with Eph receptors, including but not limited to antisense oligonucleotides, siRNA, and gene editing like CRISPR/CAS.
  • the immune stimulating drug is an antagonist to an immune-checkpoint protein antigen selected from the group consisting of: SIRP (expressed on macrophage, monocytes, dendritic cells), CD47 (highly expressed on tumor cells and other cell types), TIGIT (immune receptor present on some T cells and natural killer cells), VISTA (expressed on monocytes, dendritic cells, B cells, T cells), CD152 (expressed by activated CD8+ T cells, CD4+ T cells and regulatory T cells), CD279 (expressed on tumor infiltrating lymphocytes, expressed by activated T cells (both CD4 and CD8), regulatory T cells, activated B cells, activated NK cells, anergic T cells, monocytes, dendritic cells), CD274 (expressed on T cells, B cells, dendritic cells, macrophages, vascular endothelial cells, pancreatic islet cells), and CD223 (expressed by activated T cells, regulatory T cells, anergic T cells, and CD223 (expressed
  • EphrinB2 expression is determined by protein expression using a method selected from the group consisting of immunohistochemistry (IHC), immunofluorescence, flow cytometry, and Western blot.
  • the mRNA expression level is determined using a method selected from the group consisting of quantitative polymerase chain reaction (qPCR), reverse transcription qPCR (RT-qPCR), RNA sequencing, microarray analysis, in situ hybridization, and serial analysis of gene expression (SAGE).
  • the biological sample is selected from the group consisting of a tissue sample, a blood sample, a serum sample, a plasma sample, a cerebrospinal fluid (CSF) sample, an ascites fluid sample, and a cell culture sample.
  • a tissue sample a blood sample, a serum sample, a plasma sample, a cerebrospinal fluid (CSF) sample, an ascites fluid sample, and a cell culture sample.
  • CSF cerebrospinal fluid
  • the cancer is selected from the group consisting of: B cell lymphoma; a lung cancer (small cell lung cancer and non-small cell lung cancer); a bronchus cancer; a colorectal cancer; a prostate cancer; a breast cancer; a pancreas cancer; a stomach cancer; an ovarian cancer; a urinary bladder cancer; a brain or central nervous system cancer; a peripheral nervous system cancer; an esophageal cancer; a cervical cancer; a melanoma; a uterine or endometrial cancer; a cancer of the oral cavity or pharynx; a liver cancer; a kidney cancer; a biliary tract cancer; a small bowel or appendix cancer; a salivary gland cancer; a thyroid gland cancer; a adrenal gland cancer; an osteosarcoma; a chondrosarcoma; a liposarcoma; a testes cancer; and a malignant fibrous histiocytom
  • the cancer is ovarian cancer. In some embodiments, the cancer is a breast cancer. In some embodiments, the cancer is a RAS (e.g., KRAS, HRAS, NRAS) mutant cancer. In some embodiments, the cancer is a cancer with PTEN loss.
  • RAS e.g., KRAS, HRAS, NRAS
  • the subject previously responded to treatment with an anticancer therapy, but, upon cessation of therapy, suffered relapse (hereinafter “a recurrent cancer”).
  • a recurrent cancer the subject has resistant or refractory cancer.
  • the cancer is refractory to platinum-based chemotherapy.
  • the cancer is refractory to immunotherapy treatment.
  • the cancer is refractory to treatment with a chemotherapeutic agent.
  • the cancer is refractory to treatment using depleting antibodies to specific tumor antigens.
  • the cancer is refractory to treatment using agonistic, antagonistic, or blocking antibodies to co-stimulatory or co-inhibitory molecules (immune checkpoints).
  • the cancer is refractory to targeted treatment with an immunoconjugate, antibody-drug conjugate (ADC), or fusion molecule comprising a depleting antibody to specific tumor antigens tumor antigen and a cytotoxic agent.
  • the cancer is refractory to targeted treatment with a small molecule kinase inhibitor.
  • the cancer is refractory to treatment using surgery.
  • the cancer is refractory to treatment using stem cell transplantation.
  • the cancer is refractory to treatment using radiation.
  • the cancer is refractory to combination therapy involving, for example, two or more of: immunotherapy treatment, treatment with a platinum based chemotherapeutic agent, treatment with a tumor antigen-specific, depleting antibody, treatment with a immunoconjugate, ADC, or fusion molecule comprising a tumor antigen-specific, depleting antibody and a cytotoxic agent, targeted treatment with a small molecule kinase inhibitor, treatment using surgery, treatment using stem cell transplantation, and treatment using radiation.
  • immunotherapy treatment treatment with a platinum based chemotherapeutic agent
  • treatment with a tumor antigen-specific, depleting antibody treatment with a immunoconjugate, ADC, or fusion molecule comprising a tumor antigen-specific, depleting antibody and a cytotoxic agent
  • targeted treatment with a small molecule kinase inhibitor targeted treatment with a small molecule kinase inhibitor
  • the method for treating a cancer in a subject further comprises a second therapy selected from the group consisting of: small molecule kinase inhibitor targeted therapy, surgery, cytoreductive therapy, cytotoxic chemotherapy, and immunotherapy.
  • the combination therapy will be synergistic.
  • the second therapy is cytoreductive therapy and the combination may increase the therapeutic index of the cytoreductive therapy.
  • the cytoreductive therapy may act in a DNA repair pathway.
  • the cytoreductive therapy is radiation therapy.
  • the combination may be synergistic.
  • the second therapy is a chemotherapeutic agent is selected from the group consisting of: daunorubicin, adriamycin (doxorubicin), epirubicin, idarubicin, anamycin, MEN 10755, etoposide, teniposide, vinblastine, vincristine, vinorelbine (NAVELBINE); vindesine, vindoline, vincamine, mechlorethamine, cyclophosphamide, melphalan (L-sarcolysin), carmustine (BCNU), lomustine (CCNU), semustine (methyl- CCNU), streptozocin, chlorozotocin, cytarabine (CYTOSAR-U), cytosine arabinoside, fluorouracil (5-FU), floxuridine (FUdR), thioguanine (6-thioguanine), mercaptopurine (6-MP), pentostatin, fluorouracil (5-FU),
  • the second therapy will comprise administration of a poly (ADP-ribose) polymerase inhibitor (PARP) inhibitor.
  • PARP poly (ADP-ribose) polymerase inhibitor
  • the PARP inhibitor is selected from the group consisting of ABT-767, AZD 2461 , BGB-290, BGP 15, CEP 9722, E7016, E7449, fluzoparib, IN01001 , JPI 289, MP 124, niraparib, olaparib, ONO2231 , rucaparib, SC 101914, talazoparib, veliparib, WW 46, or salts or derivatives thereof, olaparib, rucaparib, niraparib, talazoparib and veliparib.
  • the combination may be synergistic.
  • the method of treatment will comprise the administration of sEphB4-HSA in combination with pegylated liposomal doxorubicin (PLD). In some embodiments, the method of treatment will comprise the administration of sEphB4-HSA in combination with paclitaxel. In some embodiments, the combination may be synergistic.
  • the second therapy will comprise immunotherapy selected from, but not limited to, treatment using depleting antibodies to specific tumor antigens; treatment using antibody-drug conjugates; treatment using agonistic, antagonistic, or blocking antibodies to co-stimulatory or co-inhibitory molecules (immune checkpoints) such as CTLA-4, PD-1 , OX-40, CD137, GITR, LAG3, TIM-3, and VISTA; treatment using bispecific T cell engaging antibodies (BiTE®) such as blinatumomab: treatment involving administration of biological response modifiers such as IL-2, IL-12, IL-15, IL-21 , GM-CSF, IFN-oc, IFN-p and IFN-y; treatment using therapeutic vaccines such as sipuleucel-T; treatment using dendritic cell vaccines, or tumor antigen peptide vaccines; treatment using oncolytic virus therapy (T-VEC); treatment using chimeric antigen receptor (CAR)-T cells; treatment using C
  • CAR chimeric anti
  • the additional therapy comprises administration of an antibody that specifically binds an immune-checkpoint protein antigen from the list including, but not limited to, CD276, CD272, CD152, CD223, CD279, CD274, TIM-3 and B7-H4; or any immune-checkpoint protein antigen antibody taught in the art.
  • the PD-1 inhibitor is selected from the group consisting of, but not limited to, nivolumab (Bristol-Myers Squibb)(Drugbank 09035; Drugbank 06132), pembrolizumab (Merck)(Drugbank 09037) and pidilizumab (Medivation)(Drugbank 15383).
  • the CTLA-4 inhibitor is selected from the group consisting of, but not limited to, ipilimumab (Bristol-Myers Squibb)(Drugbank 06186) and tremelimumab (Medlmmune)(Drugbank 11771 ).
  • Figure 1 provides pictures of EphrinB2 Immuno-histochemistry (IHC) and EphrinB2 In situ hybridization (ISH/RNAScope) of EphrinB2 positive non-responders.
  • Figure 2 provides pictures of EphrinB2 Immuno-histochemistry (IHC) and EphrinB2 In situ hybridization (ISH/RNAScope) of 5 responders.
  • IHC EphrinB2 Immuno-histochemistry
  • ISH/RNAScope EphrinB2 In situ hybridization
  • FIG. 3 provides pictures of EphrinB2 Immuno-histochemistry (IHC) and EphrinB2 In situ hybridization (ISH/RNAScope) of cell pellet controls of various isogenic CHO cell lines: wild type or ectopically expressing human EphrinB2, and 2 urothelial cancer tissues.
  • IHC Immuno-histochemistry
  • ISH/RNAScope EphrinB2 In situ hybridization
  • polypeptide polypeptide
  • peptide protein
  • protein protein
  • amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
  • antibody and “antibodies” are used interchangeably herein and refer to a polypeptide capable of interacting with and/or binding to another molecule, often referred to as an antigen.
  • Antibodies can include, for example “antigen-binding polypeptides” or “target-molecule binding polypeptides.”
  • Antigens of the present invention can include for example any polypeptides described in the present invention.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine.
  • Amino acid analogs refer to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a- carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
  • A Alanine
  • C Cysteine
  • An amino acid is represented by a single letter before and after the relevant position to reflect the change from original amino acid (before the position) to changed amino acid (after position).
  • A19T means that amino acid alanine at position 19 is changed to threonine.
  • tumor refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
  • cancer refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
  • cancer refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
  • cancer refers to cells which exhibit autonomous, unregulated growth, such that they exhibit an aberrant growth phenotype characterized by a significant loss of control over cell proliferation.
  • the cells of interest for detection, analysis, classification, or treatment in the present application include precancerous (e.g., benign), malignant, pre- metastatic, and non-metastatic cells.
  • precancerous e.g., benign
  • malignant e.g., pre- metastatic
  • non-metastatic cells e.g., tumor cells
  • primary tumor refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues located at the anatomical site where the autonomous, unregulated growth of the cells initiated, for example the organ of the original cancerous tumor. Primary tumors do not include metastases.
  • the “pathology” of cancer includes all phenomena that compromise the well-being of the patient. This includes, without limitation, abnormal or uncontrollable cell growth, primary tumor growth and formation, metastasis, interference with the normal functioning of neighboring cells, release of cytokines or other secretory products at abnormal levels, suppression or aggravation of inflammatory or immunological response, neoplasia, premalignancy, malignancy, invasion of surrounding or distant tissues or organs, such as lymph nodes, etc.
  • cancer recurrence and “tumor recurrence,” and grammatical variants thereof, refer to further growth of neoplastic or cancerous cells after diagnosis of cancer. Particularly, recurrence may occur when further cancerous cell growth occurs in the cancerous tissue.
  • Tuor spread similarly, occurs when the cells of a tumor disseminate into local or distant tissues and organs; therefore, tumor spread encompasses tumor metastasis.
  • Tuor invasion occurs when the tumor growth spread out locally to compromise the function of involved tissues by compression, destruction, or prevention of normal organ function.
  • Metastasis refers to the growth of a cancerous tumor in an organ or body part, which is not directly connected to the organ of the original cancerous tumor. Metastasis will be understood to include micrometastasis, which is the presence of an undetectable amount of cancerous cells in an organ or body part which is not directly connected to the organ of the original cancerous tumor (e.g., the organ containing the primary tumor). Metastasis can also be defined as several steps of a process, such as the departure of cancer cells from an original tumor site (e.g., primary tumor site) and migration and/or invasion of cancer cells to other parts of the body.
  • cancerous tissue sample refers to any cells obtained from a cancerous tumor.
  • solid tumors which have not metastasized for example a primary tumor
  • a tissue sample from the surgically removed tumor will typically be obtained and prepared for testing by conventional techniques.
  • ear stage cancer or “early stage tumor” is meant a cancer that is not invasive or metastatic or is classified as a Stage 0, 1 , or 2 cancer.
  • cancer include, but are not limited to, carcinoma, lymphoma, blastoma (including medulloblastoma and retinoblastoma), sarcoma (including liposarcoma and synovial cell sarcoma), neuroendocrine tumors (including carcinoid tumors, gastrinoma, and islet cell cancer), mesothelioma, schwannoma (including acoustic neuroma), meningioma, adenocarcinoma, melanoma, and leukemia or lymphoid malignancies.
  • bladder cancer e.g., urothelial bladder cancer (e.g., transitional cell or urothelial carcinoma, non-muscle invasive bladder cancer, muscle-invasive bladder cancer, and metastatic bladder cancer) and non-urothelial bladder cancer
  • squamous cell cancer e.g., epithelial squamous cell cancer
  • lung cancer including small-cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, hepatoma, breast cancer (including metastatic breast cancer), colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma,
  • Tumors of interest for treatment with the methods of the invention include solid tumors, e.g., carcinomas, gliomas, melanomas, sarcomas, and the like. Ovarian cancer and breast cancer is of particular interest.
  • Carcinomas include a variety of adenocarcinomas, for example in prostate, lung, etc. adernocartical carcinoma; hepatocellular carcinoma; renal cell carcinoma, ovarian carcinoma, carcinoma in situ, ductal carcinoma, carcinoma of the breast, basal cell carcinoma; squamous cell carcinoma; transitional cell carcinoma; colon carcinoma; nasopharyngeal carcinoma; multilocular cystic renal cell carcinoma; oat cell carcinoma, large cell lung carcinoma; small cell lung carcinoma; etc.
