WO2023034564A2 - Anti-cd33 antibodies and uses thereof - Google Patents
Anti-cd33 antibodies and uses thereof Download PDFInfo
- Publication number
- WO2023034564A2 WO2023034564A2 PCT/US2022/042448 US2022042448W WO2023034564A2 WO 2023034564 A2 WO2023034564 A2 WO 2023034564A2 US 2022042448 W US2022042448 W US 2022042448W WO 2023034564 A2 WO2023034564 A2 WO 2023034564A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- acid sequence
- set forth
- sequence set
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/58—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6854—Immunoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70596—Molecules with a "CD"-designation not provided for elsewhere in G01N2333/705
Definitions
- the presently disclosed subject matter relates to antibodies that bind to CD33, and methods of using such antibodies.
- AML Acute myeloid leukemia
- ADC CD33 antibody-drug conjugate
- CD33 Given the significant role for CD33 in diseases (e.g., AML), antibodies that bind to CD33 and methods of using such agents, are desired.
- the presently disclosed subject matter provides antibodies or antigen-binding fragments thereof that specifically bind to CD33, and methods of using the antibodies or antigen-binding fragments thereof.
- the CD33 antibody or an antigen-binding fragment thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 28, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 52, SEQ ID NO: 62, SEQ ID NO: 72, SEQ ID NO: 81, or SEQ ID NO: 88.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 63, SEQ ID NO: 73, SEQ ID NO: 82, SEQ ID NO: 89, or SEQ ID NO: 92.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises (a) a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 28, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 52, SEQ ID NO: 62, SEQ ID NO: 72, SEQ ID NO: 81, or SEQ ID NO: 88; and (b) a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO:
- the heavy chain variable region and the light chain variable region of the anti-CD33 antibody or antigen-binding fragment thereof are selected from the group consisting of:
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 9;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 18, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 19; (c) a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 35, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 29;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 43, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 44;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 52, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 53;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 62, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 63; (h) a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 81, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 81;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 88, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 89; and
- the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 28, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 52, SEQ ID NO: 62, SEQ ID NO: 72, SEQ ID NO: 81, or SEQ ID NO: 88.
- the anti-CD33 antibody or antigen-binding fragment thereof comprises a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 63, SEQ ID NO: 73, SEQ ID NO: 82, SEQ ID NO: 89, or SEQ ID NO: 92.
- the CD33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 28, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 52, SEQ ID NO: 62, SEQ ID NO: 72, SEQ ID NO: 81, and SEQ ID NO: 88; and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 63, SEQ ID NO: 73, SEQ ID NO: 82, SEQ ID NO: 89, or SEQ ID NO: 92.
- the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region and the light chain variable region are selected from the group consisting of:
- the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain constant region and/or a light chain constant region.
- the heavy chain constant region comprises an amino acid sequence that is about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 95.
- the heavy chain constant region comprises the amino acid sequence set forth in SEQ ID NO: 95.
- the light chain constant region comprises an amino acid sequence that is about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 96 or SEQ ID NO: 99.
- the light chain constant region comprises the amino acid sequence set forth in SEQ ID NO: 96 or SEQ ID NO: 99.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises (a) a heavy chain constant region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 95; and (b) a light chain constant region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 96 or SEQ ID NO: 99.
- the anti-CD33 antibody or antigen-binding fragment thereof comprsies:
- a heavy chain constant region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 95, and a light chain constant region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 96; or
- a heavy chain constant region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 95, and a light chain constant region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 99.
- the antibody or antigen-binding fragment thereof comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 95.
- the antibody or antigen-binding fragment thereof comprises a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 96 or SEQ ID NO: 99.
- the antibody or antigen-binding fragment thereof comprises a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 95; and a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 96 or SEQ ID NO: 99.
- the antibody or antigen-binding fragment thereof comprises:
- the antibody or antigen-binding fragment thereof comprises a heavy chain variable region that comprises CDR1, CDR2, and CDR3 domains; and a light chain variable region that comprises CDR1, CDR2, and CDR3 domains, wherein the heavy chain variable region and light chain variable region CDR3 domains are selected from the group consisting of:
- the heavy chain variable region and light chain variable region CDR2 domains of the antibody or antigen-binding fragment thereof are selected from the group consisting of:
- the heavy chain variable region and light chain variable region CDR1 domains of the antibody or antigen-binding fragment thereof are selected from the group consisting of:
- one or more of the CDR sequences have up to about 5 amino acid substitutions. In certain embodiments, one or more of the CDR sequences have up to about 3 amino acid substitutions.
- the anti-CD33 antibody or antigen-binding fragment thereof comprises:
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 12, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 13, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 14;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 22, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 23, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 24;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 32, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 33, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 34;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 37, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 47, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 56, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO:57, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 58;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 66, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 67, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 68;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 76, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 77; or
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 85, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 86, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 87.
- the anti-CD33 antibody or antigen-binding fragment thereof comprises:
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 15, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 16, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 17;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 59, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 60, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 61;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 69, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 70, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 71;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 78, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 79, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 80; or
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42.
- the anti-CD33 antibody or antigen-binding fragment thereof comprises:
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 6, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 7;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 32, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 33, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 34; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 37, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 47 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 56 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 58; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 59 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 60, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 61;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 66 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 67, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 684; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 69 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 70, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 71;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 76 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 77; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 78 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 79, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 80; or
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 85 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 86, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 87; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5 , a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42.
- the sequence of the antibody is in a heavy-light variable chain orientation (VH-VL).
- the antibody or antigen-binding fragment thereof comprises a human variable region framework region.
- the antibody or antigen-binding fragment thereof is a fully human or an antigen-binding fragment thereof. In certain embodiments, the antibody or antigen-binding fragment thereof is a chimeric antibody or an antigen-binding fragment thereof. In certain embodiments, the antibody or antigen-binding fragment thereof is a humanized antibody or an antigen-binding fragment thereof. In certain embodiments, the antigen-binding fragment of the antibody is a Fab, Fab', F(ab')2, variable fragment (Fv) or a single chain variable fragment (scFv).
- the antigen-binding fragment of the antibody or antigen-binding fragment thereof is an scFv.
- the presently disclosed subject matter provides antibodies or antigen-binding fragments thereof, which cross-compete for binding to CD33 with any of the above-described antibody or antigen-binding fragment thereof.
- the presently disclosed subject matter further provides antibodies or antigen-binding fragments thereof, which binds to the same epitope region on CD33 with any of the abovedescribed antibody or antigen-binding fragment thereof.
- the presently disclosed subject matter also provides immunoconjugates comprising the antibody or antigen-binding fragment thereof disclosed herein, linked to a therapeutic agent.
- the therapeutic agent is a drug, a cytotoxin, or a radioactive isotope.
- the presently disclosed subject matter provides multi-specific molecules comprising the antibody or antigen-binding fragment thereof disclosed herein, linked to one or more functional moieties.
- the one or more functional moieties have a different binding specificity than the antibody or antigen binding fragment thereof.
- compositions comprising the antibody or antigen-binding fragment thereof disclosed herein, the immunoconjugate disclosed herein, or the multi-specific molecule disclosed herein.
- the composition is a pharmaceutical composition that further comprises a pharmaceutically acceptable carrier.
- the presently disclosed subject matter provides nucleic acids encoding the antibody or antigen-binding fragment thereof disclosed herein.
- the presently disclosed subject matter provides nucleic acids that encodes the heavy chain variable regions of the antibody or antigen-binding fragment thereof disclosed herein.
- the nucleic acid comprises a nucleotide sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the nucleotide sequence set forth in SEQ ID NO: 10, SEQ ID NO: 20, SEQ ID NO: 30, SEQ ID NO: 36, SEQ ID NO: 45, SEQ ID NO: 54, SEQ ID NO: 64, SEQ ID NO: 74, SEQ ID NO: 83, SEQ ID NO: 90, or SEQ ID NO: 93.
- the nucleic acid comprises the nucleotide sequence set forth in SEQ ID NO: 10, SEQ ID NO: 20, SEQ ID NO: 30, SEQ ID NO: 36, SEQ ID NO: 45, SEQ ID NO: 54, SEQ ID NO: 64, SEQ ID NO: 74, SEQ ID NO: 83, SEQ ID NO: 90, or SEQ ID NO: 93.
- the presently disclosed subject matter provides nucleic acids that encodes the light chain variable regions of the antibody or antigen-binding fragment thereof disclosed herein.
- the nucleic acid comprises a nucleotide sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the nucleotide sequence set forth in SEQ ID NO: 11, SEQ ID NO: 21, SEQ ID NO: 31, SEQ ID NO: 46, SEQ ID NO: 55, SEQ ID NO: 65, SEQ ID NO: 75, SEQ ID NO: 84, SEQ ID NO: 91, or SEQ ID NO: 94.
- the nucleic acid comprises the nucleotide sequence set forth in SEQ ID NO: 11, SEQ ID NO: 21, SEQ ID NO: 31, SEQ ID NO: 46, SEQ ID NO: 55, SEQ ID NO: 65, SEQ ID NO: 75, SEQ ID NO: 84, SEQ ID NO: 91, or SEQ ID NO: 94.
- the presently disclosed subject matter provides vectors comprising such nucleic acid molecules, and host cells comprising such vectors.
- the presently disclosed subject matter provides methods for detecting CD33 in a cell, a tissue, or a blood sample.
- the method comprises: contacting a cell, a tissue, or a blood sample with the antibody or antigen-binding fragment thereof disclosed herein, wherein the antibody or antigen-binding fragment thereof comprises a detectable label; and determining the amount of the labeled antibody or antigen-binding fragment thereof bound to the cell, tissue, blood sample by measuring the amount of detectable label associated with the cell, tissue, or blood sample, wherein the amount of bound antibody or antigen-binding fragment thereof indicates the amount of CD33 in the cell, tissue, or blood sample.
- the presently disclosed subject matter provides various methods of using the antibodies and antigen-binding fragments thereof, immunoconjugates, multi-specific molecules, or compositions disclosed herein.
- the presently disclosed subject matter provides methods of treating or ameliorating a disease or disorder associated with CD33 in a subject.
- the method comprises administering to the subject the antibody or antigen-binding fragment thereof, the immunoconjugate, multi-specific molecule, or composition disclosed herein.
- the disease or disorder expresses CD33.
- the disease or disorder is associated with overexpression of CD33.
- the disease or disorder is tumor.
- the presently disclosed subject matter also provides methods of reducing tumor burden in a subject.
- the method comprises administering to the subject the antibody or antigen-binding fragment thereof, the immunoconjugate, multi-specific molecule, or composition disclosed herein.
- the method reduces the number of the tumor cells, reduces the tumor size, and/or eradicates the tumor in the subject.
- the presently disclosed subject matter also provides methods of treating and/or preventing a tumor in a subject.
- the method comprises administering to the subj ect the antibody or antigen-binding fragment thereof, the immunoconjugate, multi-specific molecule, or composition disclosed herein.
- the presently disclosed subject matter also provides methods of increasing or lengthening survival of a subject having a tumor.
- the method comprises administering to the subject the antibody or antigen-binding fragment thereof, the immunoconjugate, multi-specific molecule, or composition disclosed herein.
- the method reduces or eradicates tumor burden in the subject.
- the tumor is cancer.
- the tumor is hematological cancer, or solid tissue cancer.
- the hematological cancer is selected from the group consisting of acute myeloid leukemia (AML), myelodysplastic syndromes (MDS), acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), myeloproliferative neoplasms (MPNs), and chronic myeloid neoplasms.
- AML acute myeloid leukemia
- MDS myelodysplastic syndromes
- ALL acute lymphoblastic leukemia
- CLL chronic lymphocytic leukemia
- MPNs myeloproliferative neoplasms
- chronic myeloid neoplasms chronic myeloid neoplasms.
- the hematological cancer is acute myeloid leukemia (AML).
- the subject is a human.
- kits for treating or ameliorating a disease or disorder in a subject comprising the antibody or antigenbinding fragment thereof, the immunoconjugate thereof, the multi -specific molecule thereof, or the composition disclosed herein.
- the kit further comprises written instructions for using the antibody or antigen-binding fragment thereof, the immunoconjugate thereof, the multi-specific molecule thereof, or the composition thereof disclosed herein for treating or ameliorating a disease or disorder in a subject, treating or ameliorating a disease or disorder in a subject, reducing tumor burden in a subject, treating and/or preventing a tumor in a subject, and/or increasing or lengthening survival of a subject having a tumor.
- Figures 1A and IB depict CD33 domain architecture.
- Figure 1A depicts a schematic of full-length CD33 (CD33M) consisting of two Ig-like domains (IgV and IgC2) in the extracellular region, a single transmembrane segment, an immunoreceptor tyrosine-based inhibitory motif (ITIM) and an ITIM-like motif in the cytosolic region.
- CD33M full-length CD33
- ITIM immunoreceptor tyrosine-based inhibitory motif
- Figure IB depicts the CD33 gene structure with and without alternate splicing. Removal of exon 2 results in the loss of the IgV domain.
- Several antibodies that have been advanced to the clinic with various formats CAR, BiTE, radiotherapy target the IgV domain. GO, gemtuzumab ozogamicin.
- Figure 2 depicts candidate antibodies binding to CD33 protein. Binding of 10 selected clones tested by ELISA on mouse (moCD33) and human (huCD33) proteins. All 10 clonal mAbs showed binding to human CD33 but not mouse CD33. Anti-His, anti-CD33 and irrelevant protein with His were used as controls.
- Figure 3 depicts the binding of candidate antibodies to recombinant CD33 protein.
- Recombinant human, cynomolgus and mouse CD33-ECD-His were captured by Ni-plates and antibodies added at lOpg/mL concentration in triplicates. HRP conjugated anti-human Fc secondary antibody was used for detection.
- Figures 4 A and 4B depict the binding of exemplified monoclonal anti-CD33 antibodies disclosed herein to CD33 expressed on cell surface.
- Figures 4A depicts the binding of monoclonal antibodies TDI-Y-006, TDI-Y-007 and 1J19 on CD33-overexpressing 3T3 cells.