  • Carcinomas may be found in prostrate, pancreas, colon, brain (e.g., glioblastoma), lung, breast, skin, etc. Including in the designation of soft tissue tumors are neoplasias derived from fibroblasts, myofibroblasts, histiocytes, vascular cells/endothelial cells and nerve sheath cells. Tumors of connective tissue include sarcomas; histiocytomas; fibromas; skeletal chondrosarcoma; extraskeletal myxoid chondrosarcoma; clear cell sarcoma; fibrosarcomas, etc.
  • Hematologic cancers include leukemias and lymphomas, e.g., cutaneous T cell lymphoma, acute myeloid leukemia (AML), chronic myeloid leukemia (CML), acute lymphoblastic leukemia (ALL), nonHodgkins lymphoma (NHL), etc.
  • AML acute myeloid leukemia
  • CML chronic myeloid leukemia
  • ALL acute lymphoblastic leukemia
  • NHL nonHodgkins lymphoma
  • Resistant or refractory cancer refers to tumor cells or cancer that do not respond to previous anti-cancer therapy including, e.g., chemotherapy, surgery, radiation therapy, stem cell transplantation, and immunotherapy.
  • Tumor cells can be resistant or refractory at the beginning of treatment, or they may become resistant or refractory during treatment.
  • Refractory tumor cells include tumors that do not respond at the onset of treatmentor respond initially for a short period but fail to respond to treatment.
  • Refractory tumor cells also include tumors that respond to treatment with anticancer therapy but fail to respond to subsequent rounds of therapies.
  • refractory tumor cells also encompass tumors that appear to be inhibited by treatment with anticancer therapy but recur up to five years, sometimes up to ten years or longer after treatment is discontinued.
  • the anticancer therapy can employ chemotherapeutic agents alone, radiation alone, targeted therapy alone, surgery alone, or combinations thereof.
  • the refractory tumor cells are interchangeable with resistant tumor cells.
  • the cancer is resistant to standard therapies.
  • the cancer is a chemoresistant cancer.
  • the cancer is a platinum resistant cancer.
  • Tumor immunity refers to the process in which tumors evade immune recognition and clearance. Thus, as a therapeutic concept, tumor immunity is “treated” when such evasion is attenuated, and the tumors are recognized and attacked by the immune system. Examples of tumor recognition include tumor binding, tumor shrinkage and tumor clearance.
  • sample refers to a composition that is obtained or derived from a subject and/or individual of interest that contains a cellular and/or other molecular entity that is to be characterized and/or identified, for example, based on physical, biochemical, chemical, and/or physiological characteristics.
  • tissue samples include, but are not limited to, tissue samples, primary or cultured cells or cell lines, cell supernatants, cell lysates, platelets, serum, plasma, vitreous fluid, lymph fluid, synovial fluid, follicular fluid, seminal fluid, amniotic fluid, milk, whole blood, blood-derived cells, urine, cerebro-spinal fluid, saliva, sputum, tears, perspiration, mucus, tumor lysates, and tissue culture medium, tissue extracts such as homogenized tissue, tumor tissue, cellular extracts, and combinations thereof.
  • tissue sample or “cell sample” is meant a collection of similar cells obtained from a tissue of a subject or individual.
  • the source of the tissue or cell sample may be solid tissue as from a fresh, frozen and/or preserved organ, tissue sample, biopsy, and/or aspirate; blood or any blood constituents such as plasma; bodily fluids such as cerebral spinal fluid, amniotic fluid, peritoneal fluid, or interstitial fluid; cells from any time in gestation or development of the subject.
  • the tissue sample may also be primary or cultured cells or cell lines.
  • the tissue or cell sample is obtained from a disease tissue/organ.
  • a "tumor sample” is a tissue sample obtained from a tumor or other cancerous tissue.
  • the tissue sample may contain a mixed population of cell types (e.g., tumor cells and non-tumor cells, cancerous cells and non-cancerous cells).
  • the tissue sample may contain compounds which are not naturally intermixed with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, or the like.
  • detection includes any means of detecting, including direct and indirect detection.
  • biomarker refers to an indicator, e.g., predictive, diagnostic, and/or prognostic, which can be detected in a sample.
  • the biomarker may serve as an indicator of a particular subtype of a disease or disorder (e.g., cancer) characterized by certain, molecular, pathological, histological, and/or clinical features.
  • a biomarker is a gene.
  • Biomarkers include, but are not limited to, polynucleotides (e.g., DNA and/or RNA), polynucleotide copy number alterations (e.g., DNA copy numbers), polypeptides, polypeptide and polynucleotide modifications (e.g., post- translational modifications), carbohydrates, and/or glycolipid-based molecular markers.
  • polynucleotides e.g., DNA and/or RNA
  • polynucleotide copy number alterations e.g., DNA copy numbers
  • polypeptides e.g., polypeptide and polynucleotide modifications (e.g., post- translational modifications)
  • carbohydrates e.g., glycolipid-based molecular markers.
  • treatment is an approach for obtaining beneficial or desired clinical results.
  • beneficial or desired clinical results include, but are not limited to, any one or more of: alleviation of one or more symptoms; diminishment of extent of disease; preventing or delaying spread (e.g., metastasis, for example metastasis to the lung or to the lymph node) of disease; preventing or delaying recurrence of disease; stabilizing, delaying or slowing of disease progression; amelioration of the disease state; remission (whether partial or total); and improving quality of life.
  • treatment is a reduction of pathological consequence of a proliferative disease.
  • the methods of the invention contemplate any one or more of these aspects of treatment.
  • Treating may refer to any indicia of success in the treatment or amelioration or prevention of cancer, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the disease condition more tolerable to the patient; slowing in the rate of degeneration or decline; or making the final point of degeneration less debilitating.
  • the treatment or amelioration of symptoms can be based on objective or subjective parameters; including the results of an examination by a physician.
  • treating includes the administration of the compounds or agents of the present invention to prevent or delay, to alleviate, or to arrest or inhibit development of the symptoms or conditions.
  • therapeutic effect refers to the reduction, elimination, or prevention of the disease, symptoms of the disease, or side effects of the disease in the subject.
  • sustained response refers to the sustained effect on reducing tumor growth after cessation of a treatment.
  • the tumor size may remain to be the same or smaller as compared to the size at the beginning of the administration phase.
  • the sustained response has a duration at least the same as the treatment duration, at least 1 .5 times, 2.0 times, 2.5 times, or 3.0 times the length of the treatment duration.
  • reducing or inhibiting cancer relapse means to reduce or inhibit tumor or cancer relapse or tumor or cancer progression.
  • cancer relapse and/or cancer progression include, without limitation, cancer metastasis.
  • partial response refers to at least a 30% decrease in the sum of the longest diameters (SLD) of target lesions, taking as reference the baseline SLD.
  • stable disease refers to neither sufficient shrinkage of target lesions to qualify for PR, nor sufficient increase to qualify for PD, taking as reference the smallest SLD since the treatment started.
  • progressive disease or “PD” refers to at least a 20% increase in the SLD of target lesions, taking as reference the smallest SLD recorded since the treatment started or the presence of one or more new lesions.
  • progression free survival refers to the length of time during and after treatment during which the disease being treated (e.g., cancer) does not get worse. Progression-free survival may include the amount of time patients have experienced a complete response or a partial response, as well as the amount of time patients have experienced stable disease.
  • ORR objective response rate
  • overall survival refers to the percentage of individuals in a group who are likely to be alive after a particular duration of time.
  • EphrinB2/EphB4 inhibitors polypeptide agents that inhibit EphB4 or EphrinB2 mediated functions
  • EphrinB2/EphB4 inhibitors are used to refer to inhibitory, activating, or modulating molecules, respectively, identified using in vitro and in vivo assays for receptor or ligand binding or signaling, e.g., ligands, receptors, agonists, antagonists, and their homologs and mimetics.
  • EphrinB2/EphB4 inhibitors having the desired pharmacological activity may be administered in a physiologically acceptable carrier to a host to inhibit EphB4 or EphrinB2 mediated functions.
  • the therapeutic agents may be administered in a variety of ways, orally, topically, parenterally e.g., intravenous, subcutaneously, intraperitoneally, by viral infection, intravascularly, etc. Intravenous delivery is of particular interest.
  • the compounds may be formulated in a variety of ways.
  • the concentration of therapeutically active compound in the formulation may vary from about 0.1 -100 wt.%.
  • compositions can be prepared in various forms, such as granules, tablets, pills, suppositories, capsules, suspensions, salves, lotions and the like.
  • Pharmaceutical grade organic or inorganic carriers and/or diluents suitable for oral and topical use can be used to make up compositions containing the therapeutically active compounds.
  • Diluents known to the art include aqueous media, vegetable and animal oils and fats. Stabilizing agents, wetting and emulsifying agents, salts for varying the osmotic pressure or buffers for securing an adequate pH value, and skin penetration enhancers can be used as auxiliary agents.
  • “Pharmaceutically acceptable excipient” means an excipient that is useful in preparing a pharmaceutical composition that is generally safe, non-toxic, and desirable, and includes excipients that are acceptable for veterinary use as well as for human pharmaceutical use. Such excipients can be solid, liquid, semisolid, or, in the case of an aerosol composition, gaseous.
  • compositions, carriers, diluents and reagents are used interchangeably and represent that the materials are capable of administration to or upon a human without the production of undesirable physiological effects to a degree that would prohibit administration of the composition.
  • Dosage unit refers to physically discrete units suited as unitary dosages for the particular individual to be treated. Each unit can contain a predetermined quantity of active compound(s) calculated to produce the desired therapeutic effect(s) in association with the required pharmaceutical carrier.
  • the specification for the dosage unit forms can be dictated by (a) the unique characteristics of the active compound(s) and the particular therapeutic effect(s) to be achieved, and (b) the limitations inherent in the art of compounding such active compound(s).
  • the terms “subject,” “individual,” and “patient” are used interchangeably herein to refer to a mammal being assessed for treatment and/or being treated. In an embodiment, the mammal is a human.
  • subject thus encompass individuals having cancer, including without limitation, adenocarcinoma of the ovary or prostate, breast cancer, glioblastoma, etc., including those who have undergone or are candidates for resection (surgery) to remove cancerous tissue.
  • Subjects may be human, but also include other mammals, particularly those mammals useful as laboratory models for human disease, e.g., mouse, rat, etc.
  • diagnosis is used herein to refer to the identification of a molecular or pathological state, disease or condition, such as the identification of a virus infection.
  • a “therapeutically effective amount” refers to the amount of a compound that, when administered to a subject for treating breast or ovarian cancer, is sufficient to affect such treatment of the cancer.
  • the “therapeutically effective amount” may vary depending, for example, on the sEphB4-HSA polypeptide or immune stimulating drug selected, the stage of the cancer, the age, weight and/or health of the patient and the judgment of the prescribing physician. An appropriate amount in any given instance may be readily ascertained by those skilled in the art or capable of determination by routine experimentation.
  • determining the treatment efficacy can include any methods for determining that a treatment is providing a benefit to a subject.
  • treatment efficacy and variants thereof are generally indicated by alleviation of one or more signs or symptoms associated with the disease and can be readily determined by one skilled in the art.
  • Treatment efficacy may also refer to the prevention or amelioration of signs and symptoms of toxicities typically associated with standard or non-standard treatments of a disease. Determination of treatment efficacy is usually indication and disease specific and can include any methods known or available in the art for determining that a treatment is providing a beneficial effect to a patient. For example, evidence of treatment efficacy can include but is not limited to remission of the disease or indication.
  • treatment efficacy can also include general improvements in the overall health of the subject, such as but not limited to enhancement of patient life quality, increase in predicted subject survival rate, decrease in depression or decrease in rate of recurrence of the indication (increase in remission time). (See, e.g., Physicians' Desk Reference (2010).).
  • an effective amount of the drug may have the effect in reducing the number of cancer cells; reducing the tumor size; inhibiting (i.e.
  • an effective amount can be administered in one or more administrations.
  • an effective amount of drug, compound, or pharmaceutical composition is an amount sufficient to accomplish prophylactic or therapeutic treatment either directly or indirectly.
  • an effective amount of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition.
  • an "effective amount" may be considered in the context of administering one or more therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
  • in conjunction with refers to administration of one treatment modality in addition to another treatment modality.
  • in conjunction with refers to administration of one treatment modality before, during, or after administration of the other treatment modality to the individual.
  • “In combination with”, “combination therapy” and “combination products” refer, in certain embodiments, to the concurrent administration to a patient of a first therapeutic and the compounds as used herein.
  • the combination products are administered non-concurrently.
  • each component can be administered at the same time or sequentially in any order at different points in time. Thus, each component can be administered separately but sufficiently closely in time so as to provide the desired therapeutic effect.