- Figure 4B depicts the binding of monoclonal antibodies TDI-Y-006, TDI-Y-007 and 1 J19 toU937, an AML line with endogenous CD33 expression. Binding was tested at increasing concentration by flow cytometry. Human IgGl (HuIgGl) isotype was included as a control.
- anti-CD33 antibodies The presently disclosed subject matter provides anti-CD33 antibodies.
- Non-limiting embodiments of the present disclosure are described by the present specification and Examples.
- Antibody and “antibodies” as those terms are known in the art refer to antigen binding proteins of the immune system.
- the term “antibody” as referred to herein includes whole, full length antibodies having an antigen-binding region, and any fragment thereof in which the "antigen-binding fragment” or “antigen-binding region” is retained, or single chains, for example, single chain variable fragment (scFv), thereof.
- a naturally occurring "antibody” is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds. Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant (CH) region.
- VH heavy chain variable region
- CH heavy chain constant
- the heavy chain constant region is comprised of three domains, CHI, CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant CL region.
- the light chain constant region is comprised of one domain, CL.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs arranged from amino-terminus to carboxy -terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Cl q) of the classical complement system.
- human antibody is intended to include antibodies having variable regions in which both the framework and CDR regions are derived from human germline immunoglobulin sequences. Furthermore, if the antibody contains a constant region, the constant region also is derived from human germline immunoglobulin sequences.
- the human antibodies of the presently disclosed subject matter may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- the term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the presently disclosed subject matter may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
- recombinant human antibody includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom (described further below), (b) antibodies isolated from a host cell transformed to express the human antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- Such recombinant human antibodies have variable regions in which the framework and CDR regions are derived from human germline immunoglobulin sequences.
- such recombinant human antibodies can be subjected to in vitro mutagenesis (or, when an animal transgenic for human Ig sequences is used, in vivo somatic mutagenesis) and thus the amino acid sequences of the VH and VL regions of the recombinant antibodies are sequences that, while derived from and related to human germline VH and VL sequences, may not naturally exist within the human antibody germline repertoire in vivo.
- humanized antibody is intended to refer to antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences. Additional framework region modifications may be made within the human framework sequences.
- chimeric antibody is intended to refer to antibodies in which the variable region sequences are derived from one species and the constant region sequences are derived from another species, such as an antibody in which the variable region sequences are derived from a mouse antibody and the constant region sequences are derived from a human antibody.
- an antibody that “specifically binds to CD33” is intended to refer to an antibody that binds to CD33 (e.g., human CD33, e.g., soluble human CD33) with a dissociation constant (KD) of about 1 x 10' 8 M or less, about 5 x 10' 9 M or less, about 1 x 10' 9 M or less, about 5 x IO' 10 M or less, about 1 x IO' 10 M or less, about 5 x 10' 11 M or less, or about 1 x 10' 11 M or less.
- KD dissociation constant
- an “antibody that competes for binding” or “antibody that cross-competes for binding” with a reference antibody for binding to an antigen, e.g., CD33 refers to an antibody that blocks binding of the reference antibody to the antigen (e.g., CD33) in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to the antigen (e.g., CD33) in a competition assay by 50% or more.
- An exemplary competition assay is described in “Antibodies”, Harlow and Lane (Cold Spring Harbor Press, Cold Spring Harbor, NY).
- isotype refers to the antibody class (e.g., IgM or IgGl) that is encoded by the heavy chain constant region genes.
- an antibody recognizing an antigen and “an antibody specific for an antigen” are used interchangeably herein with the term” an antibody which binds specifically to an antigen (e.g., a CD33 polypeptide).”
- antigen-binding fragment or “antigen-binding region” of an antibody, as used herein, refers to that region or fragment of the antibody that binds to the antigen and which confers antigen specificity to the antibody; fragments of antigen-binding proteins, for example, antibodies includes one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., a CD33 polypeptide). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- antigen-binding fragments encompassed within the term "antibody fragments" of an antibody include a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CHI domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al., Nature 1989;341 : 544-546), which consists of a VH domain; and an isolated complementarity determining region (CDR).
- Fab fragment a monovalent fragment consisting of the VL, VH, CL and CHI domains
- F(ab)2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
- a Fd fragment consisting of the VH and CHI
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules.
- scFv single chain Fv
- scFv single chain Fv
- These antibody fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
- an “antibody” or “antigen-binding protein” is one which has been identified and separated and/or recovered from a component of its natural environment.
- synthetic antibodies or “recombinant antibodies” are generally generated using recombinant technology or using peptide synthetic techniques known to those of skill in the art.
- single-chain variable fragment is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of an immunoglobulin (e.g., mouse or human) covalently linked to form a VH::VL heterodimer.
- the heavy (VH) and light chains (VL) are either joined directly or joined by a peptide-encoding linker (e.g., 10, 15, 20, 25 amino acids), which connects the N-terminus of the VH with the C-terminus of the VL, or the C-terminus of the VH with the N-terminus of the VL.
- the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility.
- the linker can link the heavy chain variable region and the light chain variable region of the extracellular antigen-binding domain.
- linkers are disclosed in Shen et al., Anal Chem (2008);80(6): 1910-1917 and WO 2014/087010, the contents of which are hereby incorporated by reference in their entireties.
- the linker is a G4S linker.
- the linker comprises or consists of the amino acid sequence set forth in SEQ ID NO: 104, which is provided below: GGGGSGGGGSGGGSGGGGS [ SEQ I D NO : 104 ]
- the linker comprises or consists of the amino acid sequence set forth in SEQ ID NO: 105, which is provided below:
- the linker comprises or consists of the amino acid sequence set forth in SEQ ID NO: 106, which is provided below:
- the linker comprises or consists of the amino acid sequence set forth in SEQ ID NO: 107, which is provided below:
- the linker comprises or consists of the amino acid sequence set forth in SEQ ID NO: 108, which is provided below:
- the linker comprises or consists of the amino acid sequence set forth in SEQ ID NO: 109, which is provided below:
- Single chain Fv polypeptide antibodies can be expressed from a nucleic acid comprising VH - and VL -encoding sequences as described by Huston, et al. (Proc. Nat. Acad. Set. USA, 1988;85:5879-5883). See, also, U.S. Patent Nos. 5,091,513, 5,132,405 and 4,956,778; and U.S. Patent Publication Nos. 20050196754 and 20050196754.
- Antagonistic scFvs having inhibitory activity have been described (see, e.g., Zhao et al., Hyrbidoma (Larchmt) 2008;27(6):455-51; Peter et al., J Cachexia Sarcopenia Muscle 2012 August 12; Shieh et al., J Imunol 2009; 183(4):2277-85; Giomarelli et al., Thromb Haemost 2007;97(6):955-63; Fife eta., J Clin Invst 2QQ A 16(8):2252-61; Brocks et al., Immunotechnology 1997;3(3): 173-84; Moosmayer et al., Ther Immunol 1995; 2(10:31-40).
- F(ab) refers to a fragment of an antibody structure that binds to an antigen but is monovalent and does not have a Fc portion, for example, an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g., a heavy (H) chain constant region; Fc region that does not bind to an antigen).
- an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g., a heavy (H) chain constant region; Fc region that does not bind to an antigen).
- F(ab')2 refers to an antibody fragment generated by pepsin digestion of whole IgG antibodies, wherein this fragment has two antigen binding (ab 1 ) (bivalent) regions, wherein each (ab 1 ) region comprises two separate amino acid chains, a part of a H chain and a light (L) chain linked by an S-S bond for binding an antigen and where the remaining H chain portions are linked together.
- a “F(ab')2” fragment can be split into two individual Fab' fragments.
- vector refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences into cells.
- vector includes cloning and expression vehicles, as well as viral vectors and plasmid vectors.
- CDRs are defined as the complementarity determining region amino acid sequences of an antibody which are the hypervariable regions of immunoglobulin heavy and light chains. See, e. g., Kabat et al., Sequences of Proteins of Immunological Interest, 4th U. S. Department of Health and Human Services, National Institutes of Health (1987), or IMGT numbering system (Lefranc, The Immunologist (1999);7: 132-136; Lefranc et al., Dev. Comp. Immunol. (2003); 27:55-77).
- hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence (“complementarity determining regions” or “CDRs”) and/or form structurally defined loops (“hypervariable loops”) and/or contain the antigen-contacting residues (“antigen contacts”).
- CDRs complementarity determining regions
- hypervariable loops form structurally defined loops
- antigen contacts antigen contacts
- antibodies comprise three heavy chain and three light chain CDRs or CDR regions in the variable region.
- CDRs provide the majority of contact residues for the binding of the antibody to the antigen or epitope region.
- the CDRs are identified according to the IMGT system.
- the CDRs are identified using the IMGT numbering system accessible at
- isolated denotes a degree of separation from original source or surroundings.
- An “isolated antibody” is one which has been separated from a component of its natural environment.
- an antibody is purified to greater than 95% or 99% purity as determined by, for example, electrophoretic (e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis) or chromatographic (e.g., ion exchange or reverse phase HPLC).
- electrophoretic e.g., SDS-PAGE, isoelectric focusing (IEF), capillary electrophoresis
- chromatographic e.g., ion exchange or reverse phase HPLC
- isolated nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment.
- An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
- isolated nucleic acid encoding an antibody refers to one or more nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
- vector refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked.
- the term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced.
- Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as "expression vectors.”
- an “immunoconjugate” is an antibody conjugated to one or more heterologous molecule(s), including, but not limited to, a cytotoxic agent.
- derivative refers to a compound that is derived from some other compound and maintains its general structure.
- trichloromethane chloroform
- methane is a derivative of methane.
- an “effective amount” is an amount sufficient to effect a beneficial or desired clinical result upon treatment.
- An effective amount can be administered to a subject in one or more doses.
- an effective amount is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease, or otherwise reduce the pathological consequences of the disease.
- the effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art. Several factors are typically taken into account when determining an appropriate dosage to achieve an effective amount. These factors include age, sex and weight of the subject, the condition being treated, the severity of the condition, and the form and effective concentration of the cells administered.
- mammals include, but are not limited to, humans, primates, farm animals, sport animals, rodents and pets.
- Non-limiting examples of non-human animal subjects include rodents such as mice, rats, hamsters; guinea pigs; rabbits; dogs; cats; sheep; pigs; goats; cattle; horses; and non-human primates such as apes and monkeys.
- treatment refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- antibodies of the presently disclosed subject matter are used to delay development of a disease or to slow the progression of a disease, e.g., a tumor, e.g., a tumor associated with CD33.
- the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, /. ⁇ ., the limitations of the measurement system.
- “about” can mean within 3 or more than 3 standard deviations, per the practice in the art.
- “about” can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value.
- the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.
- any concentration range, percentage range, ratio range or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated.
- CD33 is a single pass transmembrane molecule and a member of the sialic acid-binding immunoglobulin (Ig)-like lectin (Siglec) family. CD33 consists of two extracellular domains with immunoglobulin-like folds, IgV and IgC2 (see Figure 1A).
- CD33 has 3 isoforms produced via alternate splicing, with isoform 3 missing the IgV domain (Ehninger et al., Blood Cancer J 4, e218 (2014); Sanford et al., Leuk Lymphoma 57, I 965U 968 (2016); and Haubner et al., Leukemia 33, 64-74 (2019))
- SNP singlenucleotide polymorphism
- rsl2459419 OT CD33 singlenucleotide polymorphism
- gemtuzumab ozogamicin (GO), an antibody-drug conjugate (ADC) targeting CD33, had no impact and increased relapse risk likely due to the inability of this ADC to kill AML cells expressing this IgV-lacking CD33 isoform.
- This issue is bound to be encountered by all the currently clinically available CD33 -targeting products given their epitopes in the IgV domain (see Figure IB) (Perna et al., Cancer Cell 32, 506-519 e505 (2017)).
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof bind to human CD33.
- the human CD33 comprises or consists of the amino acid sequence with a UniProt Reference No: P20138-1 (SEQ ID NO: 1) or a fragment thereof. SEQ ID NO: 1 is provided below.
- the human CD33 comprises an extracellular domain, a transmembrane domain, and a cytoplasmic domain.
- the extracellular domain comprises or consists of amino acids 18 to 259 of SEQ ID NO: 1.
- the transmembrane domain comprises or consists of amino acids 260 to 282 of SEQ ID NO: 1.
- the cytoplasmic domain comprises or consists of amino acids 283 to 364 of SEQ ID NO: 1.
- the CD33 comprises or consists of an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, at least about 100% identical to the amino acid sequence set forth in SEQ ID NO: 1 or a fragment thereof.
- the anti-CD33 antibodies or antigen-binding fragments thereof bind to a portion of human CD33. In certain embodiments, the anti-CD33 antibodies or antigenbinding fragments thereof bind to the extracellular domain of CD33. In certain embodiments, the anti-CD33 antibodies or antigen-binding fragments thereof bind to amino acids 18 to 259 of SEQ ID NO: 1.
- the antibodies of the presently disclosed subject matter are characterized by particular functional features or properties of the antibodies.
- the antibodies bind specifically to CD33 (e.g., bind to human CD33).
- a presently disclosed antibody or antigen-binding fragment binds to CD33 (e.g., human CD33) with a binding affinity, for example with a dissociation constant (KD) of 1 x 10' 8 M or less, e.g., about 1 x 10' 8 M or less, about 5 x 10' 9 M or less, about 1 x 10' 9 M or less, about 5 x 10' 10 M or less, about 1 x 10' 10 M or less, or about 1 x 10' 11 M or less.
- KD dissociation constant
- the presently disclosed anti-CD33 antibody or antigen-binding fragment thereof binds to CD33 (e.g., human CD33, e.g.
- the presently disclosed anti-CD33 antibody or antigen-binding fragment thereof binds to CD33 (e.g., human CD33, e.g. soluble human CD33) with a dissociation constant (KD) of about 5 x 10' 9 M.
- the presently disclosed anti-CD33 antibody or antigen-binding fragment thereof binds to CD33 (e.g., human CD33, e.g. soluble human CD33) with a dissociation constant (KD) of about 1 x 10' 9 M.
- the presently disclosed anti-CD33 antibody or antigen-binding fragment thereof binds to CD33 (e.g., human CD33, e.g. soluble human CD33) with a dissociation constant (KD) of between about 1 x 10' 9 M and about 5 x 10' 9 M. In certain embodiments, the presently disclosed anti-CD33 antibody or antigen-binding fragment thereof binds to CD33 (e.g., human CD33, e.g. soluble human CD33) with a dissociation constant (KD) of between about 1 x 10' 9 M and about 2 x 10' 9 M.
- CD33 e.g., human CD33, e.g. soluble human CD33
- KD dissociation constant
- the presently disclosed anti-CD33 antibody or antigen-binding fragment thereof binds to CD33 (e.g., human CD33, e.g. soluble human CD33) with a dissociation constant (KD) of about 5 x 10' 9 M. In certain embodiments, the presently disclosed anti-CD33 antibody or antigen-binding fragment thereof binds to CD33 (e.g., human CD33, e.g. soluble human CD33) with a dissociation constant (KD) of about 1 x 10' 9 M.
- CD33 e.g., human CD33, e.g. soluble human CD33
- KD dissociation constant
- a presently disclosed antibody or antigen-binding fragment binds to a cell expressing CD33 (e.g., an AML cell expressing CD33) with a Half maximal Effective Concentration (ECso) value of from about 1 nM to about 50 nM, from about 5 nM to about 50 nM, from about 10 nM to about 50 nM, from about 20 nM to about 50 nM, from about 30 nM to about 50 nM, from about 40 nM to about 50 nM, or greater than about 50 nM.
- ECso Half maximal Effective Concentration
- a presently disclosed antibody or antigen-binding fragment binds to a cell expressing CD33 (e.g., an AML cell expressing CD33) with an ECso value from about 1 nM to about 5 nM. In certain embodiments, a presently disclosed antibody or antigen-binding fragment binds to a cell expressing CD33 (e.g., an AML cell expressing CD33) with an ECso value of about 2 nM. In certain embodiments, a presently disclosed antibody or antigen-binding fragment binds to a cell expressing CD33 (e.g., an AML cell expressing CD33) with an ECso value of about 2.16 nM.
- a presently disclosed antibody or antigen-binding fragment binds to a cell expressing CD33 (e.g., an AML cell expressing CD33) with an ECso value from about 5 nM to about 10 nM. In certain embodiments, a presently disclosed antibody or antigen-binding fragment binds to a cell expressing CD33 (e.g., an AML cell expressing CD33) with an ECso value of about 10 nM. In certain embodiments, a presently disclosed antibody or antigen-binding fragment binds to a cell expressing CD33 (e.g., an AML cell expressing CD33) with an ECso value of about 8.5 nM.
- a presently disclosed antibody or antigen-binding fragment binds to a cell expressing CD33 (e.g., an AML cell expressing CD33) with an ECso value from about 40 nM to about 50 nM. In certain embodiments, a presently disclosed antibody or antigen-binding fragment binds to a cell expressing CD33 (e.g., an AML cell expressing CD33) with an ECso value of about 45 nM. In certain embodiments, a presently disclosed antibody or antigen-binding fragment binds to a cell expressing CD33 (e.g., an AML cell expressing CD33) with an ECso value of about 45 nM.
- the heavy and light chains of a presently disclosed antibody or antigen-binding fragment can be full-length (e.g., an antibody can include at least one (e.g., one or two) complete heavy chains, and at least one (e.g., one or two) complete light chains) or can include an antigen-binding fragment (a Fab, F(ab')2, Fv or a single chain Fv fragment (“scFv”)).
- an antibody can include at least one (e.g., one or two) complete heavy chains, and at least one (e.g., one or two) complete light chains) or can include an antigen-binding fragment (a Fab, F(ab')2, Fv or a single chain Fv fragment (“scFv”)).
- the antibody heavy chain constant region is chosen from, e.g., IgGl, IgG2, IgG3, IgG4, IgM, IgAl, IgA2, IgD, and IgE, particularly chosen from, e.g., IgGl, IgG2, IgG3, and IgG4.
- the immunoglobulin isotype is IgGl (e.g., human IgGl). The choice of antibody isotype can depend on the immune effector function that the antibody is designed to elicit.
- the antibody light chain constant region is chosen from, e.g., kappa or lambda, particularly kappa.
- the presently disclosed subject matter includes antibodies or antigen-binding fragments thereof that have the scFv sequence fused to one or more constant domains to form an antibody with an Fc region of a human immunoglobulin to yield a bivalent protein, increasing the overall avidity and stability of the antibody.
- the Fc portion allows the direct conjugation of other molecules, including but not limited to fluorescent dyes, cytotoxins, radioisotopes etc. to the antibody for example, for use in antigen quantitation studies, to immobilize the antibody for affinity measurements, for targeted delivery of a therapeutic agent, to test for Fc-mediated cytotoxicity using immune effector cells and many other applications.
- results presented here highlight the specificity, sensitivity and utility of the presently disclosed antibodies or antigen-binding fragments in targeting a CD33 polypeptide (e.g., a human CD33 polypeptide).
- a CD33 polypeptide e.g., a human CD33 polypeptide
- the anti-CD33 scFv is an scFv-Fc fusion protein or a full-length human IgG with VH and VL regions or CDRs selected from Table 1.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 8.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 8 is set forth in SEQ ID NO: 10.
- the anti-CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 9.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 9 is set forth in SEQ ID NO: 11.
- SEQ ID NO: 8-11 are provided in Table 1.
- the scFv is designated as “3-P14”.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 8 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 9.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof.
- SEQ ID NOs: 2-4 are provided in Table 1.
- the anti-CD33 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 6 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 7 or a conservative modification thereof.
- SEQ ID NOs: 4-6 are provided in Table 1.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 6 or a conservative modification, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 7 or a conservative modification thereof.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 6, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 7.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 8, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 9.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- variable regions are linked one after another such that a heavy chain variable region (VH) is position at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C-terminus: VH-VL. In certain embodiments, a light chain variable region (VL) is positioned at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C-terminus: VL-VH.
- VH heavy chain variable region
- VL light chain variable region
- the anti-CD33 scFv is an scFv-Fc fusion protein or a full-length human IgG with VH and VL regions or CDRs selected from Table 2.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 18, as shown in Table 2.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 18 is set forth in SEQ ID NO: 20.
- the anti-CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 19.
- an exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 19 is set forth in SEQ ID NO: 21.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 18 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 19.
- SEQ ID NO: 18-21 are provided in Table 2.
- the scFv is designated as “4-B2”.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 12 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 13 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 14 or a conservative modification thereof.
- SEQ ID NOs: 12-14 are provided in Table 2.
- the anti-CD33 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 15 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 16 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 17 or a conservative modification thereof.
- SEQ ID NOs: 15-17 are provided in Table 2.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 12 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 13 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 14 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 15 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 16 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 17 or a conservative modification.
- the anti-CD33 scFv comprises a VH C comprising a DR1 comprising the amino acid sequence set forth in SEQ ID NO: 12, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 13, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 14; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 15, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 16, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 17.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 18, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 19.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- a heavy chain variable region is positioned at the N- terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VH-VL. In certain embodiments, a light chain variable region (VL) is positioned at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VL-VH.
- the anti-CD33 scFv is an scFv-Fc fusion protein or full-length human IgG with VH and VL regions or CDRs selected from Table 3.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 28, as shown in Table 3.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 28 is set forth in SEQ ID NO: 30.
- the anti-CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 29.
- SEQ ID NO: 31 An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 29 is set forth in SEQ ID NO: 31.
- SEQ ID NO: 28-31 are provided in Table 3.
- the scFv is designated as “ 1 -J 19”.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 28 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 29.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 22 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 23 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 24 or a conservative modification thereof.
- SEQ ID NOs: 22-24 are provided in Table 3.
- the anti-CD33 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27 or a conservative modification thereof.
- SEQ ID NOs: 25-27 are provided in Table 3.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 22 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 23 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 24 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27 or a conservative modification thereof.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 22, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 23, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 24; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 28, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 29.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- a heavy chain variable region is positioned at the N- terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VH-VL. In certain embodiments, a light chain variable region (VL) is positioned at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VL-VH
- the anti-CD33 scFv is an scFv-Fc fusion protein or full length human IgG with VH and VL regions or CDRs selected from Table 4.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 35, as shown in Table 4.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 35 is set forth in SEQ ID NO: 36.
- the anti-CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 29.
- SEQ ID NO: 31 An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 29 is set forth in SEQ ID NO: 31.
- SEQ ID NO: 29, 31, 35, and 36 are provided in Table 4.
- the scFv is designated as “1 -JI 9-2”
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 35 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 29.
- SEQ ID NOs: 35 and 29 are provided in Table 4.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 32 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 33 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 34 or a conservative modification thereof.
- SEQ ID NOs: 32-34 are provided in Table 4.
- the anti-CD33 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27 or a conservative modification thereof.
- SEQ ID NOs: 25-27 are provided in Table 4.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 32 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 33 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 34 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27 or a conservative modification thereof.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 32, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 33, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 34; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 35, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 29.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- a heavy chain variable region is positioned at the N- terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VH-VL. In certain embodiments, a light chain variable region (VL) is positioned at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VL-VH.
- the anti-CD33 scFv is an scFv-Fc fusion protein or a full-length human IgG with VH and VL regions or CDRs selected from Table 5.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 43, as shown in Table 5.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 43 is set forth in SEQ ID NO: 45.
- the anti- CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 44.
- SEQ ID NO: 46 An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 44 is set forth in SEQ ID NO: 46.
- SEQ ID NO: 43-46 are provided in Table 5.
- the scFv is designated as “ 1-P13”.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 43 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 44.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 37 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39 or a conservative modification thereof.
- SEQ ID NOs: 37-39 are provided in Table 5.
- the anti-CD33 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42 or a conservative modification thereof.
- SEQ ID NOs: 40-42 are provided in Table 5.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 37 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42 or a conservative modification thereof.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 37, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 43, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 44.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- a heavy chain variable region is positioned at the N- terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VH-VL. In certain embodiments, a light chain variable region (VL) is positioned at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VL-VH.
- the anti-DLL scFv is an scFv-Fc fusion protein or a full-length human IgG with VH and VL regions or CDRs selected from Table 6.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 52, as shown in Table 6.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 52 is set forth in SEQ ID NO: 54.
- the anti- CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 53.
- SEQ ID NO: 55 An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 53 is set forth in SEQ ID NO: 55.
- SEQ ID NO: 52-55 are provided in Table 6.
- the scFv is designated as “1-P23”.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 52 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 53.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 47 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48 or a conservative modification thereof.
- SEQ ID NOs: 47, 38, and 48 are provided in Table 6.
- the anti-CD33 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51 or a conservative modification thereof.
- SEQ ID NOs: 49-51 are provided in Table 6.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 47 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51 or a conservative modification thereof.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 47, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 52, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 53.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- a heavy chain variable region is positioned at the N- terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VH-VL. In certain embodiments, a light chain variable region (VL) is positioned at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VL-VH
- the anti-CD33 scFv is an scFv-Fc fusion protein or a full-length human IgG with VH and VL regions or CDRs selected from Table 7.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 62, as shown in Table 7.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 62 is set forth in SEQ ID NO: 64.
- the anti-CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 63.
- SEQ ID NO: 65 An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 63 is set forth in SEQ ID NO: 65.
- SEQ ID NO: 62-65 are provided in Table 7.
- the scFv is designated as “1-A20”.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 62 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 63.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 56 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof.
- SEQ ID NOs: 56-58 are provided in Table 7.
- the anti-CD33 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 59 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 60 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 61 or a conservative modification thereof.
- SEQ ID NOs: 59-61 are provided in Table 7.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 56 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 58 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 59 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 60 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 61 or a conservative modification thereof.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 56, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 58; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 59, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 60, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 61.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 62 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 63.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- a heavy chain variable region (VH) is positioned at the N- terminus.
- the variable regions are positioned from the N- to the C- terminus: VH-VL.
- a light chain variable region (VL) is positioned at the N-terminus.
- the variable regions are positioned from the N- to the C- terminus: VL-VH. Table 7
- the anti-CD33 scFv is an scFv-Fc fusion protein or a full-length human IgG with VH and VL regions or CDRs selected from Table 8.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 72, as shown in Table 8.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 72 is set forth in SEQ ID NO: 74.
- the anti-CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 73.
- SEQ ID NO: 75 An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 73 is set forth in SEQ ID NO: 75.
- SEQ ID NO: 72-75 are provided in Table 8.
- the scFv is designated as “2-N3”.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 72 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 73.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 66 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 67 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 68 or a conservative modification thereof.
- SEQ ID NOs: 66-68 are provided in Table 8.
- the anti-CD33 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 69 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 70 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 71 or a conservative modification thereof.
- SEQ ID NOs: 69-71 are provided in Table 8.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 66 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 67 or a conservative modification thereof, a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 68 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 69 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 70 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 71 or a conservative modification thereof.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 66, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 67, a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 68; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 69, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 70, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 71.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 72, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 73.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- a heavy chain variable region is positioned at the N- terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VH-VL. In certain embodiments, a light chain variable region (VL) is positioned at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VL-VH.
- the anti-CD33 scFv is an scFv-Fc fusion protein or a full-length human IgG with VH and VL regions or CDRs selected from Table 9.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 81, as shown in Table 9.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 81 is set forth in SEQ ID NO: 83.
- the anti-CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 82.
- SEQ ID NO: 84 An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 82 is set forth in SEQ ID NO: 84.
- SEQ ID NO: 81-84 are provided in Table 9.
- the scFv is designated as “1-H19”.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 81 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 82.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 76 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 77 or a conservative modification thereof.
- SEQ ID NOs: 76, 57, and 77 are provided in Table 9.
- the anti-CD33 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 78 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 79 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 80 or a conservative modification thereof.