  • Concomitant administration of a known cancer therapeutic drug with a pharmaceutical composition of the present invention means administration of the drug and AXL variant at such time that both the known drug and the composition of the present invention will have a therapeutic effect. Such concomitant administration may involve concurrent (i.e. at the same time), prior, or subsequent administration of the drug with respect to the administration of a compound of the present invention. A person of ordinary skill in the art would have no difficulty determining the appropriate timing, sequence and dosages of administration for particular drugs and compositions of the present invention.
  • the term “correlates,” or “correlates with,” and like terms refers to a statistical association between instances of two events, where events include numbers, data sets, and the like.
  • a positive correlation also referred to herein as a “direct correlation” means that as one increases, the other increases as well.
  • a negative correlation also referred to herein as an “inverse correlation” means that as one increases, the other decreases.
  • the present invention describes the use of EphrinB2 expression as a biomarker to evaluate the efficacy of treatment and to assist physicians in deciding on the course of a treatment in an individual suffering from a metastatic cancer.
  • the invention provides methods to diagnose and select a subject with cancer for treatment using an EphB4-EphrinB2 inhibitor, or an EphB4-EphrinB2 inhibitor in combination with an immune stimulating drug, as front-line therapy for treatment of cancers.
  • the invention provides methods to diagnose and select a subject with cancer for treatment using an EphB4-EphrinB2 inhibitor, or an EphB4-EphrinB2 inhibitor in combination with an immune stimulating drug, for treatment of a number of cancers where standard therapies have been shown to be ineffective, result in relapse, or are not even considered for use due to the type of cancer and related tumors.
  • the invention provides methods to diagnose and select a subject with cancer for treatment using an EphB4-EphrinB2 inhibitor, or an EphB4-EphrinB2 inhibitor in combination with an immune stimulating drug, for treatment of a number of cancers wherein the subject is currently on a course of treatment with an immune stimulating drug.
  • the individual suffers from a platinum resistant metastatic cancer.
  • the individual has not received prior platinum chemotherapy, or is too unhealthy to receive platinum chemotherapy.
  • the method of diagnosing and selecting a subject with cancer for treatment using an EphB4-EphrinB2 inhibitor in combination with an immune stimulating drug comprises: i) detecting the level of EphrinB2 expression in a biological sample from a subject who has been diagnosed with a cancer; ii) selecting the subject for treatment using an EphB4-EphrinB2 inhibitor in combination with an immune stimulating drug as front-line therapy when EphrinB2 expression is 1% or greater.
  • the method of diagnosing and selecting a subject with cancer for treatment using an EphB4-EphrinB2 inhibitor comprises: i) detecting the level of EphrinB2 expression in a biological sample from a subject who has been diagnosed with a cancer; ii) selecting the subject for treatment using an EphB4-EphrinB2 inhibitor as front-line therapy when EphrinB2 expression is 1% or greater.
  • the method of diagnosing a subject with cancer comprises: i) detecting the level of EphrinB2 expression in a biological sample from a subject who has been diagnosed with a cancer and is currently on a course of treatment with an immune stimulating drug; and ii) changing therapy when EphrinB2 expression is 1% or greater.
  • EphrinB2 expression is determined by protein expression using a method selected from the group consisting of immunohistochemistry (IHC), immunofluorescence, flow cytometry, and Western blot.
  • the mRNA expression level is determined using a method selected from the group consisting of quantitative polymerase chain reaction (qPCR), reverse transcription qPCR (RT-qPCR), RNA sequencing, microarray analysis, in situ hybridization, and serial analysis of gene expression (SAGE).
  • the biological sample is selected from the group consisting of a tissue sample, a blood sample, a serum sample, a plasma sample, a cerebrospinal fluid (CSF) sample, an ascites fluid sample, and a cell culture sample.
  • a tissue sample a blood sample, a serum sample, a plasma sample, a cerebrospinal fluid (CSF) sample, an ascites fluid sample, and a cell culture sample.
  • CSF cerebrospinal fluid
  • EphB4 and membrane-localized ligand EphrinB2 induce bidirectional signaling (forward in receptor expressing cells, reverse signaling in ligand expressing cells).
  • EphB4 belongs to the largest family of receptor tyrosine kinases and upon interaction with the EphrinB2 ligand has been reported to regulate neuronal migration, bone remodeling, angiogenesis, cancer progression, and metastasis (Pasquale EB, Cell, 133:38-52, 2008).
  • EphB4 and EphrinB2 expression is downregulated in vast majority of adult normal tissues, even as early as postnatal development but EphB4 is over-expressed in multiple epithelial cancers including lung, bladder, head-neck, and pancreatic cancers (Ferguson BD, et eL, Growth Factors, 32:202-6, 2014). Oncogenes including mutant Kras and loss of PTEN induce EphB4 expression. Expression of EphB4 correlates with stage, grade and survival since knock down of EphB4 leads to cell death by apoptosis. The ligand EphrinB2's over-expression and correlation with poor outcome have been reported in several cancer types.
  • EphrinB2 in the tumor vessels (and tumor) and high EphrinB2 prevents immune cell recruitment and thus resistance to therapy.
  • Inhibition of the EphB4-EphrinB2 interaction has a direct inhibitory effect on tumor cell proliferation in vitro and ex-vivo.
  • the EphB4-Ephrin B2 pathway antagonist or agonist is selected from: (i) a soluble polypeptide comprising the extracellular domain of Ephrin B2; (ii) a soluble polypeptide comprising the extracellular domain of EphB4; (iii) an antibody, or a fragment thereof, that binds to EphB4; (iv) an antibody, or a fragment thereof, that binds to Ephrin B2; (v) a nucleic acid compound that hybridizes to an EphB4 transcript under physiological conditions and decreases the expression of EphB4 in a cell; or (vi) a nucleic acid compound that hybridizes to an EphrinB2 transcript under physiological conditions and decreases the expression of EphrinB2 in a cell.
  • the EphB4-Ephrin B2 pathway antagonist inhibits the interaction between Ephrin B2 and EphB4.
  • the Ephrin B2/EphB4 pathway antagonist inhibits clustering of Ephrin B2 or EphB4.
  • the EphB4-Ephrin B2 pathway antagonist inhibits phosphorylation of Ephrin B2 or EphB4.
  • the EphB4-Ephrin B2 pathway agonist stimulates kinase activity of Ephrin B2 or EphB4.
  • the agent that inhibits EphB4 or EphrinB2 mediated functions is a nucleic acid therapeutic agent.
  • the nucleic acid therapeutic agent that inhibits EphB4 or EphrinB2 mediated functions is oligonucleotide DNA or siRNA which targets EphrinB2 or EphB4.
  • sEphB4-HSA is a fully human fusion protein composed of soluble EphB4 extracellular domain fused at the C- terminus with albumin upon expression as a single seamless protein of 123.3 kDa.
  • sEphB4- HSA specifically binds to EphrinB2.
  • sEphB4-HSA preliminary studies of sEphB4-HSA in tumor models show increase in T and NK cell migration into tumor. This is accompanied by the induction of ICAM-1 in the tumor vessels. ICAM-1 is an integrin that promotes attachment of T and NK cells to the endothelium followed by transmigration of cells into the tumor.
  • sEphB4-HSA also shows downregulation of PI3K signaling by blocking EphB-EphrinB2 interaction in tumor cell and tumor vessels. sEphB4-HSA blocks the signaling and promote immune cell trafficking into the tumor and inhibit survival signal in tumor cells by downregulating PI3K pathway.
  • EphB4-EphrinB2 represent a therapeutic strategy that has survived the test of clinical trials. It has been shown to be safe in multiple clinical trials with minimal to no toxicity (A. El-Khoueiry BG, et al., Eur J Cancer, 69, 2016), likely due to low levels of expression in normal tissue.
  • Eph/ephrin gene family members modulate immune cell processes in inflammatory models, such as arteriosclerosis and wound healing (Braun J, et aL, Arterioscler Thromb Vase Biol, 31 :297-305, 2011 ; Poitz DM, et aL, Mol Immunol, 68:648-56, 2015; Yu G, et aL, J Immunol, 171 :106-14, 2003; Funk SD, et aL, Arterioscler Thromb Vase Biol, 32:686-95, 2012).
  • Eph-ephrin interactions have also been reported to regulate monocyte adhesion to the blood vessel wall trans-endothelial migration, T cell chemotaxis, activation, proliferation and apoptosis, and mobilization of hematopoietic cells from bone marrow sinusoids.
  • the present inventors have interrogated TCGA database for mRNA expression of EphrinB2 (“EFNB2”). Expression of EFNB2 was significantly higher in tumor tissue compared to normal tissue, based on data analyzed using on comine microarray database. High-EFNB2 expression correlated significantly with poor survival bladder urothelial cancer (median OS 23.19 vs. 44.28 months). In addition, EFNB2 expression correlated with reduced disease-free survival in the same populations. Verification of the data at protein level remains.
  • the polypeptide agent that inhibits EphB4 or EphrinB2 mediated functions is a monomeric ligand binding portion of the EphB4 protein or EphrinB2 protein, or an antibody that binds to and affects EphB4 or EphrinB2.
  • the polypeptide agent is a soluble EphB4 (sEphB4) polypeptide that binds specifically to an EphrinB2 polypeptide and comprises an amino acid sequence of an extracellular domain of an EphB4 protein.
  • the sEphB4 polypeptide comprises a globular domain of an EphB4 protein.
  • the agent that inhibits EphB4 or EphrinB2 mediated functions is oligonucleotide DNA or siRNA which targets EphrinB2 or EphB4.
  • the sEphB4 polypeptide comprises a sequence selected from the group consisting of a sequence that is at least 90% identical to residues 1-522, at least 90% identical to residues 1-412, and at least 90% identical to residues 1-312 of the amino acid sequence of SEQ ID NO: 1 .
  • the sEphB4 polypeptide may comprise a sequence encompassing the globular (G) domain (amino acids 29-197 of SEQ ID NO; 1), and optionally additional domains, such as the cysteine-rich domain (amino acids 239-321 of SEQ ID NO: 1), the first fibronectin type 3 domain (amino acids 324-429 of SEQ ID NO: 1) and the second fibronectin type 3 domain (amino acids 434-526 of SEQ ID NO: 1).
  • the sEphB4 polypeptide will comprise amino acids 1-537 of SEQ ID NO: 1.
  • the sEphB4 polypeptide will comprise amino acids 1-427 of SEQ ID NO: 1 . In some embodiments, the sEphB4 polypeptide will comprise amino acids 1-326 of SEQ ID NO: 1. In some embodiments, the sEphB4 polypeptide will comprise amino acids 1-197, 29-197, 1-312, 29-132, 1-321 , 29-321 , 1-326, 29-326, 1-412, 29-412, 1 -427, 29-427, 1 -429, 29-429, 1-526, 29-526, 1-537 and 29-537 of SEQ ID NO: 1.
  • the sEphB4 polypeptide will comprise amino acids 16-197, 16-312, 16-321 , 16-326, 16-412, 16-427, 16-429, 16-526 of SEQ ID NO: 1 .
  • a sEphB4 polypeptide may be one that comprises an amino acid sequence at least 90%, and optionally 95% or 99% identical to any of the preceding amino acid sequences while retaining EphrinB2 binding activity.
  • any variations in the amino acid sequence from the sequence shown in SEQ ID NO: 1 are conservative changes or deletions of no more than 1 , 2, 3, 4 or 5 amino acids, particularly in a surface loop region.
  • a soluble polypeptide may be prepared in a multimeric form, by, for example, expressing as an Fc fusion protein or fusion with another multimerization domain.
  • the sEphB4 polypeptide will further comprise an additional component that confers increased serum half-life while still retaining EphrinB2 binding activity.
  • the sEphB4 polypeptides are monomeric and are covalently linked to one or more polyoxyaklylene groups (e.g., polyethylene, polypropylene).
  • the sEphB4 polypeptide is covalently linked to a single polyethylene glycol (PEG) group (hereinafter “sEphB4-PEG”). In some embodiments, the sEphB4 polypeptide is covalently linked to two, three, or more PEG groups.
  • PEG polyethylene glycol
  • the one or more PEG may have a molecular weight ranging from about 1 kDa to about 100 kDa, about 10 to about 60 kDa, and about 10 to about 40 kDa.
  • the PEG group may be a linear PEG or a branched PEG.
  • the soluble, monomeric sEphB4 conjugate comprises an sEphB4 polypeptide covalently linked to one PEG group of from about 10 to about 40 kDa (monoPEGylated EphB4), or from about 15 to 30 kDa, preferably via an s-amino group of sEphB4 lysine or the N-terminal amino group.
  • the sEphB4 is randomly PEGylated at one amino group out of the group consisting of the s-amino groups of sEphB4 lysine and the N-terminal amino group.
  • the sEphB4 polypeptide is stably associated with a second stabilizing polypeptide that confers improved half-life without substantially diminishing EphrinB2 binding.
  • the stabilizing polypeptide is immunocompatible with human patients (or animal patients, where veterinary uses are contemplated) and will have little or no significant biological activity.
  • the sEphB4 polypeptide is associated covalently or non-covalently with an albumin selected from the group consisting of a human serum albumin (HSA) (hereinafter “sEphB4-HSA”) and bovine serum albumin (BSA”) (hereinafter “sEphB4-BSA”).
  • HSA human serum albumin
  • BSA bovine serum albumin
  • the covalent attachment may be achieved by expression of the sEphB4 polypeptide as a co-translational fusion with human serum albumin.
  • the albumin sequence may be fused at the N-terminus, the C-terminus or at a non-disruptive internal position in the sEphB4 polypeptide. Exposed loops of the sEphB4 would be appropriate positions for insertion of an albumin sequence.
  • Albumin may also be post- translationally attached to the sEphB4 polypeptide by, for example, chemical cross-linking.
  • the sEphB4 polypeptide may also be stably associated with more than one albumin polypeptide.
  • the sEphB4-HSA fusion inhibits the interaction between EphrinB2 and EphB4, the clustering of EphrinB2 or EphB4, the phosphorylation of EphrinB2 or EphB4, or combinations thereof.
  • the sEphB4-HSA fusion has enhanced in vivo stability relative to the unmodified wildtype polypeptide.
  • the sEphB4-HSA comprises residues 16-197 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-312 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-321 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-326 of SEQ ID NO: 1 directly fused to residues 25- 609 of SEQ ID NO: 2.
  • the sEphB4-HSA comprises residues 16-412 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-427 of SEQ ID NO: 1 directly fused to residues 25- 609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-429 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises residues 16-526 of SEQ ID NO: 1 directly fused to residues 25- 609 of SEQ ID NO: 2.
  • the sEphB4-HSA comprises residues 16-537 of SEQ ID NO: 1 directly fused to residues 25-609 of SEQ ID NO: 2. In some embodiments, the sEphB4-HSA comprises the amino acid sequence set forth in SEQ ID NO: 3. In some embodiments, the sEphB4-HSA comprises the amino acid sequence set forth in SEQ ID NO: 4. In some embodiments, the sEphB4-HSA comprises the amino acid sequence set forth in SEQ ID NO: 5.