- SEQ ID NOs: 78-80 are provided in Table 9.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 76 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 77 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 78 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 79 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 80 or a conservative modification thereof.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 76, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 77; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 78, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 79, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 80.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 81, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 82.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- a heavy chain variable region is positioned at the N- terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VH-VL. In certain embodiments, a light chain variable region (VL) is positioned at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VL-VH.
- the anti-CD33 scFv is an scFv-Fc fusion protein or a full-length human IgG with VH and VL regions or CDRs selected from Table 10.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 88, as shown in Table 10.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 88 is set forth in SEQ ID NO: 90.
- the anti-CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 89.
- SEQ ID NO: 91 An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 89 is set forth in SEQ ID NO: 91.
- SEQ ID NO: 88-91 are provided in Table 10.
- the scFv is designated as “2-F18”.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 88 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 89.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 85 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 86 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 87 or a conservative modification thereof.
- SEQ ID NOs: 85-87 are provided in Table 10.
- the anti-CD33 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42 or a conservative modification thereof.
- SEQ ID NOs: 5, 41, and 42 are provided in Table 10.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 85 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 86 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 87 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42 or a conservative modification thereof.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 85, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 86, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 87; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 88, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 89.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- a heavy chain variable region is positioned at the N- terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VH-VL. In certain embodiments, a light chain variable region (VL) is positioned at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VL-VH.
- the anti-CD33 scFv is an scFv-Fc fusion protein or a full-length human IgG with VH and VL regions or CDRs selected from Table 11.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 8, as shown in Table 11.
- An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 8 is set forth in SEQ ID NO: 93.
- the anti-CD33 scFv comprises a VL comprising the amino acid sequence set forth in SEQ ID NO: 92.
- SEQ ID NO: 94 An exemplary nucleotide sequence encoding the amino acid sequence of SEQ ID NO: 92 is set forth in SEQ ID NO: 94.
- SEQ ID NO: 8, 92, 93, and 94 are provided in Table 11.
- the scFv is designated as “4-P3”.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 8 and a VL comprising the amino acid sequence set forth in SEQ ID NO: 92.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3 or a conservative modification thereof, and a H CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof.
- SEQ ID NOs: 2-4 are provided in Table 11.
- the anti-DDL3 scFv comprises a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 6 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 7 or a conservative modification thereof.
- SEQ ID NOs: 5-7 are provided in Table 11.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4 or a conservative modification thereof; and a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5 or a conservative modification thereof, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 6 or a conservative modification thereof, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 7 or a conservative modification thereof.
- the anti-CD33 scFv comprises a VH comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4, a VL comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 6, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 7.
- the anti-CD33 scFv comprises a VH comprising the amino acid sequence set forth in SEQ ID NO: 8, and a VL comprising the amino acid sequence set forth in SEQ ID NO: 92.
- the VH and VL are linked via a linker.
- the linker comprises the amino acid sequence set forth in SEQ ID NO: 105.
- a heavy chain variable region is positioned at the N- terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VH-VL. In certain embodiments, a light chain variable region (VL) is positioned at the N-terminus. In certain embodiments, the variable regions are positioned from the N- to the C- terminus: VL-VH.
- the presently disclosed subject matter provides antibodies (e.g., human antibodies, e.g., human monoclonal antibodies) that specifically bind to CD33 (e.g., human CD33).
- the VH amino acid sequences of anti-CD33 antibodies 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1-A20, 2-N3,
- 1-H19, 2-F18, and 4-P3 are set forth in SEQ ID NOs: 8, 18, 28, 35, 43, 52, 62, 72, 81, and 88.
- 2-F18, and 4-P3 are set forth in SEQ ID NOs: 9, 19, 29, 44, 53, 63, 73, 82, 89, and 92.
- VH and VL sequences can be “mixed and matched” to create other anti-CD33 binding molecules.
- CD33 binding of such “mixed and matched” antibodies can be tested using the binding assays known in the art, including for example, ELISAs, Western blots, RIAs, Biacore analysis.
- a VH sequence from a particular VH/VL pairing is replaced with a structurally similar VH sequence.
- a VL sequence from a particular VH/VL pairing is replaced with a structurally similar VL sequence.
- the presently disclosed subject matter provides an antibody or an antigen-binding fragment thereof comprising: (a) a heavy chain variable region (VH) comprising an amino acid sequence selected from SEQ ID NOs: 8, 18, 28, 35, 43, 52, 62, 72, 81, and 88; and (b) a light chain variable region (VL) comprising an amino acid sequence selected from SEQ ID NOs: 9, 19, 29, 44, 53, 63, 73, 82, 89, and 92; wherein the antibody or antigen-binding fragment specifically binds to CD33, e.g., human CD33.
- the VH and VL are selected from the group consisting of:
- the presently disclosed subject matter provides antibodies or antigen-binding fragments thereof that comprise the heavy chain and light chain CDRls, CDR2s and CDR3s of 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3.
- amino acid sequences of the V H CDRls of 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1- P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 are set forth in SEQ ID NOs: 2, 12, 22, 32, 37, 47, 56, 66, 76, and 85.
- amino acid sequences of the VH CDR2S of 3-P14, 4-B2, 1-J19, 1-J19-2, 1- P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 antibodies are set forth in SEQ ID NOs: 3, 13,
- amino acid sequences of the VH CDR3S of 3-P14, 4-B2, 1-J19, 1- J19-2, 1-P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 are set forth in SEQ ID NOs: 4, 14,
- amino acid sequences of the V L CDRls of 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 are set forth in SEQ ID NOs: 5, 15, 25, 40, 49, 59, 69, and
- amino acid sequences of the V L CDR2s of 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1- A20, 2-N3, 1-H19, 2-F18, and 4-P3 are set forth in SEQ ID NOs: 6, 16, 26, 41, 50, 60, 70, and
- amino acid sequences of the V L CDR3s of 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1- A20, 2-N3, 1-H19, 2-F18, and 4-P3 are set forth in SEQ ID NOs: 7, 17, 27, 42, 51, 61, 71, and
- the CDR regions are delineated using the IMGT system. In certain embodiments, the CDR regions are delineated using the IMGT numbering system accessible at http ://www.imgt. org/IMGT_vquest/input.
- VH CDR1, CDR2, and CDR3 sequences and VL CDR1, CDR2, and CDR3 sequences can be “mixed and matched” (i.e., CDRs from different antibodies can be mixed and match, although each antibody must contain a VH CDR1, CDR2, and CDR3 and a VL CDR1, CDR2, and CDR3) to create other anti-CD33 binding molecules.
- CD33 binding of such “mixed and matched” antibodies can be tested using the binding assays described above.
- the CDR1, CDR2 and/or CDR3 sequence from a particular VH sequence is replaced with a structurally similar CDR sequence(s).
- the CDR1, CDR2 and/or CDR3 sequence from a particular VL sequence preferably is replaced with a structurally similar CDR sequence(s).
- VH and VL sequences can be created by substituting one or more VH and/or VL CDR region sequences with structurally similar sequences from the CDR sequences of the antibodies or antigen-binding fragments thereof disclosed herein 3-P14, 4-B2, 1- J19, 1-J19-2, 1-P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3.
- the presently disclosed subject matter provides an antibody or an antigen-binding fragment thereof comprising:
- a heavy chain variable region CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2, SEQ ID NO: 12, SEQ ID NO: 22, SEQ ID NO: 32, SEQ ID NO: 37, SEQ ID NO:
- a heavy chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3, SEQ ID NO: 13, SEQ ID NO: 23, SEQ ID NO: 33, SEQ ID NO: 38, SEQ ID NO: 57, SEQ ID NO: 67, or SEQ ID NO: 86;
- a heavy chain variable region CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4, SEQ ID NO: 14, SEQ ID NO: 24, SEQ ID NO: 34, SEQ ID NO: 39, SEQ ID NO:
- a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 6, SEQ ID NO: 16, SEQ ID NO: 26, SEQ ID NO: 41, SEQ ID NO: 50, SEQ ID NO:
- SEQ ID NO: 61 SEQ ID NO: 71, or SEQ ID NO: 80.
- the antibody or antigen-binding fragment thereof comprises:
- the antibody or antigen-binding fragment thereof comprises:
- the antibody or antigen-binding fragment thereof comprises:
- the antibody or antigen-binding fragment thereof comprises:
- the antibody or antigen-binding fragment thereof comprises:
- SEQ ID NO: 40 (e) a light chain variable region CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41;
- the antibody or antigen-binding fragment thereof comprises:
- the antibody or antigen-binding fragment thereof comprises:
- the antibody or antigen-binding fragment thereof comprises:
- the antibody or antigen-binding fragment thereof comprises:
- the antibody or antigen-binding fragment thereof comprises:
- the anti-CD33 antibody or antigen-binding fragment thereof comprises a heavy chain constant region and/or a light chain constant region.
- the heavy chain constant region comprises an amino acid sequence that is about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 95.
- the heavy chain constant region comprises the amino acid sequence set forth in SEQ ID NO: 95. SEQ ID NO: 95 is provided below.
- the light chain constant region comprises an amino acid sequence that is about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 96.
- the light chain constant region comprises the amino acid sequence set forth in SEQ ID NO: 96. SEQ ID NO: 96 is provided below.
- the light chain constant region comprises an amino acid sequence that is about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 99.
- the light chain constant region comprises the amino acid sequence set forth in SEQ ID NO: 99. SEQ ID NO: 99 is provided below.
- GQPKANPTVTLFPPSSEELQANKATLVCLI SDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPE QWKSHRSYSCQVTHEGSTVEKTVAPTECS [ SEQ ID NO : 99 ]
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain constant region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 95; and (b) a light chain constant region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 96.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 95; and (b) a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 96.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain constant region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 95; and (b) a light chain constant region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 99.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 95; and (b) a light chain constant region comprising the amino acid sequence set forth in SEQ ID NO: 99.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 97.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 97. SEQ ID NO: 97 is provided below.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 98.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence set forth in SEQ ID NO: 98. SEQ ID NO: 98 is provided below.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 97; and (b) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 98.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 97; and (b) a light chain comprising the amino acid sequence set forth in SEQ ID NO: 98.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 100.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 100. SEQ ID NO: 100 is provided below.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 101.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence set forth in SEQ ID NO: 101. SEQ ID NO: 101 is provided below.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 100; and (b) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 101.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 100; and (b) a light chain comprising the amino acid sequence set forth in SEQ ID NO: 101.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 102.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 102. SEQ ID NO: 102 is provided below.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 103.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises a light chain comprising the amino acid sequence set forth in SEQ ID NO: 103.
- SEQ ID NO: 103 is provided below.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 100; and (b) a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 102.
- the anti-CD33 antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 100; and (b) a light chain comprising the amino acid sequence set forth in SEQ ID NO: 103.
- constant regions/framework regions of the anti-CD33 antibodies disclosed herein can be altered, for example, by amino acid substitution, to modify the properties of the antibody (e.g., to increase or decrease one or more of: antigen binding affinity, Fc receptor binding, antibody carbohydrate, for example, glycosylation, fucosylation etc., the number of cysteine residues, effector cell function, effector cell function, complement function or introduction of a conjugation site).
- a presently disclosed anti-CD33 antibody is a fully-human antibody, e.g., any one of 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3.
- Fully-human mAbs when administered to humans, causing serious side effects, including anaphylaxis and hypersensitivity reactions.
- phage display libraries have made it possible to select large numbers of antibody repertoires for unique and rare Abs against very defined epitopes (for more details on phage display see McCafferty et al., Phage antibodies: filamentous phage displaying antibody variable domains. Nature, 348: 552-554.)
- the rapid identification of human Fab or single chain Fv (scFv) fragments highly specific for tumor antigen-derived peptide-MHC complex molecules has thus become possible.
- mAb monoclonal antibody
- the presently disclosed subject matter involves the development of a fully human mAb that recognizes, for example, a human CD33 polypeptide (e.g., a polypeptide having the amino acid sequence set forth in SEQ ID NO: 116) for cancer therapy.
- a presently disclosed anti-CD33 antibody or antigen-binding fragment thereof comprises heavy and light chain variable regions comprising amino acid sequences that are homologous or identical to the amino acid sequences of the antibodies described herein (e.g., 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 antibodies), and wherein the antibodies or antigen-binding fragments thereof retain the desired functional properties of the anti-CD33 antibodies or antigen-binding fragments thereof of the presently disclosed subject matter.
- the antibodies or antigen-binding fragments thereof retain the desired functional properties of the anti-CD33 antibodies or antigen-binding fragments thereof of the presently disclosed subject matter.
- an anti-CD33 antibody or an antigen-binding fragment thereof comprising a heavy chain variable region and a light chain variable region, wherein:
- the heavy chain variable region comprises an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 28, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 52, SEQ ID NO: 62, SEQ ID NO: 72, SEQ ID NO: 81, or SEQ ID NO: 88; and
- the light chain variable region comprises an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 63, SEQ ID NO: 73, SEQ ID NO: 82, SEQ ID NO: 89, or SEQ ID NO: 92.
- the VH and/or VL amino acid sequences can be at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the sequences set forth above.
- An antibody having VH and VL regions having high (i.e., 80% or greater) homology or identity to the VH and VL regions of the sequences set forth above can be obtained by mutagenesis (e.g., site- directed or PCR-mediated mutagenesis), followed by testing of the encoded altered antibody for retained function (i.e., the binding affinity) using the binding assays described herein.
- mutagenesis e.g., site- directed or PCR-mediated mutagenesis
- the encoded altered antibody for retained function i.e., the binding affinity
- a presently disclosed anti-CD33 antibody or antigen-binding fragment thereof comprises heavy and light chain constant regions comprising amino acid sequences that are homologous or identical to the amino acid sequences of the antibodies described herein (e.g., 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 antibodies), and wherein the antibodies or antigen-binding fragments thereof retain the desired functional properties of the anti-CD33 antibodies or antigen-binding fragments thereof of the presently disclosed subject matter.
- the antibodies or antigen-binding fragments thereof retain the desired functional properties of the anti-CD33 antibodies or antigen-binding fragments thereof of the presently disclosed subject matter.