  • a sEphB4 polypeptide may be prepared in a multimeric form, by, for example, expressing as a fusion protein with a molecule that blocks signaling or blocks EphrinB2 interaction with Eph receptors, including but not limited to antisense oligonucleotides, siRNA, and gene editing like CRISPR/CAS.
  • the methods of the present invention may utilize nucleic acid therapeutic agents that inhibit or reduce gene expression of ephrin ligand and/or Eph in a cancer.
  • nucleic acid therapeutic agent or “nucleic acid agent” or “nucleic acid compound” refers to any nucleic acid-based compound that contains nucleotides and has a desired effect on a target gene.
  • nucleic acid therapeutic agents contemplated for use include, but are not limited to, antisense nucleic acids, dsRNA, siRNA, and enzymatic nucleic acid compounds.
  • antisense nucleic acid is meant a non-enzymatic nucleic acid compound that binds to a target nucleic acid by means of RNA-RNA, RNA-DNA or RNA-PNA (protein nucleic acid) interactions and alters the activity of the target nucleic acid (for a review, see Stein and Cheng, 1993 Science 261 , 1004 and Woolf et aL, U.S. Pat. No. 5,849,902).
  • antisense molecules are complementary to a target sequence along a single contiguous sequence of the antisense molecule.
  • an antisense molecule can form a loop and binds to a substrate nucleic acid which forms a loop.
  • an antisense molecule can be complementary to two (or more) non-contiguous substrate sequences, or two (or more) non-contiguous sequence portions of an antisense molecule can be complementary to a target sequence, or both.
  • Schmajuk et aL 1999, J. Biol. Chem., 274:21783-21789
  • Stein et aL 1997, Antisense N. A. Drug Dev., 7:151 ; Crooke, 2000, Methods EnzymoL, 313:3-45; and Crooke, 1998, Biotech. Genet. Eng. Rev., 15:121- 157.
  • the antisense nucleic acids of the disclosure can be delivered, for example, as an expression plasmid which, when transcribed in the cell, produces RNA which is complementary to at least a unique portion of the cellular mRNA which encodes an Ephrin B2 or EphB4 polypeptide.
  • the construct is an oligonucleotide which is generated ex vivo and which, when introduced into the cell causes inhibition of expression by hybridizing with the mRNA and/or genomic sequences encoding an Ephrin B2 or EphB4 polypeptide.
  • oligonucleotide probes are optionally modified oligonucleotide which are resistant to endogenous nucleases, e.g., exonucleases and/or endonucleases, and are therefore stable in vivo.
  • exemplary nucleic acid compounds for use as antisense oligonucleotides are phosphoramidate, phosphothioate and methylphosphonate analogs of DNA (see also U.S. Patent Nos. 5,176,996; 5,264,564; and 5,256,775).
  • dsRNA double stranded RNA
  • RNAi RNA interference
  • siRNA see, e.g., Bass, 2001 , Nature, 411 :428-429; Elbashir et aL, 2001 , Nature, 411 :494-498; and Kreutzer et aL, PCT Publication No. WO 00/44895; Zernicka-Goetz et aL, PCT Publication No. WO 01/36646; and Li et aL, PCT Publication No.
  • RNAi is a term initially applied to a phenomenon observed in plants and worms where double-stranded RNA (dsRNA) blocks gene expression in a specific and post-transcriptional manner. RNAi provides a useful method of inhibiting gene expression in vitro or in vivo.
  • dsRNA double-stranded RNA
  • siRNA short interfering RNA
  • siRNA short interfering nucleic acid
  • the siRNA can be a doublestranded polynucleotide molecule comprising self-complementary sense and antisense regions, wherein the antisense region comprises complementarity to a target nucleic acid compound (e.g., Ephrin B2 or EphB4).
  • a target nucleic acid compound e.g., Ephrin B2 or EphB4
  • the siRNA can be a single-stranded hairpin polynucleotide having self-complementary sense and antisense regions, wherein the antisense region comprises complementarity to a target nucleic acid compound.
  • the siRNA can be a circular single-stranded polynucleotide having two or more loop structures and a stem comprising self-complementary sense and antisense regions, wherein the antisense region comprises complementarity to a target nucleic acid compound, and wherein the circular polynucleotide can be processed either in vivo or in vitro to generate an active siRNA capable of mediating RNAi.
  • the siRNA can also comprise a single stranded polynucleotide having complementarity to a target nucleic acid compound, wherein the single stranded polynucleotide can further comprise a terminal phosphate group, such as a 5'-phosphate (see for example Martinez et aL, 2002, Cell., 110, 563-574), or 5', 3'- diphosphate.
  • a terminal phosphate group such as a 5'-phosphate (see for example Martinez et aL, 2002, Cell., 110, 563-574), or 5', 3'- diphosphate.
  • Applicants have generated a number of monoclonal antibodies against EphB4 as well as hybridoma cell lines producing EphB4 monoclonal antibodies. These antibodies were further characterized in many ways, such as, their ability to inhibit interaction between EphB4 and its ligand (e.g., Ephrin B2), their ability to inhibit dimerization or multimerization of EphB4 receptor, their ability to induce tyrosine phosphorylation of EphB4, their crossreactivity with other Eph family members, their ability to inhibit angiogenesis, and their ability to inhibit tumor growth.
  • EphB4 and its ligand e.g., Ephrin B2
  • Ephrin B2 its ligand
  • their ability to inhibit dimerization or multimerization of EphB4 receptor their ability to induce tyrosine phosphorylation of EphB4
  • their crossreactivity with other Eph family members their ability to inhibit angiogenesis, and their ability to inhibit tumor growth.
  • EphB4 antibodies may specifically bind to one or more regions of EphB4 (e.g., a globular domain, a cystein-rich domain, or a fibronectin type III domain).
  • EphB4 antibody may bind to both fibronectin type 3 domains.
  • Such antibodies have been described in, e.g., US 20050249736, US 20090196880, US 8,273,858, US 8,981 ,062 and US 8,975,377.
  • methods of the present invention include administering to a patient in need of treatment a therapeutically effective amount or an effective dose of sEphB4-HSA polypeptide of the present invention.
  • effective doses of the polypeptides of the present invention e.g., for the treatment of primary or metastatic cancer, described herein vary depending upon many different factors, including means of administration, target site, physiological state of the patient, whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic.
  • the patient is a human but nonhuman mammals including transgenic mammals can also be treated. Treatment dosages need to be titrated to optimize safety and efficacy.
  • the dosage may range from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5.0 mg/kg, of the host body weight.
  • dosages can be 1 mg/kg body weight or 10 mg/kg body weight or within the range of 1 -10 mg/kg.
  • the dosage of the polypeptide administered to the patient is selected from the group consisting of about 0.5, of about 1 .0, of about 1 .5, of about 2.0, of about 2.5, of about 3.0, of about 3.5, of about 4.0, of about 4.5, of about 5.0, of about 6.0, of about 7.0, of about 8.0, of about 9.0, and of about 10.0 mg/kg.
  • the treatment regime entails administration once per every two weeks or once a month or once every 3 to 6 months.
  • Therapeutic entities of the present invention are usually administered on multiple occasions. Intervals between single dosages can be weekly, bi-weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of the therapeutic entity in the patient.
  • therapeutic entities of the present invention can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the half-life of the polypeptide in the patient.
  • immune-checkpoint protein antigens have been reported to be expressed on various immune cells, including, e.g., SIRP (expressed on macrophage, monocytes, dendritic cells), CD47 (highly expressed on tumor cells and other cell types), VISTA (expressed on monocytes, dendritic cells, B cells, T cells), TIGIT (immune receptor present on some T cells and natural killer cells), CD152 (expressed by activated CD8+ T cells, CD4+ T cells and regulatory T cells), CD279 (expressed on tumor infiltrating lymphocytes, expressed by activated T cells (both CD4 and CD8), regulatory T cells, activated B cells, activated NK cells, anergic T cells, monocytes, dendritic cells), CD274 (expressed on T cells, B cells, dendritic cells, macrophages, vascular endothelial cells, pancreatic islet cells), and CD223 (expressed by activated T cells, regulatory T cells, anergic T
  • Antibodies that bind to an antigen which is determined to be an immune-checkpoint protein are known to those skilled in the art.
  • various anti-CD276 antibodies have been described in the art (see, e.g., U.S. Pat. Public. No. 20120294796 (Johnson et al) and references cited therein);
  • various anti-CD272 antibodies have been described in the art (see, e.g., U.S. Pat. Public. No. 20140017255 (Mataraza et al) and references cited therein);
  • various anti-CD152/CTLA-4 antibodies have been described in the art (see, e.g., U.S. Pat. Public. No.
  • Immune checkpoint inhibitor targeting agents are effective in patients with tumors that express inflammatory signatures and contain resident immune cells commonly referred to as “hot tumors.” Tumors with a few or no immune cells (cold tumors) are less likely or unlikely to respond. Immune checkpoint PD-1 and CTLA inhibitors are efficacious in several cancers which express interferon gamma signature, are rich in tumor infiltrating immune cells and express PD-L1 . Tumor vessels regulate immune cell exit into the tumors, thus tumor vessel modulation may offer avenue to change tumor environment.
  • the PD-1 receptor-ligand interaction is a major pathway hijacked by tumors to suppress immune control.
  • the normal function of PD-1 expressed on the cell surface of activated T-cells under healthy conditions, is to down-modulate unwanted or excessive immune responses, including autoimmune reactions.
  • the ligands for PD-1 (PD-L1 and PD- L2) are constitutively expressed or can be induced in a variety of cell types, including non- hematopoietic tissues as well as in various tumors. Binding of either PD-1 ligand to PD-1 inhibits T-cell activation triggered through the T-cell receptor.
  • PD-1 has been suggested to regulate tumor-specific T-cell expansion in subjects with melanoma (MEL). This suggests that the PD-1/PD-L1 pathway plays a critical role in tumor immune evasion and should be considered as an attractive target for therapeutic intervention.
  • Pembrolizumab (KEYTRUDA®) is a potent and highly selective humanized monoclonal antibody (mAb) of the lgG4/kappa isotype designed to directly block the interaction between PD-1 and its ligands, PD-L1 and PD-L2.
  • FDA Food and Drug Administration
  • KEYTRUDA® has recently been approved in the United Stated for the treatment of patients with unresectable or metastatic melanoma and disease progression following ipilumumab and, if BRAF V600 mutation positive, a BRAF inhibitor.
  • Nivolumab is a human lgG4 anti-PD-1 monoclonal antibody that works as a checkpoint inhibitor, blocking a signal that would have prevented activated T cells from attacking the cancer, thus allowing the immune system to clear the cancer.
  • OPDIVO® is used as a first line treatment for inoperable or metastatic melanoma in combination with ipilimumab if the cancer does not have a mutation in BRAF as a second-line treatment following treatment with ipilimumab and if the cancer has a mutation in BRAF, with a BRAF inhibitor as a second-line treatment for squamous non-small cell lung cancer and as a second-line treatment for renal cell carcinoma.
  • the PD-1 inhibitor used in the combination therapy methods is selected from the group consisting of, but not limited to, nivolumab (Bristol-Myers Squibb)(Drugbank 09035; Drugbank 06132), pembrolizumab (Merck)(Drugbank 09037) and pidilizumab (Medivation)(Drugbank 15383).
  • the CTLA-4 inhibitor is selected from the group consisting of, but not limited to, ipilimumab (Bristol-Myers Squibb)(Drugbank 06186) and tremelimumab (Medlmmune)(Drugbank 11771 ).
  • Pembrolizumab is approved for this patient population, it is effective in only a minority of the patients having a median overall survival (OS) of 10.3 months (95% Cl, 8-11.8), median overall progression free survival (PFS) of 2.1 months (95% Cl, 2.0-2.2), with overall response rate (ORR) of 21 .1% (95% Cl, 16.4 to 26.5), and complete response rate of 7% in this patient population.
  • OS median overall survival
  • PFS median overall progression free survival
  • ORR overall response rate
  • Hepatocellular carcinoma is the most frequent cancer in certain parts of the world, and the fifth most cancer common worldwide. Globally, it is the second leading cause of cancer death in men and the sixth leading cause of cancer death among women (see, e.g., Parkin D. M., Lancet Oncology, 2:533-43, 2001). Because HCC is often diagnosed late in the course of clinical manifestation, only 10-15% of patients are candidates for curative surgery. For the majority of HCC patients, systemic chemotherapies or supportive therapies are the mainstay treatment options. HCC in general is highly refractory to therapy and most chemotherapeutic agents show limited effectiveness and have not been able to improve patient survival (see, e.g., Gish R. G.
  • HNSCC Head and neck squamous cell carcinoma
  • UDT upper aerodigestive tract
  • the objective response rate is 6-20% (Szturz P, et aL, BMC Med, 15:110, 2017; Ferris RL, et al., Oral Oncol, 81 :45-51 , 2018; Postow MA, et aL, J Clin Oncol, 33:1974-82, 2015; Chow LQM, et aL, J Clin Oncol, 34:3838-45, 2016; Siu LL, et aL, JAMA Oncol 2018) and the vast majority of patients demonstrate either innate or adaptive resistance to immunotherapy.
  • Radiotherapy remains the standard of care treatment in the definitive management of patients with locally advanced HNSCCs and can act as an adjuvant for immunotherapy but there are some undesirable effects mounted in response to RT that in turn compromises the efficacy of immunotherapeutic agents.
  • RT is unable to overcome the accumulation of immunosuppressive populations such as Tregs in the later (repair) phase (7). Therefore, finding other treatments that synergize with RT and counteract its negative effects is critical to overcome adverse side-effects, treatment resistance, and tumor regrowth.
  • Five-year survival rates for HNSCC are low and have not improved in several decades. Moreover, patients with this disease experience severe morbidity including disfigurement, speech, swallowing and breathing problems.
  • Pembrolizumab is a potent and highly selective humanized monoclonal antibody (mAb) of the lgG4/kappa isotype designed to directly block the interaction between PD-1 and its ligands, PD-L1 and PD-L2.
  • mAb monoclonal antibody
  • HNSCC metastatic head and neck squamous cell carcinoma