- an anti-CD33 antibody or an antigen-binding fragment thereof comprising a heavy chain constant region and a light chain constant region, wherein:
- the heavy chain constant region (CH) comprises an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 95; and
- the light chain constant region (CL) comprises an amino acid sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 9, SEQ ID NO: 96 or SEQ ID NO: 99.
- the CH and/or CL amino acid sequences can be at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the sequences set forth above.
- An antibody having CH and CL regions having high (i.e., 80% or greater) homology or identity to the CH and CL regions of the sequences set forth above can be obtained by mutagenesis (e.g., site- directed or PCR-mediated mutagenesis), followed by testing of the encoded altered antibody for retained function (i.e., the binding affinity) using the binding assays described herein.
- mutagenesis e.g., site- directed or PCR-mediated mutagenesis
- the percent homology between two amino acid sequences is equivalent to the percent identity between the two sequences.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
- the percent homology or identity between two amino acid sequences can be determined using the algorithm of E. Meyers and W. Miller (Comput Appl Biosci ( 1988);14 : 11-17) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent homology between two amino acid sequences can be determined using the Needleman and Wunsch (J Mol Biol (1970);48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available at www.gcg.com), using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5, or 6.
- the protein sequences of the presently disclosed subject matter can further be used as a “query sequence” to perform a search against public databases to, for example, identify related sequences.
- Such searches can be performed using the XBLAST program (version 2.0) of Altschul et al., J Mol Biol (1990);215 :403-l 0.
- Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res ( 1997);25(17) :3389-3402.
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- a presently disclosed anti-CD33 antibody or an antigen-binding fragment thereof comprises a heavy chain variable region comprising CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences based on the preferred antibodies described herein (e.g., 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 antibodies), or a conservative modification thereof, and wherein the antibodies retain the desired functional properties of the anti-CD33 antibodies or antigenbinding fragments thereof of the presently disclosed subject matter.
- the presently disclosed subject matter provides an antibody or an antigen-binding fragment thereof, comprising a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences, wherein:
- the heavy chain variable region CDR3 sequence comprises an amino acid sequence selected from SEQ ID NOs: 4, 14, 24, 34, 39, 48, 58, 68, 77, and 87, and conservative modifications thereof;
- the light chain variable region CDR3 sequence comprises an amino acid sequence selected from SEQ ID NOs: 7, 17, 27, 42, 51, 61, 71, and 80, and conservative modifications thereof.
- the heavy chain variable region CDR3 sequence comprises an amino acid sequence selected from SEQ ID NOs: 4, 14, 24, 34, 39, 48, 58, 68, 77, and 87, and conservative modifications thereof; and the light chain variable region CDR3 sequence comprises an amino acid sequence selected from SEQ ID NOs: 7, 17, 27, 42, 51, 61, 71, and 80, and conservative modifications thereof.
- the heavy chain variable region CDR2 sequence comprises an amino acid sequence selected from SEQ ID NOs: 3, 13, 23, 33, 38, 57, 67, and 86, and conservative modifications thereof; and the light chain variable region CDR2 sequence comprises an amino acid sequence selected from SEQ ID NOs: 6, 16, 26, 41, 50, 60, 70, and 79, and conservative modifications thereof.
- the heavy chain variable region CDR1 sequence comprises an amino acid sequence selected from SEQ ID NOs: 2, 12, 22, 32, 37, 47, 56, 66, 76, and 85, and conservative modifications thereof; and the light chain variable region CDR1 sequence comprises an amino acid sequence selected from SEQ ID NOs: 5, 15, 25, 40, 49, 59, 69, and 78, and conservative modifications thereof.
- conservative sequence modifications is intended to refer to amino acid modifications that do not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody of the present disclosure by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. Exemplary conservative amino acid substitutions are shown in Table 24. Amino acid substitutions may be introduced into an antibody of interest and the products screened for a desired activity, e.g., retained/improved antigen binding, decreased immunogenicity, or improved ADCC or CDC.
- a sequence disclosed herein e.g., a CDR sequence, a VH sequence or a VL sequence
- Amino acids may be grouped according to common side-chain properties:
- Non-conservative substitutions will entail exchanging a member of one of these classes for another class. 5.3.5. Anti-CD33 Antibodies that Cross-compete for Binding to CD 33 with Anti ⁇
- the presently disclosed subject matter provides antibodies or antigen-binding fragments thereof that cross-compete with any of the disclosed anti-CD33 antibodies for binding to CD33 (e.g., human CD33).
- the cross-competing antibodies can bind to the same epitope region, e.g., same epitope, adjacent epitope, or overlapping as any of the anti- CD33 antibodies or antigen-binding fragments thereof of the presently disclosed subject matter.
- the reference antibody or reference antigen-binding fragments thereof for cross-competition studies can be any one of the anti-CD33 antibodies or antigenbinding fragments thereof disclosed herein, e.g., 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1- A20, 2-N3, 1-H19, 2-F18, and 4-P3 antibodies.
- cross-competing antibodies can be identified based on their ability to cross-compete with any one of the presently disclosed anti- CD33 antibodies or antigen-binding fragments thereof in standard CD33 binding assays. For example, Biacore analysis, ELISA assays or flow cytometry can be used to demonstrate cross-competition with the antibodies of the presently disclosed subject matter.
- test antibody to inhibit the binding of, for example, any one of the presently disclosed anti-CD33 antibodies (e.g., 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1- P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 antibodies) to CD33 (e.g., human CD33) demonstrates that the test antibody can compete with any one of the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof for binding to CD33 (e.g., human CD33) and thus binds to the same epitope region on CD33 (e.g., human CD33) as any one of the presently disclosed anti- CD33 antibodies or antigen-binding fragments thereof.
- any one of the presently disclosed anti-CD33 antibodies e.g., 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1- P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 antibodies
- CD33 e.g.,
- the crosscompeting antibody or antigen-binding fragment thereof binds to the same epitope on CD33 (e.g., human CD33) as any one of the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof.
- Antibodies or antigen-binding fragments thereof of the presently disclosed subject can be tested for binding to CD33 by, for example, standard ELISA.
- each antibody can be biotinylated using commercially available reagents (Pierce, Rockford, IL). Competition studies using unlabeled monoclonal antibodies and biotinylated monoclonal antibodies can be performed using CD33 coated-ELISA plates as described above. Biotinylated mAb binding can be detected with a strep-avidin-alkaline phosphatase probe.
- isotype ELISAs can be performed using reagents specific for antibodies of a particular isotype.
- Anti-CD33 human IgGs can be further tested for reactivity with CD33 antigen by Western blotting.
- the KD is measured by a radiolabeled antigen binding assay (RIA).
- RIA radiolabeled antigen binding assay
- an RIA is performed with the Fab version of an antibody of interest and its antigen.
- solution binding affinity of Fabs for antigen is measured by equilibrating Fab with a minimal concentration of ( 125 I)-labeled antigen in the presence of a titration series of unlabeled antigen, then capturing bound antigen with an anti-Fab antibody-coated plate (see, e.g., Chen et al., J Mol Biol (1999);293:865-881).
- the KD is measured using a BIACORE® surface plasmon resonance assay.
- a BIACORE® surface plasmon resonance assay For example, an assay using a BIACORE®-2000 or a BIACORE ®-3000 (BIAcore, Inc., Piscataway, NJ)
- the presently disclosed subject provides an anti-CD33 antibody or an antigen-binding fragment thereof, conjugated to a therapeutic moiety, such as a cytotoxin, a drug (e.g., an immunosuppressant) or a radiotoxin.
- a therapeutic moiety such as a cytotoxin, a drug (e.g., an immunosuppressant) or a radiotoxin.
- cytotoxin e.g., an immunosuppressant
- radiotoxin e.g., an immunosuppressant
- Immunoconjugates that include one or more cytotoxins are referred to as “immunotoxins.”
- a cytotoxin or cytotoxic agent includes any agent that is detrimental to (e.g., kills) cells.
- Non-limiting examples of cytotoxins include taxol (such as ricin, diphtheria, gelonin), cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1 -dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- taxol such as ricin, diphtheria, gelonin
- cytochalasin B such as ricin, diphtheria, gelonin
- cytochalasin B such as ricin, diphtheria, gelonin
- cytochalasin B
- Therapeutic agents also include, for example, calecheamicin, aureastatin, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5 -fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cisdichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), hypo
- cytotoxins that can be conjugated to an anti- CD33 antibody disclosed herein include duocarmycins, calicheamicins, maytansines and auristatins, and derivatives thereof. Cytotoxins can be conjugated to an anti-CD33 antibody or an antigen-binding fragment thereof disclosed herein using linker technology available in the art. Examples of linker types that have been used to conjugate a cytotoxin to an antibody include, but are not limited to, hydrazones, thioethers, esters, disulfides and peptide-containing linkers.
- a linker can be chosen that is, for example, susceptible to cleavage by low pH within the lysosomal compartment or susceptible to cleavage by proteases, such as proteases preferentially expressed in tumor tissue such as cathepsins (e.g., cathepsins B, C, D).
- proteases such as proteases preferentially expressed in tumor tissue such as cathepsins (e.g., cathepsins B, C, D).
- Anti- CD33 antibodies or antigen-binding fragments thereof of the presently disclosed subject matter also can be conjugated to a radioactive isotope to generate cytotoxic radiopharmaceuticals, also referred to as radioimmunoconjugates.
- cytotoxic radiopharmaceuticals also referred to as radioimmunoconjugates.
- Non-limiting examples of radioactive isotopes that can be conjugated to antibodies for use diagnostically or therapeutically include 47 Sc, 67 Cu, 90 Y, 131 I, 149 Tb, 161 Tb, 177 Lu, 225 Ac, 213 Bi, 223 Ra and 227 Th. Methods for preparing radioimmunconjugates are established in the art.
- radioimmunoconjugates are commercially available, including ZevalinTM (IDEC Pharmaceuticals) and BexxarTM (Corixa Pharmaceuticals), and similar methods can be used to prepare radioimmunoconjugates using the presently disclosed anti-CD33 antibodies.
- the anti-CD33 antibodies or antigen-binding fragments thereof of the presently disclosed subject matter can be conjugated to a radioisotope to generate a radioimmunoconjugate by using a chelator.
- chelator refers to a chemical compound in the form of a heterocyclic ring or surrounding structure containing a metal ion attached by coordinate bonds to at least two nonmetal ions.
- Non-limiting examples of chelator include l,4,7-Triazacyclononane-l,4,7-triacetic acid (NOTA), 2,2'-(7-(l-carboxy-4-((4- isothiocyanatobenzyl)amino)-4-oxobutyl)-l,4,7-triazonane-l,4-diyl)diacetic acid (NODA), 2,2',2'',2"'-(l,4,7,10-Tetraazacyclododecane-l,4,7,10-tetrayl)tetraacetic acid (DOTA), Diethylenetriamine-N,N,N',N,N-pentaacetic acid, pentetic acid, (Carboxymethyl)imino] bis(ethylenenitrilo)-tetra-acetic acid (DTP A), l-Hydroxy-2-pyridone;2-Pyridinol-l -oxide
- HOPO N-(5-(3-((5-Aminopentyl)hydroxycarbamoyl) propionamido)pentyl)-3- ((5-(N- hydroxyacetamido) pentyl)carbamoyl) propionohydroxamic acid
- DFO N-(N- hydroxyacetamido) pentyl)carbamoyl) propionohydroxamic acid
- NODAGA 2-[l,4,7- Triazacyclononan-l-yl-4,7-bis(tBu-ester)]-l,5-pentanedioic acid
- Additional exemplary chelators encompassed by the presently disclosed subject matter include AAZTA and derivatives thereof, BAT, BARAC, BPCA, TE2A, CB-TE2A, CB0TE1A1P, CB-TE2P, MM- TE2A, DM TE-2A, CP356, DATA, DBCO, DiAmSar and derivatives thereof, DIBO, DIMA, DFO, DGO, DOTA and derivatives thereof (e g., Ac-DOTA, benzo-DOTA, dibenzo-DOTA, CB- DO2A, 3p-C-DEPA, Oxo-DO3 A), DOTMA derivative thereof (e g., benzo-DOTMA), DTPA and derivatives thereof (e.g., benzo-DTPA, dibenzo-DTPA, phenyl-DTPA, diphenyl-DTPA, benzyl- DTPA, dibenzyl-DTPA, 1B4M-DTPA, CHX-A"- DT
- the antibody conjugates of the presently disclosed subject matter can be used to modify a given biological response, and the drug moiety is not to be construed as limited to classical chemical therapeutic agents.
- the drug moiety may be a protein or polypeptide possessing a desired biological activity.
- Such proteins may include, for example, an enzymatically active toxin, or active fragment thereof, such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor (TNF) or interferon-y; or, biological response modifiers such as, for example, lymphokines, interleukin- 1 (IL-1), interleukin-2 (IL-2), interleukin-6 (IL-6), granulocyte macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), or other growth factors.
- TNF tumor necrosis factor
- IL-6 interleukin-6
- GM-CSF granulocyte macrophage colony stimulating factor
- G-CSF granulocyte colony stimulating factor
- the presently disclosed subject matter provides multi-specific molecules comprising an anti-CD33 antibody, or a fragment thereof, disclosed herein.
- a presently disclosed or an antigenbinding fragment thereof can be derivatized or linked to one more functional molecules, e.g., one or more peptides or proteins (e.g., one or more antibodies or ligands for a receptor) to generate a multi-specific molecule that binds to two or more different binding sites or target molecules.
- the presently disclosed anti-CD33 antibody or antigen-binding fragment thereof can in fact be derivatized or linked to more than one other functional molecules to generate multi-specific molecules that bind to more than two different binding sites and/or target molecules.
- a presently disclosed anti-CD33 antibody or an antigen-binding fragment thereof can be functionally linked (e.g., by chemical coupling, genetic fusion, noncovalent association or otherwise) to one or more other binding molecules, such as another antibody, antibody fragment, peptide or binding mimetic, such that a bispecific molecule.
- the multi-specific molecule is a bispecific molecule.