  • Non-small cell lung cancer is the most common type of lung cancer. Squamous cell carcinoma, adenocarcinoma, and large cell carcinoma are all subtypes of NSCLC. NSCLC accounts for about 85% of all lung cancers. As a class, NSCLCs are relatively insensitive to chemotherapy, compared to small cell carcinoma. When possible, they are primarily treated by surgical resection with curative intent, although chemotherapy is increasingly being used both pre-operatively (neoadjuvant chemotherapy) and post- operatively (adjuvant chemotherapy).
  • pembrolizumab for the treatment of metastatic non-small cell lung cancer (NSCLC) in patients whose tumors express PD-L1 and who have failed treatment with other chemotherapeutic agents.
  • NSCLC metastatic non-small cell lung cancer
  • pembrolizumab became the first immunotherapy to be used first line in the treatment of NSCLC if the cancer overexpresses PDL1 and the cancer has no mutations in EGFR or in ALK; if chemotherapy has already been administered, then pembrolizumab can be used as a second line treatment but if the cancer has EGFR or ALK mutations, agents targeting those mutations should be used first.
  • Assessment of PDL1 must be conducted with a validated and approved companion diagnostic.
  • PD-1 inhibition was assessed in patients with advanced non-small-cell lung cancer.
  • the objective response rate was 19.4%, and the median duration of response was 12.5 months.
  • the median duration of progression- free survival was 3.7 months, and the median duration of overall survival was 12.0 months.
  • PD-L1 expression in at least 50% of tumor cells was selected as the cutoff from the training group.
  • the response rate was 45.2%.
  • median progression-free survival was 6.3 months; median overall survival was not reached.
  • PD-L1 expression in at least 50% of tumor cells correlated with improved efficacy of pembrolizumab (Garon et al., N Engl J Med, 372:2018-2028, 2015).
  • Prostate cancer is the most common non-cutaneous malignancy in men and the second leading cause of death in men from cancer in the western world. Prostate cancer results from the uncontrolled growth of abnormal cells in the prostate gland. Once a prostate cancer tumor develops, androgens, such as testosterone, promote prostate cancer tumor growth. At its early stages, localized prostate cancer is often treated with local therapy including, for example, surgical removal of the prostate gland and radiotherapy. However, when local therapy fails to cure prostate cancer, as it does in up to a third of men, the disease progresses into incurable metastatic disease (i.e. , disease in which the cancer has spread from one part of the body to other parts).
  • metastatic disease i.e. , disease in which the cancer has spread from one part of the body to other parts.
  • prostatic cancer is used in the broadest sense and refers to all stages and all forms of cancer arising from the tissue of the prostate gland.
  • prostatic cancer encompasses any type of malignant (i.e. non-benign) tumor located in prostatic tissues, such as e.g. prostatic adenocarcinoma, prostatic sarcoma, undifferentiated prostate cancer, prostatic squamous cell carcinoma, prostatic ductal transitional carcinoma and prostatic intraepithelial neoplasia.
  • Kaposi sarcoma is a multifocal angioproliferative disorder of vascular endothelium, most associated with infection with the Kaposi-sarcoma associated herpes virus (KSHV), also known as human herpes virus-8 (HHV-8).
  • KSHV herpes virus
  • HHV-8 human herpes virus-8
  • KS is associated with a number of epidemiologic and pathophysiologic factors. KS is classified into four distinct clinical types: classic Mediterranean KS, African-endemic KS, immunosuppressive drug- related KS, and HIV-related KS. A rare disease before the era of HIV and AIDS, HIV-related KS is the most frequent malignancy in HIV infected patients. KS can affect many organs. KS manifests most frequently as a disease of the skin.
  • KS In many advanced cases, KS involves organs such as the lungs, liver, or gastrointestinal tract. At this time, KS is incurable.
  • Available therapies are for palliation. Systemic chemotherapy is generally used for patients with more advanced disease or evidence of rapid progression of disease. The major goals of treatment are symptom palliation, prevention of disease progression, and reduction of tumor burden to alleviate lymphedema, organ compromise, and psychological stress.
  • the standard therapies for visceral or advanced cutaneous KS include cytotoxic chemotherapy such as liposomal anthracycline and paclitaxel.
  • Liposomal doxorubicin has superior efficacy and favorable tolerability and toxicity compared to the combination of non-liposomal doxorubicin, vincristine, and bleomycin with overall response rates of 59% in HIV patients.
  • response rates to liposomal doxorubicin can be higher.
  • complete response rates are uncommon and there is no cure. At this point in time, no targeted therapy has been fully developed for KS.
  • Combination therapy with gemcitabine-based regimens for locally advanced and metastatic pancreatic cancer was shown in a meta-analysis to provide a slight benefit in overall survival (OS), albeit with more frequent toxicities, and there is also evidence to suggest an improved benefit with combination regimens in patients with good performance status.
  • One such combination regimen is gemcitabine plus albumin-bound paclitaxel (nab-paclitaxel).
  • nab-paclitaxel albumin-bound paclitaxel
  • 861 patients were randomized in a 1 :1 ratio to receive either intravenous infusions of gemcitabine (1000 mg per square meter body surface area or mg/m 2 ) alone or gemcitabine (1000 mg/m 2 ) plus nab-paclitaxel (125 mg/m 2 ).
  • the combination group had an increased median overall survival of 8.5 months as compared to 6.7 months in the single agent group, but more high-grade neutropenia, fatigue, and neuropathy were seen in the former.
  • 41% of patients had dose-reductions of nab-paclitaxel, and 47% had dose reductions of gemcitabine.
  • FDA Food and Drug Administration
  • An updated OS analysis of the MPACT study published in 2015 confirmed a longer median OS of 8.7 months in the nab-paclitaxel and gemcitabine combination group, compared to 6.6 months in the gemcitabine monotherapy group.
  • the cancer is selected from the group consisting of, but not limited to, non-small cell lung carcinoma (NSCLC), colon carcinoma, metastatic urothelial cancer, breast cancer, hepatocellular carcinoma (HCC), mesothelioma, pancreatic cancer, prostate cancer, bladder cancer, squamous cell carcinoma of the head and neck (HNSCC), Kaposi sarcoma, and leukemia.
  • NSCLC non-small cell lung carcinoma
  • HCC hepatocellular carcinoma
  • mesothelioma mesothelioma
  • pancreatic cancer prostate cancer
  • bladder cancer squamous cell carcinoma of the head and neck
  • Kaposi sarcoma Kaposi sarcoma
  • leukemia leukemia
  • the patient previously responded to treatment with an anti-cancer therapy, but, upon cessation of therapy, suffered relapse (hereinafter “a recurrent proliferative disease”).
  • the patient has resistant or refractory cancer.
  • the cancer is refractory to immunotherapy treatment.
  • the cancer is refractory to treatment with a chemotherapeutic agent.
  • the cancer is refractory to treatment using depleting antibodies to specific tumor antigens.
  • the cancer is refractory to treatment using agonistic, antagonistic, or blocking antibodies to co-stimulatory or co-inhibitory molecules (immune checkpoints).
  • the cancer is refractory to targeted treatment with an immunoconjugate, antibody-drug conjugate (ADC), or fusion molecule comprising a depleting antibody to a specific tumor antigen and a cytotoxic agent.
  • ADC antibody-drug conjugate
  • the cancer is refractory to targeted treatment with a small molecule kinase inhibitor.
  • the cancer is refractory to combination therapy involving, for example, two or more of: immunotherapy treatment, treatment with a chemotherapeutic agent, treatment using depleting antibodies to specific tumor antigens, treatment using agonistic, antagonistic, or blocking antibodies to co-stimulatory or co-inhibitory molecules (immune checkpoints), treatment with a immunoconjugate, ADC, or fusion molecule comprising a depleting antibody to a specific tumor antigen and a cytotoxic agent, targeted treatment with a small molecule kinase inhibitor, treatment using surgery, treatment using a therapeutic vaccine, treatment using stem cell transplantation, and treatment using radiation.
  • immunotherapy treatment treatment with a chemotherapeutic agent
  • treatment using depleting antibodies to specific tumor antigens treatment using agonistic, antagonistic, or blocking antibodies to co-stimulatory or co-inhibitory molecules (immune checkpoints)
  • ADC or fusion molecule comprising a depleting antibody to a specific tumor antigen and a cytotoxic agent
  • the method for treating or delaying progression of a cancer in a subject further comprises a second therapy selected from the group consisting of: small molecule kinase inhibitor targeted therapy, surgery, cytoreductive therapy, cytotoxic chemotherapy, and immunotherapy.
  • the combination therapy will be synergistic.
  • the second therapy is cytoreductive therapy and the combination may increase the therapeutic index of the cytoreductive therapy.
  • the cytoreductive therapy may act in a DNA repair pathway.
  • the cytoreductive therapy is radiation therapy.
  • the combination may be synergistic.
  • the combination therapy comprises anti-proliferative, or cytoreductive therapy.
  • Anti-proliferative, or cytoreductive therapy is used therapeutically to eliminate tumor cells and other undesirable cells in a host and includes the use of therapies such as delivery of ionizing radiation, and administration of chemotherapeutic agents.
  • ionizing radiation I R
  • I R ionizing radiation
  • Radiation injury to cells is nonspecific, with complex effects on DNA. The efficacy of therapy depends on cellular injury to cancer cells being greater than to normal cells.
  • Radiotherapy may be used to treat every type of cancer.
  • Some types of radiation therapy involve photons, such as X-rays or gamma rays.
  • Another technique for delivering radiation to cancer cells is internal radiotherapy, which places radioactive implants directly in a tumor or body cavity so that the radiation dose is concentrated in a small area.
  • a suitable dose of ionizing radiation may range from at least about 2 Gy to not more than about 10 Gy, usually about 5 Gy.
  • a suitable dose of ultraviolet radiation may range from at least about 5 J/m 2 to not more than about 50 J/m 2 , usually about 10 J/m 2 .
  • the sample may be collected from at least about 4 and not more than about 72 hours following ultraviolet radiation, usually around about 4 hours.
  • Chemotherapeutic agents are well-known in the art and are used at conventional doses and regimens, or at reduced dosages or regimens, including for example, topoisomerase inhibitors such as anthracyclines, including the compounds daunorubicin, adriamycin (doxorubicin), epirubicin, idarubicin, anamycin, MEN 10755, and the like.
  • topoisomerase inhibitors include the podophyllotoxin analogues etoposide and teniposide, and the anthracenediones, mitoxantrone and amsacrine.
  • anti-proliferative agent interferes with microtubule assembly, e.g., the family of vinca alkaloids.
  • vinca alkaloids include vinblastine, vincristine; vinorelbine (NAVELBINE); vindesine; vindoline; vincamine; etc.
  • DNA-damaging agent include nucleotide analogs, alkylating agents, etc.
  • Alkylating agents include nitrogen mustards, e.g., mechlorethamine, cyclophosphamide, melphalan (L-sarcolysin), etc.
  • Nucleotide analogs include pyrimidines, e.g., cytarabine (CYTOSAR-U), cytosine arabinoside, fluorouracil (5- FU), floxuridine (FUdR), etc.; purines, e.g., thioguanine (6-thioguanine), mercaptopurine (6- MP), pentostatin, fluorouracil (5-FU) etc.; and folic acid analogs, e.g., methotrexate, 10- propargyl-5,8-dideazafolate (PDDF, CB3717), 5,8-dideazatetrahydrofolic acid (DDATHF), leucovorin, etc.
  • chemotherapeutic agents of interest include metal complexes, e.g., cisplatin (cis-DDP), carboplatin, oxaliplatin, etc.; ureas, e.g., hydroxyurea; gemcitabine, and hydrazines, e.g., N-methylhydrazine.
  • metal complexes e.g., cisplatin (cis-DDP), carboplatin, oxaliplatin, etc.
  • ureas e.g., hydroxyurea
  • gemcitabine e.g., N-methylhydrazine.
  • the dosages of such chemotherapeutic agents include, but is not limited to, about any of 10 mg/m 2 , 20 mg/m 2 , 30 mg/m 2 , 40 mg/m 2 , 50 mg/m 2 , 60 mg/m 2 , 75 mg/m 2 , 80 mg/m 2 , 90 mg/m 2 , 100 mg/m 2 , 120 mg/m 2 , 150 mg/m 2 , 175 mg/m 2 , 200 mg/m 2 , 210 mg/m 2 , 220 mg/m 2 , 230 mg/m 2 , 240 mg/m 2 , 250 mg/m 2 , 260 mg/m 2 , and 300 mg/m 2 .
  • the combination therapy will comprise immunotherapy.
  • immunotherapy refers to cancer treatments which include, but are not limited to treatment using depleting antibodies to specific tumor antigens (see, e.g., reviews by Blattman and Greenberg, Science, 305:200, 2004; Adams and Weiner, Nat Biotech, 23:1147, 2005; Vogal et al. J Clin Oncology, 20:719, 2002; Colombat et aL, Blood, 97:101 , 2001 ); treatment using antibody-drug conjugates (see, e.g., Ducry, Laurent (Ed.) Antibody Drug Conjugates. In: Methods in Molecular Biology. Book 1045.
  • immune checkpoints Treatment using agonistic, antagonistic, or blocking antibodies to co-stimulatory or co-inhibitory molecules (immune checkpoints) has been an area of extensive research and clinical evaluation. Under normal physiological conditions, immune checkpoints are crucial for the maintenance of self-tolerance (that is, the prevention of autoimmunity) and protect tissues from damage when the immune system is responding to pathogenic infection. It is now also clear that tumors co-opt certain immune-checkpoint pathways as a major mechanism of immune resistance, particularly against T cells that are specific for tumor antigens (Pardoll DM., Nat Rev Cancer, 12:252-64, 2012).
  • immune checkpoint molecules including, e.g., CTLA-4 (ipilimumab), PD-1 (nivolumab; pembrolizumab; pidilizumab) and PD-L1 (BMS-936559; MPLD3280A;
  • MEDI4736; MSB0010718C (see, e.g, Philips and Atkins, International Immunology, 27(1 ); 39-46, Oct 2014), and OX-40, CD137, GITR, LAG3, TIM-3, and VISTA (see, e.g., Sharon et aL, Chin J Cancer., 33(9): 434-444, Sep 2014; Hodi et aL, N Engl J Med, 2010; Topalian et aL, N Engl J Med, 366:2443-54) are being evaluated as new, alternative immunotherapies to treat patients with proliferative diseases such as cancer, and in particular, patients with refractory and/or recurrent cancers.
  • proliferative diseases such as cancer, and in particular, patients with refractory and/or recurrent cancers.
  • between about 0.1 mg/kg to about 10 mg/kg of PD-1 inhibitor is administered. In various embodiments, between about 1 mg/kg to about 15 mg/kg of PD-1 inhibitor is administered. In various embodiments, between about 3 mg/kg to about 12 mg/kg of PD-1 inhibitor is administered. In various embodiments, between about 1 mg/kg to about 10 mg/kg of PD-1 inhibitor is administered. In various embodiments, between about 3 mg/kg to about 10 mg/kg of PD-1 inhibitor is administered. In various embodiments, at least about 1 mg/kg of PD-1 inhibitor is administered. In various embodiments, at least about 2 mg/kg of PD-1 inhibitor is administered. In various embodiments, at least about 3 mg/kg of PD-1 inhibitor is administered.