- the bispecific molecules comprises at least a first binding specificity for CD33 and a second binding specificity for a second target epitope region.
- the second target epitope region can be a CD33 epitope, or a non-CD33 epitope, e.g., a different antigen.
- the multi-specific molecule comprises a first binding specificity for CD33, a second binding specificity for a second target, and a third binding specificity for a third target.
- the second target is an antigen expressed on the surface of an immune cell (e.g., a T cell, or a human immune effector cell).
- the multi-specific molecule is capable of recruiting the activity of that immune effector cell by specifically binding to the effector antigen on the human immune effector cell, thereby enhancing effector function.
- the third target is an antigen expressed on a senescent cell.
- the multi-specific molecules of the presently disclosed subject matter can be prepared by conjugating the constituent binding specificities using methods known in the art. For example, each binding specificity of the multi-specific molecule can be generated separately and then conjugated to one another. When the binding specificities are proteins or peptides, a variety of coupling or cross-linking agents can be used for covalent conjugation.
- Non-limiting examples of cross-linking agents include protein A, carbodiimide, N-succinimidyl-S-acetyl-thioacetate (SATA), 5, 5'-dithiobis(2-nitrobenzoic acid) (DTNB), o-phenylenedimaleimide (oPDM), N- succinimidyl-3-(2-pyridyldithio)propionate (SPDP), and sulfosuccinimidyl 4-(N- maleimidomethyl) cyclohaxane-1 -carboxylate (sulfo-SMCC) (see e.g., Karpovsky et al. (1984) J. Exp. Med.
- Conjugating agents can be SATA and sulfo-SMCC, both available from Pierce Chemical Co. (Rockford, IL).
- the binding specificities are antibodies, they can be conjugated via sulfhydryl bonding of the C-terminus hinge regions of the two heavy chains.
- the hinge region is modified to contain an odd number of sulfhydryl residues, preferably one, prior to conjugation.
- both binding specificities can be encoded in the same vector and expressed and assembled in the same host cell. This method is particularly useful where the multi-specific molecule is a mAb x mAb, mAb x Fab, Fab x F(ab’)2 or ligand x Fab fusion protein.
- Binding of the multi-specific molecules to their specific targets can be confirmed by, for example, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), FACS analysis, bioassay (e.g., growth inhibition), or Western Blot assay.
- ELISA enzyme-linked immunosorbent assay
- RIA radioimmunoassay
- FACS analysis bioassay (e.g., growth inhibition)
- bioassay e.g., growth inhibition
- Western Blot assay Western Blot assay.
- Each of these assays generally detects the presence of protein-antibody complexes of particular interest by employing a labeled reagent (e.g., an antibody) specific for the complex of interest.
- the complexes can be detected using any of a variety of other immunoassays.
- the antibody can be radioactively labeled and used in a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, March, 1986, which is incorporated by reference herein).
- RIA radioimmunoassay
- the radioactive isotope can be detected by such means as the use of a y counter or a scintillation counter or by autoradiography.
- the presently disclosed subject matter provides nucleic acids encoding the anti-CD33 antibodies or antigen-binding fragments thereof disclosed herein.
- the presently disclosed subject matter provides nucleic acids encoding the heavy chain variable region sequence of any one of the presently disclosed anti-CD33 antibodies (e.g., 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1- A20, 2-N3, 1-H19, 2-F18, and 4-P3 antibodies).
- the nucleic acid comprises or consists of a nucleotide sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the nucleotide sequence set forth in SEQ ID NO: 10, SEQ ID NO: 20, SEQ ID NO: 30, SEQ ID NO: 36, SEQ ID NO: 45, SEQ ID NO: 54, SEQ ID NO: 64, SEQ ID NO: 74, SEQ ID NO: 83, SEQ ID NO: 90, or SEQ ID NO: 93.
- the nucleic acid comprises or consists of the nucleotide sequence set forth in SEQ ID NO: 10, SEQ ID NO: 20, SEQ ID NO: 30, SEQ ID NO: 36, SEQ ID NO: 45, SEQ ID NO: 54, SEQ ID NO: 64, SEQ ID NO: 74, SEQ ID NO: 83, SEQ ID NO: 90, or SEQ ID NO: 93.
- the presently disclosed subject matter provides nucleic acids encoding the light chain variable region sequence of any one of the presently disclosed anti-CD33 antibodies (e.g., 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 antibodies).
- the presently disclosed anti-CD33 antibodies e.g., 3-P14, 4-B2, 1-J19, 1-J19-2, 1-P13, 1-P23, 1-A20, 2-N3, 1-H19, 2-F18, and 4-P3 antibodies.
- the nucleic acid comprises or consists of a nucleotide sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the nucleotide sequence set forth in SEQ ID NO: 11, SEQ ID NO: 21, SEQ ID NO: 31, SEQ ID NO: 46, SEQ ID NO: 55, SEQ ID NO: 65, SEQ ID NO: 75, SEQ ID NO: 84, SEQ ID NO: 91, or SEQ ID NO: 94.
- the nucleic acid comprises or consists of the nucleotide sequence set forth in SEQ ID NO: 11, SEQ ID NO: 21, SEQ ID NO: 31, SEQ ID NO: 46, SEQ ID NO: 55, SEQ ID NO: 65, SEQ ID NO: 75, SEQ ID NO: 84, SEQ ID NO: 91, or SEQ ID NO: 94.
- vectors comprising the presently disclosed nucleic acids.
- the vector is an expression vector.
- the presently disclosed subject matter further provides host cells comprising the vectors disclosed herein.
- the host cells are T cells.
- compositions comprising a presently disclosed anti-CD33 antibody or an antigen-binding fragment thereof, a presently disclosed immunoconjugate, a presently disclosed multi-specific molecule.
- the composition is a pharmaceutical composition further comprising a pharmaceutically acceptable carrier.
- Suitable pharmaceutically acceptable carriers include, for example, one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof. Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelflife or effectiveness of the binding proteins.
- the compositions of the injection can, as is well known in the art, be formulated so as to provide quick, sustained or delayed release of the active ingredient after administration to the mammal.
- the presently disclosed subject matter provides various methods of using the anti-CD33 antibodies or antigen-binding fragments thereof, the immunoconjugate, the multi-specific molecule, and the composition disclosed herein.
- the presently disclosed subject matter provides methods for treating or ameliorating a disease or disorder in a subject.
- the method comprises administering one or more of the anti-CD33 antibodies or antigen-binding fragments thereof, the immunoconjugate, the multi-specific molecule, or the composition disclosed herein to the subject.
- the disease or disorder is associated with CD33.
- the disease or disorder is associated with overexpression of CD33.
- the disease or disorder is tumor.
- the presently disclosed subject matter provides methods of reducing tumor burden in a subject.
- the method comprises administering one or more of the anti- CD33 antibodies or antigen-binding fragments thereof, the immunoconjugate, the multi-specific molecule, or the composition disclosed herein to the subject.
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof can reduce the number of tumor cells, reduce tumor size, and/or eradicate the tumor in the subject.
- the presently disclosed subject matter also provides methods of increasing or lengthening survival of a subject having a tumor.
- the method comprises administering one or more of the anti-CD33 antibodies or antigen -binding fragments thereof, the immunoconjugate, the multi-specific molecule, or the composition disclosed herein to the subject.
- the method can reduce or eradicate tumor burden in the subject.
- the presently disclosed subject matter further provides methods for treating and/or preventing a tumor in a subject.
- the method comprises administering one or more of the anti-CD33 antibodies or antigen-binding fragments thereof, the immunoconjugate, the multi-specific molecule, or the composition disclosed herein to the subject.
- Such methods comprise administering the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof in an amount effective, a presently disclosed composition (e.g., a pharmaceutical composition) to achieve the desired effect, be it palliation of an existing condition or prevention of recurrence.
- a presently disclosed composition e.g., a pharmaceutical composition
- the amount administered is an amount effective in producing the desired effect.
- An effective amount can be provided in one or a series of administrations.
- An effective amount can be provided in a bolus or by continuous perfusion.
- the tumor is cancer.
- the tumor is selected from the group consisting of hematological cancer, and solid tissue cancer.
- the hematological cancer is selected from the group consisting of acute myeloid leukemia (AML), myelodysplastic syndromes (MDS), acute lymphoblastic leukemia (ALL), chronic lymphocytic leukemia (CLL), myeloproliferative neoplasms (MPNs), and chronic myeloid neoplasms.
- the tumor is acute myeloid leukemia AML.
- Any suitable method or route can be used to administer a presently disclosed anti-CD33 antibody, and optionally, to co-administer antineoplastic agents.
- Routes of administration include, but are not limited to, oral, intravenous, intraperitoneal, subcutaneous, intramuscular, intranodal, intratumoral, intraosseous, intrathecal, pleural, intrapleural, topical, and direct administration. It should be emphasized, however, that the presently disclosed subject matter is not limited to any particular method or route of administration.
- anti-CD33 antibodies or antigen-binding fragments thereof can be administered as a conjugate, which binds specifically to the receptor and delivers a toxic, lethal payload following ligand-toxin internalization.
- the presently disclosed anti-CD33 antibodies, antigen-binding fragments thereof, multispecific molecules, and nucleic acids encode thereof can be used for diagnostic and prognostic applications as well as use as research tools for detection of CD33 in a biological sample, in a cell, a tissue, or a blood sample.
- the presently disclosed subject matter provides methods for detecting CD33 in a cell, a tissue, or a blood sample.
- the method comprises: contacting a cell, a tissue, or a blood sample with the antibody, antigen-binding fragment thereof, or multi-specific molecule disclosed herein, wherein the antibody, antigen-binding fragment thereof or multi-specific molecule comprises a detectable label; and determining the amount of the labeled antibody, antigen-binding fragment thereof, or multi-specific molecule bound to the cell, tissue, or blood sample by measuring the amount of detectable label associated with the cell or tissue, wherein the amount of bound antibody, antigen-binding fragment thereof, or multispecific molecule indicates the amount of CD33 in the cell, tissue, or a blood sample.
- the cell or tissue can be any cell or tissue, including any normal, healthy, or cancerous cells and tissues.
- the blood sample is a peripheral blood sample.
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof can be used in methods known in the art relating to the localization and/or quantitation of CD33 polypeptides (e.g., for use in measuring levels of the CD33 protein within appropriate physiological samples, for use in diagnostic methods, for use in imaging the polypeptide, and the like).
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof can be used to isolate a CD33 polypeptide by standard techniques, such as affinity chromatography or immunoprecipitation.
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof can facilitate the purification of natural immunoreactive
- CD33 proteins from biological samples, e.g., mammalian sera or cells as well as recombinantly-produced immunoreactive CD33 proteins expressed in a host system.
- anti-CD33 antibodies of the present technology can be used to detect an immunoreactive CD33 protein (e.g., in plasma, a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the immunoreactive polypeptide.
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof can be used diagnostically to monitor immunoreactive CD33 protein levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen.
- the detection can be facilitated by coupling (i.e., physically linking) the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof to a detectable substance.
- An exemplary method for detecting the presence or absence of an immunoreactive CD33 protein in a biological sample comprises contacting a biological sample from a subject with a presently disclosed anti-CD33 antibody or an antigen-binding fragment thereof, wherein the presence of an immunoreactive CD33 protein is detected in the biological sample. Detection may be accomplished by means of a detectable label attached to the antibody.
- labeled with regard to the anti-CD33 antibody or antigen-binding fragment thereof is intended to encompass direct labeling of the antibody by coupling (i.e., physically linking) a detectable substance to the antibody, as well as indirect labeling of the antibody by reactivity with another compound that is directly labeled, such as a secondary antibody.
- indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin.
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof are conjugated to one or more detectable labels.
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof may be detectably labeled by covalent or non-covalent attachment of a chromogenic, enzymatic, radioisotopic, isotopic, fluorescent, toxic, chemiluminescent, nuclear magnetic resonance contrast agent or other label.
- the presently disclosed detection methods can be used to detect an immunoreactive CD33 protein in a biological sample in vitro as well as in vivo.
- in vitro techniques for detection of an immunoreactive CD33 protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, radioimmunoassay, and immunofluorescence.
- in vivo techniques for detection of an immunoreactive CD33 protein include introducing into a subject a labeled anti-CD33 antibody or an antigen-binding fragment thereof.
- the anti-CD33 antibody or antigen-binding fragment thereof can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
- the biological sample comprises CD33 protein molecules from the test subject.
- anti-CD33 antibodies or antigen-binding fragments thereof can be used to assay immunoreactive CD33 protein levels in a biological sample (e.g., human plasma) using antibody-based techniques.
- a biological sample e.g., human plasma
- protein expression in tissues can be studied with classical immunohistological methods.
- Other antibody -based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, and radioisotopes or other radioactive agent, such as iodine ( 125 I, 121 I, 131 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( ni In), and technetium ( 99m Tc), and fluorescent labels, such as fluorescein, rhodamine, and green fluorescent protein (GFP), as well as biotin.
- enzyme labels such as, glucose oxidase, and radioisotopes or other radioactive agent, such as iodine ( 125 I, 121 I, 131 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( ni In), and technetium ( 99m Tc)
- fluorescent labels such as fluorescein, rhodamine, and green fluorescent protein (GFP), as well as biotin.
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof may be used for in vivo imaging of CD33.
- Antibodies useful for this method include those detectable by X- radiography, NMR or ESR.
- suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject.
- Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which can be incorporated into the anti-CD33 antibodies by labeling of nutrients for the relevant scFv clone.
- anti-CD33 antibodies or antigen-binding fragments thereof which are labeled with an appropriate detectable imaging moiety (such as a radioisotope (e.g., 131 I, U1 IN " m Tc, 18 F, 89 Zr), a radio-opaque substance, or a material detectable by nuclear magnetic resonance) are introduced (e.g., parenterally, subcutaneously, or intraperitoneally) into the subject.
- an appropriate detectable imaging moiety such as a radioisotope (e.g., 131 I, U1 IN " m Tc, 18 F, 89 Zr), a radio-opaque substance, or a material detectable by nuclear magnetic resonance) are introduced (e.g., parenterally, subcutaneously, or intraperitoneally) into the subject.