  • At least about 5 mg/kg of PD-1 inhibitor is administered. In various embodiments, at least about 10 mg/kg of PD-1 inhibitor is administered. In various embodiments, between about 10 mg to about 400 mg of PD-1 inhibitor is administered. In various embodiments, between about 50 mg to about 400 mg of PD-1 inhibitor is administered. In various embodiments, between about 10 mg to about 300 mg of PD-1 inhibitor is administered. In various embodiments, between about 50 mg to about 300 mg of PD-1 inhibitor is administered. In various embodiments, between about 10 mg to about 250 mg of PD-1 inhibitor is administered. In various embodiments, between about 50 mg to about 250 mg of PD-1 inhibitor is administered. In various embodiments, at least about 50 mg of PD-1 inhibitor is administered.
  • At least about 100 mg of PD-1 inhibitor is administered. In various embodiments, at least about 150 mg of PD-1 inhibitor is administered. In various embodiments, at least about 200 mg of PD-1 inhibitor is administered. In various embodiments, at least about 250 mg of PD-1 inhibitor is administered. In various embodiments, at least about 300 mg of PD-1 inhibitor is administered. In various embodiments, the PD-1 inhibitor is administered at least once during a cycle. In various embodiments, the PD-1 inhibitor is administered at least twice during a cycle. In various embodiments, a cycle is 21 days. In various embodiments, a cycle is 28 days. In various embodiments, the PD-1 inhibitor is administered at least once a week. In various embodiments, the PD-1 inhibitor is administered at least once every two weeks.
  • the PD-1 inhibitor is administered at least once every three weeks. In various embodiments, the PD-1 inhibitor is administered at least once every four weeks.
  • Treatment using chimeric antigen receptor (CAR) T cell therapy is an immunotherapy in which the patient's own T cells are isolated in the laboratory, redirected with a synthetic receptor to recognize a particular antigen or protein, and reinfused into the patient.
  • CARs are synthetic molecules that minimally contain: (1) an antigen-binding region, typically derived from an antibody, (2) a transmembrane domain to anchor the CAR into the T cells, and (3) 1 or more intracellular T cell signaling domains.
  • a CAR redirects T cell specificity to an antigen in a human leukocyte antigen (HLA)-independent fashion, and overcomes issues related to T cell tolerance (Kalos M and June CH, Immunity, 39(1):49-60, 2013).
  • HLA human leukocyte antigen
  • CAR-T cell therapy Over the last 5 years, at least 15 clinical trials of CAR-T cell therapy have been published.
  • a new wave of excitement surrounding CAR-T cell therapy began in August 2011 , when investigators from the University of Pennsylvania (Penn) published a report on 3 patients with refractory chronic lymphocytic leukemia (CLL) who had long-lasting remissions after a single dose of CAR T cells directed to CD 19 (Porter DL, et aL, N Engl J Med., 365(8):725-733, 2011).
  • CLL chronic lymphocytic leukemia
  • NK-92 natural killer cells
  • HANK-1 KHYG-1
  • KHYG-1 KHYG-1
  • NK-YS NKG
  • YT YTS
  • NKL NK3.3
  • CAR-NK CAR expressing NK cells
  • CAR-NK CAR expressing NK cells
  • Bispecific T-cell engager molecules constitute a class of bispecific singlechain antibodies for the polyclonal activation and redirection of cytotoxic T cells against pathogenic target cells.
  • BiTEOs are bispecific for a surface target antigen on cancer cells, and for CD3 on T cells.
  • BiTEOs are capable of connecting any kind of cytotoxic T cell to a cancer cell, independently of T-cell receptor specificity, costimulation, or peptide antigen presentation, a unique set of properties that have not yet been reported for any other kind of bispecific antibody construct, namely extraordinary potency and efficacy against target cells at low T-cell numbers without the need for T-cell co-stimulation (Baeuerle et aL, Cancer Res, 69(12):4941-4, 2009).
  • BiTE antibodies have so far been constructed to more than 10 different target antigens, including CD19, EpCAM, Her2/neu, EGFR, CD66e (or CEA, CEACAM5), CD33, EphA2, and MCSP (or HMW-MAA)(ld.)
  • Treatment using BiTE® antibodies such as blinatumomab (Nagorsen, D. et al., Leukemia & Lymphoma 50(6): 886- 891, 2009) and solitomab (Amann et aL, Journal of Immunotherapy 32(5): 452-464, 2009) are being clinically evaluated.
  • the second therapy will comprise administration of a PARP inhibitor.
  • PARPs Poly(ADP-ribose) polymerases (PARPs) are a family of enzymes involved in various activities in response to DNA damage.
  • PARP-1 is a key DNA repair enzyme that mediates single strand break (SSB) repair through the base excision repair (BER) pathway.
  • PARP inhibitors have been demonstrated to selectively kill tumor cells that harbor BRCA1 and BRCA2 mutations.
  • pre-clinical and preliminary clinical data suggest that PARP inhibitors are selectively cytotoxic for tumors with homologous recombination repair deficiency caused by dysfunction of genes other than BRCA1 or BRCA2.
  • the PARP inhibitor is selected from the group consisting of ABT-767, AZD 2461 , BGB-290, BGP 15, CEP 9722, E7016, E7449, fluzoparib, ING1001 , JPI 289, MP 124, niraparib, olaparib, ONO2231 , rucaparib, SC 101914, talazoparib, veliparib, WW 46, or salts or derivatives thereof.
  • the anti-PARP therapy is administered at a dose equivalent to about 100 mg, about 200 mg, or about 300 mg of niraparib or a salt or derivative thereof.
  • the anti-PARP therapy is administered at a dose equivalent to about 100 mg of niraparib or a salt or derivative thereof. In some embodiments, the anti-PARP therapy is administered at a dose equivalent to about 200 mg of niraparib or a salt or derivative thereof. In certain embodiments, the anti-PARP therapy is administered at a dose equivalent to about 300 mg of niraparib or a salt or derivative thereof.
  • the second therapy will comprise administration of a therapeutic cancer vaccine.
  • Therapeutic cancer vaccines are designed to be used in people who already have cancer — they work against cancer cells that contain substances, called tumor-associated antigens, that are not present in normal cells or, if present, are at lower levels. Treatment vaccines can help the immune system learn to recognize and react to these antigens and destroy cancer cells that contain them.
  • a human papillomavirus (HPV) to prevent cervical, vaginal and vulvar cancers
  • Hepatitis B vaccine to prevent liver cancer.
  • the first FDA- approved oncolytic virus therapy is talimogene laherparepvec (T-VEC, or Imlygic®) based on herpes simplex virus type 1 .
  • the vaccine therapy is selected from, but not limited to, treatment using therapeutic vaccines such as sipuleucel-T; treatment using dendritic cell vaccines, treatment using oncolytic virus therapy; and treatment using tumor antigen peptide vaccines.
  • administration of the polypeptide therapeutic agents of the invention may be continued while the other therapy is being administered and/or thereafter.
  • the polypeptide therapeutic agents may be administered prior to, concurrently with, or following the additional anti-cancer therapy, usually within at least about 1 week, at least about 5 days, at least about 3 days, at least about 1 day.
  • the polypeptide therapeutic agents may be delivered in a single dose, or may be fractionated into multiple doses, e.g. delivered over a period of time, including daily, bidaily, semi-weekly, weekly, etc.
  • the effective dose will vary with the route of administration, the specific agent, the dose of anti-cancer agent, and the like, and may be determined empirically by one of skill in the art.
  • the treatment regime entails administration once per every two weeks or once a month or once every 3 to 6 months.
  • Therapeutic entities of the present invention are usually administered on multiple occasions. Intervals between single dosages can be weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of the therapeutic entity in the patient.
  • therapeutic entities of the present invention can be administered as a sustained release formulation, in which case less frequent administration is required. Dosage and frequency vary depending on the halflife of the polypeptide in the patient.
  • therapeutic entities of the present invention are often administered as pharmaceutical compositions comprising an active therapeutic agent, i.e., and a variety of other pharmaceutically acceptable components.
  • an active therapeutic agent i.e., and a variety of other pharmaceutically acceptable components.
  • the preferred form depends on the intended mode of administration and therapeutic application.
  • the compositions can also include, depending on the formulation desired, pharmaceutically acceptable, non-toxic carriers or diluents, which are defined as vehicles commonly used to formulate pharmaceutical compositions for animal or human administration. The diluent is selected so as not to affect the biological activity of the combination.
  • compositions or formulation may also include other carriers, adjuvants, or nontoxic, nontherapeutic, nonimmunogenic stabilizers and the like.
  • compositions of the present invention can also include large, slowly metabolized macromolecules such as proteins, polysaccharides such as chitosan, polylactic acids, polyglycolic acids and copolymers (such as latex functionalized SepharoseTM, agarose, cellulose, and the like), polymeric amino acids, amino acid copolymers, and lipid aggregates (such as oil droplets or liposomes). Additionally, these carriers can function as immunostimulating agents (/.e., adjuvants).
  • a relatively low dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives.
  • compositions or medicaments are administered to a patient susceptible to, or otherwise at risk of a disease or condition in an amount sufficient to eliminate or reduce the risk, lessen the severity, or delay the outset of the disease, including biochemical, histologic and/or behavioral symptoms of the disease, its complications and intermediate pathological phenotypes presenting during development of the disease.
  • therapeutic entities of the present invention are administered to a patient suspected of, or already suffering from such a disease in an amount sufficient to cure, or at least partially arrest, the symptoms of the disease (biochemical, histologic and/or behavioral), including its complications and intermediate pathological phenotypes in development of the disease.
  • An amount adequate to accomplish therapeutic or prophylactic treatment is defined as a therapeutically- or prophylactically effective dose.
  • agents are usually administered in several dosages until a sufficient response has been achieved. Typically, the response is monitored, and repeated dosages are given if there is a recurrence of the cancer.
  • compositions for the treatment of primary or metastatic cancer can be administered by parenteral, topical, intravenous, intratumoral, oral, subcutaneous, intraarterial, intracranial, intraperitoneal, intranasal, or intramuscular means.
  • parenteral topical, intravenous, intratumoral, oral, subcutaneous, intraarterial, intracranial, intraperitoneal, intranasal, or intramuscular means.
  • the most typical route of administration is intravenous or intratumoral although other routes can be equally effective.
  • compositions of the invention can be administered as injectable dosages of a solution or suspension of the substance in a physiologically acceptable diluent with a pharmaceutical carrier that can be a sterile liquid such as water, oils, saline, glycerol, or ethanol.
  • a pharmaceutical carrier that can be a sterile liquid such as water, oils, saline, glycerol, or ethanol.
  • auxiliary substances such as wetting or emulsifying agents, surfactants, pH buffering substances and the like can be present in compositions.
  • Other components of pharmaceutical compositions are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, and mineral oil. I n general, glycols such as propylene glycol or polyethylene glycol are preferred liquid carriers, particularly for injectable solutions.
  • Antibodies and/or polypeptides can be administered in the form of a depot injection or implant preparation which can be formulated in such a manner as to permit a sustained release of the active ingredient.
  • the composition comprises polypeptide at 1 mg/mL, formulated in aqueous buffer consisting of 10 mM Tris, 210 mM sucrose, 51 mM L-arginine, 0.01% polysorbate 20, adjusted to pH 7.4 with HCI or NaOH.
  • compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection can also be prepared.
  • the preparation also can be emulsified or encapsulated in liposomes or micro particles such as polylactide, polyglycolide, or copolymer for enhanced adjuvant effect, as discussed above. Langer, Science 249: 1527, 1990 and Hanes, Advanced Drug Delivery Reviews 28: 97-119, 1997.
  • the agents of this invention can be administered in the form of a depot injection or implant preparation which can be formulated in such a manner as to permit a sustained or pulsatile release of the active ingredient.
  • Additional formulations suitable for other modes of administration include oral, intranasal, and pulmonary formulations, suppositories, and transdermal applications.
  • binders and carriers include, for example, polyalkylene glycols or triglycerides; such suppositories can be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1%-2%.
  • Oral formulations include excipients, such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, and magnesium carbonate. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain 10%-95% of active ingredient, preferably 25%-70%.
  • Topical application can result in transdermal or intradermal delivery.
  • Topical administration can be facilitated by co-administration of the agent with cholera toxin or detoxified derivatives or subunits thereof or other similar bacterial toxins.
  • Co-administration can be achieved by using the components as a mixture or as linked molecules obtained by chemical crosslinking or expression as a fusion protein.
  • transdermal delivery can be achieved using a skin patch or using transferosomes. Paul et al., Eur. J. Immunol. 25: 3521 -24, 1995; Cevc etal., Biochem. Biophys. Acta 1368: 201-15, 1998.
  • the pharmaceutical compositions are generally formulated as sterile, substantially isotonic and in full compliance with all Good Manufacturing Practice (GMP) regulations of the U.S. Food and Drug Administration.
  • GMP Good Manufacturing Practice
  • a therapeutically effective dose of the polypeptide compositions described herein will provide therapeutic benefit without causing substantial toxicity.
  • Toxicity of the proteins described herein can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., by determining the LD 5 O (the dose lethal to 50% of the population) or the LD W o (the dose lethal to 100% of the population). The dose ratio between toxic and therapeutic effect is the therapeutic index.
  • the data obtained from these cell culture assays and animal studies can be used in formulating a dosage range that is not toxic for use in human.
  • the dosage of the proteins described herein lies preferably within a range of circulating concentrations that include the effective dose with little or no toxicity. The dosage can vary within this range depending upon the dosage form employed and the route of administration utilized. The exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition.
  • kits comprising the compositions of the invention and instructions for use.
  • the kit can further contain a least one additional reagent, for example a cytoreductive drug.
  • the compositions may be provided in a unit dose formulation.
  • Kits typically include a label indicating the intended use of the contents of the kit.
  • the term label includes any writing, or recorded material supplied on or with the kit, or which otherwise accompanies the kit.
  • Pembrolizumab is an existing therapy for patients with locally advanced or metastatic urothelial carcinoma who had failed platinum-treated metastatic urothelial carcinoma. This was based on phase 3 trial in which patients were randomized to pembrolizumab (270) or chemotherapy (paclitaxel, docetaxel or vinflunine) (272). Pembrolizumab vs chemotherapy had a median OS of 10.3 months (95% Cl 8-11 .8) vs 7.4 months, PFS of 2.1 months (95% Cl 2.0-2.2) vs 3.1 months, ORR of 21.1% (95% Cl 16.4- 26.5) vs 11 .4%. Complete remission with Pembrolizumab was 7%. Pembrolizumab was granted regular approval by the FDA.
  • Immune checkpoint inhibitor targeting agents like Pembrolizumab are effective in patients with tumors that express inflammatory signatures and contain resident immune cells commonly referred to as “hot tumors.” Tumors with a few or no immune cells (cold tumors) are unlikely to respond. Novel agents that recruit immune cells are, therefore, likely to improve patient response upon the current state of immunotherapy. Immune cell recruitment is in part limited by the tumor vascular barrier. EphrinB2 and its high affinity cognate receptor - EphB4 - are transmembrane proteins that are induced in tumor vessels and regulate immune cell trafficking.
  • Soluble extracellular fragment of EphB4 fused to albumin blocks interaction between endogenously expressed EphrinB2 and EphB4 and blocks bidirectional signaling. sEphB4-HSA promotes immune cell traffic.
  • sEphB4-HSA in combination with an anti- PD-1 antibody.
  • the treatment regimen consisted of sEphB4-HSA 10mg/kg IV infusion once a week plus Pembrolizumab (KEYTRUDA®) 200mg IV infusion every 3 weeks. Tumor response was measured every 6 weeks. Baseline tissue or archival tissues are collected for biomarkers (in particular, PD-L1 IHC 22C3 PharmDx, a companion marker of Pembrolizumab/KEYTRUDA®).
  • Eligibility criteria for patients were locally advanced or metastatic urothelial cancer, who had previously failed (relapsed or refractory or intolerant) cisplatin containing regimen for locally advanced or metastatic disease or patients who had relapsed within 12 months of cisplatin containing neo-adjuvant therapy. Exclusion criteria were patients who had received prior checkpoint inhibitor targeting therapy.
  • treatment regimen consisted of sEphB4-HSA 10mg/kg IV infusion once a week plus Pembrolizumab (KEYTRUDA®) 200mg IV infusion every 3 weeks. Tumor response was measured every 6 weeks. Baseline tissue or archival tissues are collected for biomarkers (in particular, PD-L1 IHC 22C3 PharmDx, a companion marker of Pembrolizumab). Independent evaluation of the response was assessed by a blinded radiologic review. PD-L1 staining was performed at a reference laboratory. All patients were eligible for toxicity assessment. Primary end point for study is OS, secondary end points are ORR and PFS. Analysis for high-risk subsets includes squamous cell variant, upper urinary tract disease, liver metastasis, hemoglobin ⁇ 10mg/dl, level, and performance status over 0. 69 patients were enrolled in the study.
  • EphrinB2 positive patients have an overall response rate ORR) of 51%, compared to overall 37% for all patients. Importantly, both response rates are higher than the expected of 21% (based on historical data) if patients were treated with pembrolizumab alone.
  • sEphB4-HSA alone during phase I portion of the study, and none had objective response.
  • the activity of combination of sEphB4-HSA combined with PD-1 antibody thus appears to occur by the complementary functions where sEphB4-HSA promotes migration of T cells into the tumor while PD-1 antibody activates newly recruited and resident immune cells to achieve durable response.
  • sEphB4-HSA and pembrolizumab demonstrated a true synergistic activity, as the overall survival is 21 months, which is double that of 10 months observed with monotherapy using pembrolizumab, and 69% of the secondary responders remain in remission after 2 years.
  • This clinical trial was a phase Ila, single arm, non-randomized, open-label trial of sEphB4-HSA combined with pembrolizumab (MK-7435) in patients with squamous cell carcinoma (SCC) of the head and neck.
  • SCC squamous cell carcinoma
  • Treatment regimen was sEphB4- HSA 10 mg/kg once per week on days 1 , 8 and 15, and Pembrolizumab 200 mg was given by intravenous infusion, once every 3 weeks, day 1 of each 3 week cycle. Therapy was given for a maximum of 24 months. Treatment was discontinued for confirmed radiographic disease progression, unacceptable adverse experiences, intercurrent illness, noncompliance with treatment, and patient or Tumor imaging was performed every 6 weeks (every 2 cycles) by computed tomography (CT) scan of the chest, abdomen and pelvis, plus a neck soft tissue CT scan, investigator decision to withdraw from the study. Tumor response was assessed according to RECIST.
  • CT computed tomography
  • Immunohistochemistry was performed on patient tumor samples obtained at baseline and week 8 (cycle 2) on therapy. Biomarkers analyzed included EphrinB2, PD-L1 , immune cell markers CD3, and CD8 for both collections. Patient tissue samples at baseline were sent to Caris Life Sciences for comprehensive tumor sequencing and PD-L1 using Monoclonal Rabbit Anti-PD-L1 Clone 28-8. Scoring for PD-L1 on both baseline and on- treatment tissue samples included tumor and immune cell membrane PD-L1 staining. Patients were determined to be PD-L1 positive if their tissue sample at baseline demonstrated >1% combined positive score (CPS).
  • CPS combined positive score
  • EphrinB2 was performed at the CLIA approved core laboratory and analyzed by an independent pathologist (LS).
  • EphrinB2 assay used Rabbit Monoclonal Anti-Ephrin B2 antibody. Scoring and analysis for EphrinB2 positivity at baseline and on-treatment biopsy was based on tumor cell membrane staining for EphrinB2. Patients were determined to be EphrinB2 positive if their tissue sample at baseline demonstrated >1% TPS. Scoring for both EphrinB2 and PD-L1 was based on a scale of 0 to 100 percent. p16 staining was done in the CLIA certified clinical laboratory as a routine service. IHC of immune markers was performed to assess immune cell infiltration into the tumor. This included staining for CD3, and CD8.
  • PD-L1 of 1% or greater was less common in this study population (11 of 25) which is consistent with the 3105 patient meta-analysis showing positivity in 42%, but substantially lower than reported such as 85% in Keynote 012.
  • ORR in PD-L1 of 1% or higher was similar to those with PD-L1 less than 1%, 3 of 11 and 3 of 13 respectively.
  • Response in PD-L1 negative 13 patients (3 of 13 or 23%) is surprising since PD-L1 less than 1% does shows very low response rate (4 of 46 of 8% in keynote 048). Results from the current study either reflect an anomaly of small numbers of offers and opportunity to address and unmet need.
  • Example 4 [00181] Patients with metastatic urothelial carcinoma have poor prognosis after failure of standard first-line chemotherapy. Immune check point programmed death 1 -programmed death ligand 1 antibodies have low response rates and thus there exists a major unmet need.
  • sEphB4- HSA soluble EphB4-human serum albumin
  • Patients may have received one or more additional systemic chemotherapy regimens for advanced disease before study enrollment.
  • the primary end points were tolerability and overall survival (OS).
  • the secondary end points were progression-free survival (PFS), objective response rate (ORR), duration of response, and toxicity.
  • PFS progression-free survival
  • ORR objective response rate
  • duration of response and toxicity.
  • the expression of sEphB4-HSA target EphrinB2 was correlated with outcomes.
  • Treatment regimen consisted of pembrolizumab 200 mg intravenously once on day 1 and sEphB4-HSA at 10 mg/m2 intravenously once daily on days 1 , 8, and 15 once every 3 weeks. Treatment was continued until RECIST -defined disease progression, development of unacceptable toxicity, withdrawal of consent by the patient, decision by the investigator to discontinue treatment, or the completion of 2 years of therapy.
  • the median age was 67 years, with a male to female ratio of 59 to 11.
  • Sites of disease at baseline included lymph nodes in 45 (64%), lungs in 24 (34%), liver in 18 (26%), and bone in nine (13%).
  • Bellmunt risk group distribution was as follows: 27% with no risk factors, 37% with one risk factor, and 36% with two or more risk factors.
  • Forty-six patients were EphrinB2-positive.
  • the median follow up was 22.9 months (range, 1 .3-54.7). The regimen had acceptable toxicity.
  • the median OS was 14.6 months (95% Cl, 9.2 to 21 .5).
  • Twenty-six (37%) patients had an objective response (95% Cl, 26 to 48).
  • the median PFS was 4.1 (95% Cl, 1 .5 to 5.7) months.
  • Forty-six (66%) patients expressed EphrinB2, and among them, the median OS was 21 .5 months (95% Cl, 12.4 to not reached), the ORR was 52% (95% Cl, 37 to 67), including a complete response rate of 24% (11 of 46; 95% Cl, 12 to 36).
  • the median PFS was 5.7 (95% Cl, 2.7 to 27.9) months. Response was maintained at 6, 12, and 24 months in 88%, 74%, and 69% of the patients, respectively.
  • EphrinB2 expression is a prognostic marker for urothelial carcinoma and a predictor of response to checkpoint inhibition monotherapy
  • a retrospective study of patients with diagnosis of metastatic urothelial carcinoma who were treated with PD1/PD-L1 antibody monotherapy analyzed the expression of EphrinB2 and response among these patients. Briefly, tissues specimens were collected and stained for EphrinB2 and consider >1% expression was considered as biomarker positive. The biomarker expression was correlated with the reported outcome of PD1/PD-L1 monotherapy.
  • Patient inclusion required the following: 1 ) at least one pathology specimen obtained prior to PD1/PD-L1 antibody therapy must be available and at least 3 unstained slides are required for tissue analysis; 2) at the beginning of PD1/PD-L1 monotherapy, radiographically measurable disease must be present; 3) treatment outcome must be describable as radiographic progression of disease (PD) which includes death, stable disease, partial response, and complete response; and 4) ECOG status 0, or 1 , or 2 at enrollment if available. It was reasoned that by measuring the expression of EphrinB2 in the tissues from these patients it would be possible to determine if EphrinB2 expression was simply a surrogate for response to checkpoint inhibition.
  • Three of the five responders had no EphrinB2 expression (3/10 30% ORR). Two of these patients had complete remission. Two of the three patients expressed PD-L1 . All three patients had disease localized to the lymph nodes only.
  • EphrinB2 positive have response rate of 11%
  • EphrinB2 negative have a response rate of 30%.
  • EphrinB2 expression is predictive of a lower response to PD-L1 monotherapy.
  • FIGs 1 -3 are pictures of EphrinB2 Immuno-histochemistry (IHC) and EphrinB2 In situ hybridization (ISH/RNAScope) of all 5 responders. Non-responders with high EphrinB2, and low EphrinB2 are also shown. Immunohistochemistry was performed with a recombinant monoclonal antibody generated in rabbit (Abeam 201512). The antibody showed specificity to EphrinB2 analyzed in isogenic CHO cell lines: wild type or ectopically expressing human EphrinB2 full length (CHO-WT, CHO-EphrinB2).
  • EphrinB2 is a membrane protein thus requiring membrane localization in positive IHC staining.
  • the absence of any staining or staining limited to signal in the nucleus or cytoplasm was considered negative (or nonspecific).
  • EphrinB2 IHC positivity is defined by the membrane localization.
  • Membrane localization in the presence of nucleus or cytoplasm staining is considered positive results.
  • the present inventors have also validated the expression with in situ hybridization (RNAScope), technology developed by Advanced Cell Diagnostics (A.C.D). The assay has been confirmed in isogenic cell lines (CHO-WT as negative control, CHO-EphrinB2 as positive control, CHO-EphrinB1 , as negative control demonstrating specificity even within its closely related protein).
  • EphrinB2 positive have response rate of 14%
  • EphrinB2 negative have a response rate of 35%.
  • patients with very high EphrinB2 (7 cases) had no response.
  • This study thus validates the first study and collectively there were at least 12 patients with high EphrinB2 expression that had no response again demonstrating that EphrinB2 expression is predictive of a lower response to PD-L1 monotherapy.
  • nucleic and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases and three letter code for amino acids, as defined in 37 C.F.R. 1 .822.
  • SEQ ID NO: 1 is the amino acid sequence of human ephrin type-B receptor precursor (NP 004435.3). Amino acid residues 1 -15 encode a signal sequence.
  • SEQ ID NO: 2 is the amino acid sequence of human serum albumin preproprotein
  • SEQ ID NO: 3 is the amino acid sequence of human ephrin type-B receptor-human serum albumin protein.
  • SEQ ID NO: 4 is the amino acid sequence of human ephrin type-B receptor-human serum albumin protein. LEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEVCDVQRAPGQAHWLR
  • SEQ ID NO: 5 is the amino acid sequence of human ephrin type-B receptor-human serum albumin protein.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Organic Chemistry (AREA)
  • Analytical Chemistry (AREA)
  • Biochemistry (AREA)
  • Pathology (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Food Science & Technology (AREA)
  • General Physics & Mathematics (AREA)
  • Biophysics (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Oncology (AREA)
  • Hospice & Palliative Care (AREA)
  • General Engineering & Computer Science (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
PCT/US2022/042812 2021-09-07 2022-09-07 Diagnostic methods for cancer using ephrinb2 expression Ceased WO2023039008A1 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
CA3231533A CA3231533A1 (en) 2021-09-07 2022-09-07 Diagnostic methods for cancer using ephrinb2 expression
EP22868022.9A EP4398928A4 (en) 2021-09-07 2022-09-07 CANCER DIAGNOSTIC METHODS USING EPHRINB2 EXPRESSION
US18/689,553 US20250123284A1 (en) 2021-09-07 2022-09-07 Diagnostic methods for cancer using ephrinb2 expression
KR1020247011751A KR20240053651A (ko) 2021-09-07 2022-09-07 에프린b2 발현을 이용한 암의 진단 방법
JP2024514635A JP2024534935A (ja) 2021-09-07 2022-09-07 エフリンb2発現を用いたがんの診断方法
AU2022343102A AU2022343102A1 (en) 2021-09-07 2022-09-07 Diagnostic methods for cancer using ephrinb2 expression
CN202280074020.6A CN118510533A (zh) 2021-09-07 2022-09-07 使用肝配蛋白b2表达的癌症诊断方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163241448P 2021-09-07 2021-09-07
US63/241,448 2021-09-07