- an appropriate detectable imaging moiety such as a radioisotope (e.g., 131 I, U1 IN " m Tc, 18 F, 89 Zr), a radio-op
- the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of " m Tc.
- the labeled anti-CD33 antibody or antigen-binding fragment thereof then accumulates at the location of cells which contain the specific target polypeptide.
- the labeled anti-CD33 antibodies or antigen-binding fragments thereof accumulate within the subject in cells and tissues in which the CD33 protein has localized.
- the presently disclosed subject matter provides diagnostic methods of a medical condition.
- the method comprises: (a) assaying the expression of immunoreactive CD33 protein by measuring binding of a presently disclosed anti-CD33 antibody or an antigen-binding fragment thereof in cells or body fluid of an individual; and (b) comparing the amount of immunoreactive CD33 protein present in the sample with a standard reference, wherein an increase or decrease in immunoreactive CD33 protein levels compared to the standard is indicative of a medical condition.
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof may be used to purify immunoreactive CD33 protein from a sample.
- the antibodies are immobilized on a solid support.
- solid supports include plastics such as polycarbonate, complex carbohydrates such as agarose and sepharose, acrylic resins and such as polyacrylamide and latex beads. Techniques for coupling antibodies to such solid supports are well known in the art.
- the simplest method to bind the antigen to the antibody-support matrix is to collect the beads in a column and pass the antigen solution down the column.
- the efficiency of this method depends on the contact time between the immobilized antibody and the antigen, which can be extended by using low flow rates.
- the immobilized antibody captures the antigen as it flows past.
- an antigen can be contacted with the antibody-support matrix by mixing the antigen solution with the support (e.g., beads) and rotating the slurry, allowing maximum contact between the antigen and the immobilized antibody.
- the slurry is passed into a column for collection of the beads.
- the beads are washed using a suitable washing buffer and then the pure or substantially pure antigen is eluted.
- An antibody or polypeptide of interest can be conjugated to a solid support, such as a bead.
- a first solid support such as a bead
- a second solid support which can be a second bead or other support, by any suitable means, including those disclosed herein for conjugation of a polypeptide to a support.
- any of the conjugation methods and means disclosed herein with reference to conjugation of a polypeptide to a solid support can also be applied for conjugation of a first support to a second support, where the first and second solid support can be the same or different.
- Appropriate linkers which can be cross-linking agents, for use for conjugating a polypeptide to a solid support include a variety of agents that can react with a functional group present on a surface of the support, or with the polypeptide, or both.
- Reagents useful as crosslinking agents include homo-bi-functional and, in particular, hetero-bi-functional reagents.
- Useful bi-functional cross-linking agents include, but are not limited to, N-SIAB, dimaleimide, DTNB, N-SATA, N-SPDP, SMCC and 6-HYNIC.
- a cross-linking agent can be selected to provide a selectively cleavable bond between a polypeptide and the solid support.
- a photolabile cross-linker such as 3-amino-(2-nitrophenyl)propionic acid can be employed as a means for cleaving a polypeptide from a solid support.
- a photolabile cross-linker such as 3-amino-(2-nitrophenyl)propionic acid
- Other crosslinking reagents are well-known in the art. (See, e.g., Wong (1991), supra; and Hermanson (1996), supra).
- An antibody or polypeptide can be immobilized on a solid support, such as a bead, through a covalent amide bond formed between a carboxyl group functionalized bead and the amino terminus of the polypeptide or, conversely, through a covalent amide bond formed between an amino group functionalized bead and the carboxyl terminus of the polypeptide.
- a bifunctional trityl linker can be attached to the support, e.g., to the 4-nitrophenyl active ester on a resin, such as a Wang resin, through an amino group or a carboxyl group on the resin via an amino resin.
- the solid support can require treatment with a volatile acid, such as formic acid or trifluoroacetic acid to ensure that the polypeptide is cleaved and can be removed.
- a volatile acid such as formic acid or trifluoroacetic acid
- the polypeptide can be deposited as a beadless patch at the bottom of a well of a solid support or on the flat surface of a solid support.
- the polypeptide can be desorbed into a MS.
- Hydrophobic trityl linkers can also be exploited as acid-labile linkers by using a volatile acid or an appropriate matrix solution, e.g., a matrix solution containing 3 -HP A, to cleave an amino linked trityl group from the polypeptide.
- Acid lability can also be changed.
- trityl, monomethoxytrityl, dimethoxytrityl or trimethoxytrityl can be changed to the appropriate p-substituted, or more acid-labile tritylamine derivatives, of the polypeptide, i.e., trityl ether and tritylamine bonds can be made to the polypeptide.
- a polypeptide can be removed from a hydrophobic linker, e.g., by disrupting the hydrophobic attraction or by cleaving tritylether or tritylamine bonds under acidic conditions, ncluding, if desired, under typical MS conditions, where a matrix, such as 3 -HP A acts as an acid.
- Orthogonally cleavable linkers can also be useful for binding a first solid support, e.g., a bead to a second solid support, or for binding a polypeptide of interest to a solid support.
- a first solid support e.g., a bead
- a second solid support without cleaving the polypeptide from the support; the polypeptide then can be cleaved from the bead at a later time.
- a disulfide linker which can be cleaved using a reducing agent, such as DTT, can be employed to bind a bead to a second solid support, and an acid cleavable bi-functional trityl group could be used to immobilize a polypeptide to the support.
- the linkage of the polypeptide to the solid support can be cleaved first, e.g., leaving the linkage between the first and second support intact.
- Trityl linkers can provide a covalent or hydrophobic conjugation and, regardless of the nature of the conjugation, the trityl group is readily cleaved in acidic conditions.
- a bead can be bound to a second support through a linking group which can be selected to have a length and a chemical nature such that high density binding of the beads to the solid support, or high density binding of the polypeptides to the beads, is promoted.
- a linking group can have, e.g., "tree-like" structure, thereby providing a multiplicity of functional groups per attachment site on a solid support. Examples of such linking group; include polylysine, polyglutamic acid, penta-erythrole and tris-hydroxy-aminomethane.
- Noncovalent Binding Association An antibody or polypeptide can be conjugated to a solid support, or a first solid support can also be conjugated to a second solid support, through a noncovalent interaction.
- a magnetic bead made of a ferromagnetic material which is capable of being magnetized, can be attracted to a magnetic solid support, and can be released from the support by removal of the magnetic field.
- the solid support can be provided with an ionic or hydrophobic moiety, which can allow the interaction of an ionic or hydrophobic moiety, respectively, with a polypeptide, e.g., a polypeptide containing an attached trityl group or with a second solid support having hydrophobic character.
- a solid support can also be provided with a member of a specific binding pair and, therefore, can be conjugated to a polypeptide or a second solid support containing a complementary binding moiety.
- a bead coated with avidin or with streptavidin can be bound to a polypeptide having a biotin moiety incorporated therein, or to a second solid support coated with biotin or derivative of biotin, such as iminobiotin. It should be recognized that any of the binding members disclosed herein or otherwise known in the art can be reversed.
- biotin e.g., can be incorporated into either a polypeptide or a solid support and, conversely, avidin or other biotin binding moiety would be incorporated into the support or the polypeptide, respectively.
- Other specific binding pairs contemplated for use herein include, but are not limited to, hormones and their receptors, enzyme, and their substrates, a nucleotide sequence and its complementary sequence, an antibody and the antigen to which it interacts specifically, and other such pairs knows to those skilled in the art.
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof are useful in diagnostic methods. As such, the presently disclosed subject matter provides methods using the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof in diagnosis of CD33 activity in a subject.
- the presently disclosed anti-CD33 antibodies or antigenbinding fragments thereof may be selected such that they have any level of epitope binding specificity and high binding affinity to a CD33 polypeptide.
- the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof can be used to detect an immunoreactive CD33 protein in a variety of standard assay formats. Such formats include immunoprecipitation, Western blotting, ELISA, radioimmunoassay, and immunometric assays.
- Biological samples can be obtained from any tissue or body fluid of a subject.
- the subject is at an early stage of cancer.
- the early stage of cancer is determined by the level or expression pattern of CD33 protein in a sample obtained from the subject.
- the sample is selected from the group consisting of urine, blood, serum, plasma, saliva, amniotic fluid, cerebrospinal fluid (CSF), and biopsi ed body tissue.
- Immunometric or sandwich assays are one format for the diagnostic methods of the present technology. Such assays use one antibody, e.g., the anti-CD33 antibody or a population of anti- CD33 antibodies immobilized to a solid phase, and another anti-CD33 antibody or a population of anti-CD33 antibodies in solution. Typically, the solution anti-CD33 antibody or population of anti-CD33 antibodies is labeled. If an antibody population is used, the population can contain antibodies binding to different epitope specificities within the target polypeptide. Accordingly, the same population can be used for both solid phase and solution antibody. If anti-CD33 monoclonal antibodies are used, first and second CD33 monoclonal antibodies having different binding specificities are used for the solid and solution phase.
- Solid phase (also referred to as “capture”) and solution (also referred to as “detection”) antibodies can be contacted with target antigen in either order or simultaneously. If the solid phase antibody is contacted first, the assay is referred to as being a forward assay. Conversely, if the solution antibody is contacted first, the assay is referred to as being a reverse assay. If the target is contacted with both antibodies simultaneously, the assay is referred to as a simultaneous assay. After contacting the CD33 protein with the anti-CD33 antibody, a sample is incubated for a period that usually varies from about 10 min to about 24 hr and is usually about 1 hr.
- a wash step is then performed to remove components of the sample not specifically bound to the anti-CD33 antibody being used as a diagnostic reagent.
- a wash can be performed after either or both binding steps.
- binding is quantified, typically by detecting a label linked to the solid phase through binding of labeled solution antibody.
- a calibration curve is prepared from samples containing known concentrations of target antigen. Concentrations of the immunoreactive CD33 protein in samples being tested are then read by interpolation from the calibration curve (i.e., standard curve).
- Analyte can be measured either from the amount of labeled solution antibody bound at equilibrium or by kinetic measurements of bound labeled solution antibody at a series of time points before equilibrium is reached. The slope of such a curve is a measure of the concentration of the CD33 protein in a sample.
- Suitable supports for use in the above methods include, e.g., nitrocellulose membranes, nylon membranes, and derivatized nylon membranes, and also particles, such as agarose, a dextran-based gel, dipsticks, particulates, microspheres, magnetic particles, test tubes, microtiter wells, SEPHADEXTM (Amersham Pharmacia Biotech, Piscataway N.J.), and the like. Immobilization can be by absorption or by covalent attachment.
- anti-CD33 antibodies can be joined to a linker molecule, such as biotin for attachment to a surface bound linker, such as avidin.
- the presently disclosed anti-CD33 antibody or antigen-binding fragment thereof is conjugated to a diagnostic agent.
- the diagnostic agent may comprise a radioactive or non-radioactive label, a contrast agent (such as for magnetic resonance imaging, computed tomography or ultrasound), and the radioactive label can be a gamma-, beta-, alpha-, Auger electron-, or positron-emitting isotope.
- a diagnostic agent is a molecule which is administered conjugated to an antibody moiety, i.e., antibody or antibody fragment, or subfragment, and is useful in diagnosing or detecting a disease by locating the cells comprising the antigen.
- Useful diagnostic agents include, but are not limited to, radioisotopes, dyes (such as with the biotin-streptavidin complex), contrast agents, fluorescent compounds or molecules and enhancing agents (e.g., paramagnetic ions) for magnetic resonance imaging (MRI).
- the diagnostic agents are selected from the group consisting of radioisotopes, enhancing agents for use in magnetic resonance imaging, and fluorescent compounds.
- Chelates may be coupled to the presently disclosed anti-CD33 antibodies or antigen-binding fragments thereof using standard chemistries. The chelate is normally linked to the antibody by a group which enables formation of a bond to the molecule with minimal loss of immunoreactivity and minimal aggregation and/or internal cross-linking.
- kits for treatment or ameliorating a disease or disorder associated with CD33 e.g., AML
- the kit comprises the anti-CD33 antibodies or antigen-binding fragments thereof, the immunoconjugate, the multi-specific molecule, or the composition disclosed herein.
- the kit comprises a sterile container which contains a therapeutic or prophylactic vaccine; such containers can be boxes, ampules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art.
- Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
- the kit further comprises instructions for administering the anti- CD33 antibodies or antigen-binding fragments thereof, the immunoconjugate, the multi-specific molecule, or the composition disclosed herein to a subject in need the treatment.
- the instructions can generally include information about the use of the anti-CD33 antibodies or antigen-binding fragments thereof, the immunoconjugate, the multi-specific molecule, and the composition disclosed herein for the treatment or ameliorating a disease or disorder.
- the instructions include at least one of the following: description of the therapeutic agent; dosage schedule and administration for treatment and/or prevention of a tumor or neoplasm or symptoms thereof; precautions; warnings; indications; counter-indications; overdosage information; adverse reactions; animal pharmacology; clinical studies; and/or references.
- the instructions may be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.
- the presently disclosed subject matter provides an anti-CD33 antibody or an antigen-binding fragment thereof, comprising a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 28, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 52, SEQ ID NO: 62, SEQ ID NO: 72, SEQ ID NO: 81, or SEQ ID NO: 88.
- the presently disclosed subject matter provides an anti-CD33 antibody or an antigen-binding fragment thereof, comprising a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 63, SEQ ID NO: 73, SEQ ID NO: 82, SEQ ID NO: 89, or SEQ ID NO: 92.
- the presently disclosed subject matter provides an anti-CD33 antibody or an antigen-binding fragment thereof, comprising
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 28, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 52, SEQ ID NO: 62, SEQ ID NO: 72, SEQ ID NO: 81, or SEQ ID NO: 88; and
- a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 63, SEQ ID NO: 73, SEQ ID NO: 82, SEQ ID NO: 89, or SEQ ID NO: 92.