Publications (1)

Publication Number Publication Date
WO2023039008A1 true WO2023039008A1 (en) 2023-03-16

Family

ID=85506954

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2022/042812 Ceased WO2023039008A1 (en) 2021-09-07 2022-09-07 Diagnostic methods for cancer using ephrinb2 expression

Country Status (8)

Country Link
US (1) US20250123284A1 (cg-RX-API-DMAC7.html)
EP (1) EP4398928A4 (cg-RX-API-DMAC7.html)
JP (1) JP2024534935A (cg-RX-API-DMAC7.html)
KR (1) KR20240053651A (cg-RX-API-DMAC7.html)
CN (1) CN118510533A (cg-RX-API-DMAC7.html)
AU (1) AU2022343102A1 (cg-RX-API-DMAC7.html)
CA (1) CA3231533A1 (cg-RX-API-DMAC7.html)
WO (1) WO2023039008A1 (cg-RX-API-DMAC7.html)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025205534A1 (ja) * 2024-03-25 2025-10-02 積水メディカル株式会社 免疫測定方法、精度管理方法、標準試料及び免疫測定試薬

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008112290A2 (en) * 2007-03-12 2008-09-18 Vasgene Therapeutics, Inc. Use of ephb4 as a diagnostic marker and a therapeutic target for ovarian cancer
WO2020190977A1 (en) * 2019-03-17 2020-09-24 Vasgene Therapeutics Inc Treatment of cancers using sephb4-hsa fusion proteins

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2008112290A2 (en) * 2007-03-12 2008-09-18 Vasgene Therapeutics, Inc. Use of ephb4 as a diagnostic marker and a therapeutic target for ovarian cancer
WO2020190977A1 (en) * 2019-03-17 2020-09-24 Vasgene Therapeutics Inc Treatment of cancers using sephb4-hsa fusion proteins

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
JACKSON-SPENCE FRANCESCA, TOMS CHARLOTTE, YANG YU-HSUEN, JURASCHECK LEO, CHOY JULIA, FLANDERS LUCY, SZABADOS BERNADETT, POWLES THO: "The role of modern immunotherapy in metastatic urothelial cancer: mini review", JOURNAL OF CANCER METASTASIS AND TREATMENT, vol. 8, 1 January 2022 (2022-01-01), pages 40 - 4722, XP093047685, DOI: 10.20517/2394-4722.2022.50 *
See also references of EP4398928A4 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2025205534A1 (ja) * 2024-03-25 2025-10-02 積水メディカル株式会社 免疫測定方法、精度管理方法、標準試料及び免疫測定試薬

Also Published As

Publication number Publication date
CN118510533A (zh) 2024-08-16
EP4398928A4 (en) 2025-10-15
US20250123284A1 (en) 2025-04-17
KR20240053651A (ko) 2024-04-24
AU2022343102A1 (en) 2024-03-21
CA3231533A1 (en) 2023-03-16
JP2024534935A (ja) 2024-09-26
EP4398928A1 (en) 2024-07-17

Similar Documents

Publication Publication Date Title
US20240009271A1 (en) Methods of treating metastatic cancers using axl decoy receptors
JP7809324B2 (ja) sEphB4-HSA融合タンパク質を用いたがんの治療
KR20210041571A (ko) 역형성 림프종 키나아제 억제제와 조합하여 egf/egfr 경로를 억제하기 위한 방법 및 조성물
US20250123284A1 (en) Diagnostic methods for cancer using ephrinb2 expression
US20230277631A1 (en) Diagnostic methods for cancer using axl decoy receptors
US20240156908A1 (en) USE OF sEphB4-HSA FUSION PROTEIN AS A FIRST-LINE THERAPY IN CANCER TREATMENT
RU2785866C2 (ru) Способы лечения метастатических видов рака с использованием рецепторов-ловушек axl
EP4583888A1 (en) Modified t-cells for use in the treatment of bladder cancer
EP4583887A1 (en) Modified t-cells for use in the treatment of gastroesophageal cancer
HK40030449A (en) Methods of treating metastatic cancers using axl decoy receptors
HK40009233B (en) Predicting response to pd-1 axis inhibitors

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22868022

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 3231533

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 18689553

Country of ref document: US

Ref document number: 2024514635

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 2022343102

Country of ref document: AU

Ref document number: AU2022343102

Country of ref document: AU

ENP Entry into the national phase

Ref document number: 2022343102

Country of ref document: AU

Date of ref document: 20220907

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20247011751

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2022868022

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022868022

Country of ref document: EP

Effective date: 20240408

WWE Wipo information: entry into national phase

Ref document number: 202280074020.6

Country of ref document: CN

WWP Wipo information: published in national office

Ref document number: 18689553

Country of ref document: US