- the presently disclosed subject matter provides an anti-CD33 antibody or an antigen-binding fragment thereof, comprising a heavy chain variable region and a light chain variable region, wherein the heavy chain variable region and the light chain variable region are selected from the group consisting of:
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 8, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 9;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 18, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 19;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 28, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 29;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 35, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 29;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 43, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 44;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 52, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 53;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 62, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 63;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 72, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 73;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 81, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 81;
- a heavy chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 88, and a light chain variable region comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 89; and
- the presently disclosed subject matter provides an anti-CD33 antibody or an antigen-binding fragment thereof, comprising a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 28, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 52, SEQ ID NO: 62, SEQ ID NO: 72, SEQ ID NO: 81, or SEQ ID NO: 88.
- SEQ ID NO: 8 amino acid sequence set forth in SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 28, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 52, SEQ ID NO: 62, SEQ ID NO: 72, SEQ ID NO: 81, or SEQ ID NO: 88.
- the presently disclosed subject matter provides an anti-CD33 antibody or an antigen-binding fragment thereof, comprising a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 63, SEQ ID NO: 73, SEQ ID NO: 82, SEQ ID NO: 89, or SEQ ID NO: 92.
- the presently disclosed subject matter provides an anti-CD33 antibody or an antigen-binding fragment thereof, comprising
- a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID SEQ ID NO: 8, SEQ ID NO: 18, SEQ ID NO: 28, SEQ ID NO: 35, SEQ ID NO: 43, SEQ ID NO: 52, SEQ ID NO: 62, SEQ ID NO: 72, SEQ ID NO: 81, or SEQ ID NO: 88;
- a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 9, SEQ ID NO: 19, SEQ ID NO: 29, SEQ ID NO: 44, SEQ ID NO: 53, SEQ ID NO: 63, SEQ ID NO: 73, SEQ ID NO: 82, SEQ ID NO: 89, or SEQ ID NO: 92.
- A8 The foregoing antibody or antigen-binding fragment thereof of any one of A1-A7, wherein
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 8
- the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 9;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 18, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 19;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 28, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 29;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 35, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 29;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 43, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 44;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 52, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 53;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 62, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 63;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 72, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 73;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 81, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 82;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 88, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 89; or
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 98
- the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 92.
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 8
- the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 9;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 18, and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 19;
- the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 28 and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 29.
- the presently disclosed subject matter provides an anti-CD33 antibody or an antigen-binding fragment thereof, comprising a heavy chain variable region that comprises CDR1, CDR2, and CDR3 domains; and a light chain variable region that comprises CDR1, CDR2, and CDR3 domains, wherein the heavy chain variable region and light chain variable region CDR3 domains are selected from the group consisting of:
- A12 The foregoing antibody or antigen-binding fragment thereof of A10 or Al l, wherein the heavy chain variable region and light chain variable region CDR1 domains are selected from the group consisting of:
- A14 The foregoing antibody or antigen-binding fragment thereof of any one of A10- A13, wherein one or more of the CDR sequences have up to about 3 amino acid substitutions.
- an anti-CD33 antibody or an antigen-binding fragment thereof comprising:
- a heavy chain variable region CDR1 comprising a comprising the amino acid sequence set forth in SEQ ID NO: 2, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 12, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 13, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 14;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 22, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 23, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 24;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 32, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 33, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 34;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 37, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 47, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 56, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO:57, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 58;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 66, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 67, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 68;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 76, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 77; or
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 85, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 86, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 87.
- an anti-CD33 antibody or an antigen-binding fragment thereof comprising:
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 59, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 60, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 61;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 69, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 70, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 71;
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 78, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 79, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 80; or
- a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42.
- an anti-CD33 antibody or an antigen-binding fragment thereof comprising:
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 6, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 7;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 12, a CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 14; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 15, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 16, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 17;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 22, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 23, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 24; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27; (d) a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 32, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 33, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 34; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25, a CDR2 comprising
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 37, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 39; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 40, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 47, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 38, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 48; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 49, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 50, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 51;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 56, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 58; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 59, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 60, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 61;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 66, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 67, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 68; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 69, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 70, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 71;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 76, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 57, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 77; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 78, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 79, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 80; or
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 85, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 86, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 87; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 41, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 42.
- A18 The foregoing antibody or antigen-binding fragment thereof of A17, wherein:
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 2, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 3, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 4; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 5, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 6, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 7;
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 12, a CDR2 comprising an amino acid sequence set forth in SEQ ID NO: 13, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 14; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 15, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 16, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 17; or
- a heavy chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 22, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 23, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 24; and a light chain variable region comprising a CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 25, a CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 26, and a CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 27.
- Al 9 The foregoing antibody or antigen-binding fragment thereof of any one of Al -Al 8, wherein the antibody comprises a comprises a heavy chain constant region and/or a light chain constant region.
- the heavy chain constant region comprises an amino acid sequence that is about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 95; and/or
- the light chain constant region comprises an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 96.
- the heavy chain constant region comprises the amino acid sequence set forth in SEQ ID NO: 95;
- the light chain constant region comprises the amino acid sequence set forth in SEQ ID NO: 96 or SEQ ID NO: 99.
- A22 The foregoing antibody or antigen-binding fragment thereof of any one of A1-A21, wherein the antibody or an antigen-binding fragment thereof comprises:
- a heavy chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 97, SEQ ID NO: 100, or SEQ ID NO: 102; and/or
- a light chain comprising an amino acid sequence that is at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, at least about 100% homologous or identical to the amino acid sequence set forth in SEQ ID NO: 98, SEQ ID NO: 101, or SEQ ID NO: 103.
- A23 The foregoing antibody or antigen-binding fragment thereof of any one of A 1 -A21 , wherein the antibody or an antigen-binding fragment thereof comprises:
- A24 The foregoing antibody or antigen-binding fragment thereof of any one of A1-A23, wherein the antibody or antigen-binding fragment thereof binds to a CD33 comprising the amino acid sequence set forth in SEQ ID NO: 215 or a fragment thereof.
- A25 The foregoing antibody or antigen-binding fragment thereof of any one of A 1 -A24, wherein the antibody comprises a human variable region framework region.
- A26 The foregoing antibody or antigen-binding fragment thereof of any one of A1-A25, which is a fully human or an antigen-binding fragment thereof.
- A27 The foregoing antibody or antigen-binding fragment thereof of any one of A1-A24, which is a chimeric antibody or an antigen-binding fragment thereof.
- A28 The foregoing antibody or antigen-binding fragment thereof of any one of A 1 -A24, which is a humanized antibody or an antigen-binding fragment thereof.
- A29 The foregoing antibody or antigen-binding fragment thereof of any one of A1-A28, wherein the antigen-binding fragment is a Fab, Fab', F(ab')2, variable fragment (Fv), or single chain variable region (scFv).
- A30 The foregoing antibody or antigen-binding fragment thereof of A29, wherein the antigen antigen-binding fragment is an scFv.
- the presently disclosed subject matter provides an antibody or an antigen-binding fragment thereof, which cross-competes for binding to CD33 with an antibody or an antigen-binding fragment thereof of any one of A1-A30.
- the presently disclosed subject matter provides an antibody or an antigen-binding fragment thereof, which binds to the same epitope region on CD33 with an antibody or an antigen-binding fragment thereof of any one of claims Al- A30.
- the presently disclosed subject matter provides a composition comprising the antibody or antigen-binding fragment thereof of any one of Al- A32.
- composition of B 1 which is a pharmaceutical composition that further comprises a pharmaceutically acceptable carrier.
- the presently disclosed subject matter provides an immunoconjugate comprising the antibody or antigen-binding fragment thereof of any one of A1-A32, linked to a therapeutic agent.
- the presently disclosed subject matter provides a composition comprising the immunoconjugate of Cl or C2.
- composition of DI which is a pharmaceutical composition that further comprises a pharmaceutically acceptable carrier.
- the presently disclosed subject matter provides a multi-specific molecule comprising the antibody or antigen-binding fragment thereof of any one of A1-A32, linked to one or more functional moi eties.
- E2 The foregoing multi-specific molecule of E2, wherein the one or more functional moi eties have a different binding specificity than the antibody or antigen binding fragment thereof.
- Fl. the presently disclosed subject matter provides a composition comprising the multi-specific molecule of El or E2.
- composition of Fl which is a pharmaceutical composition that further comprises a pharmaceutically acceptable carrier.
- the presently disclosed subject matter provides a nucleic acid that encodes an antibody or antigen-binding fragment thereof of any one of Al- A32.
- the presently disclosed subject matter provides a nucleic acid that encodes a heavy chain variable region of an antibody or antigen-binding fragment thereof of any one of A1-A32.
- nucleic acid of G2 comprising a nucleotide sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the nucleotide sequence set forth in SEQ ID NO: 10, SEQ ID NO: 20, SEQ ID NO: 30, SEQ ID NO: 36, SEQ ID NO: 45, SEQ ID NO: 54, SEQ ID NO: 64, SEQ ID NO: 74, SEQ ID NO: 83, SEQ ID NO: 90, or SEQ ID NO: 93.
- nucleic acid of G2 or G3 comprising the nucleotide sequence set forth in SEQ ID NO: 10, SEQ ID NO: 20, SEQ ID NO: 30, SEQ ID NO: 36, SEQ ID NO: 45, SEQ ID NO: 54, SEQ ID NO: 64, SEQ ID NO: 74, SEQ ID NO: 83, SEQ ID NO: 90, or SEQ ID NO: 93.
- the presently disclosed subject matter provides a nucleic acid that encodes a light chain variable region of an antibody or antigen-binding fragment thereof of any one of A1-A32.
- G6 The foregoing nucleic acid of G5, comprising a nucleotide sequence that is at least about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous or identical to the nucleotide sequence set forth in SEQ ID NO: 11, SEQ ID NO: 21, SEQ ID NO: 31, SEQ ID NO: 46, SEQ ID NO: 55, SEQ ID NO: 65, SEQ ID NO: 75, SEQ ID NO: 84, SEQ ID NO: 91, or SEQ ID NO: 94.
- G7 The foregoing nucleic acid of G6 or G7, comprising the nucleotide sequence set forth in SEQ ID NO: 11, SEQ ID NO: 21, SEQ ID NO: 31, SEQ ID NO: 46, SEQ ID NO: 55, SEQ ID NO: 65, SEQ ID NO: 75, SEQ ID NO: 84, SEQ ID NO: 91, or SEQ ID NO: 94.
- the presently disclosed subject matter provides a vector comprising the nucleic acid of any one of G1-G7. JI. In certain non-limiting embodiments, the presently disclosed subject matter provides a host cell comprising the vector of Hl.
- the presently disclosed subject matter provides a method for detecting CD33 in a whole cell, a tissue, or a blood sample, comprising: contacting a cell, tissue or blood sample with the antibody or antigen-binding fragment thereof of any one of A1-A32, wherein the antibody or antigen-binding fragment thereof comprises a detectable label; and determining the amount of the labeled antibody or antigen-binding fragment thereof bound to the cell, tissue or blood sample by measuring the amount of detectable label associated with said cell or tissue, wherein the amount of bound antibody or antigen-binding fragment thereof indicates the amount of CD33 in the cell, tissue or blood sample.
- the presently disclosed subject matter provides a method of treating or ameliorating a disease or disorder associated with CD33 in a subject, comprising administering to the subject the antibody or antigen-binding fragment thereof of any one of A1-A32, the immunoconjugate of Cl or C2, the multi-specific molecule of El or E2, or the composition of any one of Bl, B2, DI, D2, Fl, and F2.
- the presently disclosed subject matter provides a method of reducing tumor burden in a subject, comprising administering to the subject an antibody or antigen-binding fragment thereof of any one of A1-A32, the immunoconjugate of Cl or C2, the multi-specific molecule of El or E2, or the composition of any one of Bl, B2, DI, D2, Fl, and F2.
- L4 The foregoing method of L3, wherein the method reduces the number of the tumor cells, reduces the tumor size, and/or eradicates the tumor in the subject.
- the presently disclosed subject matter provides a method of treating and/or preventing a tumor in a subject, comprising administering to the subject an antibody or antigen-binding fragment thereof of any one of A1-A32, the immunoconjugate of C 1 or C2, the multi-specific molecule of El or E2, or the composition of any one of Bl, B2, DI, D2, Fl, and F2.
- the presently disclosed subject matter provides a method of increasing or lengthening survival of a subject having a tumor, comprising administering to the subject an antibody or antigen-binding fragment thereof of any one of Al- A32, the immunoconjugate of Cl or C2, the multi-specific molecule of El or E2, or the composition of any one of Bl, B2, DI, D2, Fl, and F2. L7.
- LIO myeloid leukemia
- MDS myelodysplastic syndromes
- ALL acute lymphoblastic leukemia
- CLL chronic lymphocytic leukemia
- MPNs myeloproliferative neoplasms
- chronic myeloid neoplasms AML
- AML acute myeloid leukemia
- MDS myelodysplastic syndromes
- ALL acute lymphoblastic leukemia
- CLL chronic lymphocytic leukemia
- MPNs myeloproliferative neoplasms
- chronic myeloid neoplasms chronic myeloid neoplasms
- the presently disclosed subject matter provides a kit for treating or ameliorating a disease or disorder in a subject, reducing tumor burden in a subject, treating and/or preventing a tumor in a subject, and/or increasing or lengthening survival of a subject having a tumor, comprising the antibody or antigen-binding fragment thereof of any one of A1-A32, the immunoconjugate of Cl or C2, the multi-specific molecule of El or E2, or the composition of any one of Bl, B2, DI, D2, Fl, and F2.
- kit of claim 65 wherein the kit further comprises written instructions for using the antibody or antigen-binding fragment thereof, immunoconjugate, multi-specific molecule, or composition for treating or ameliorating a disease or disorder in a subject, treating or ameliorating a disease or disorder in a subject, reducing tumor burden in a subject, treating and/or preventing a tumor in a subject, and/or increasing or lengthening survival of a subject having a tumor.
- Example 1 Generation of the Presently Disclosed Anti-CD33 antibodies and scFvs
- Antibody generation was carried out by immunizing AlivaMab® mice (Ablexis) with CD33 coding plasmid DNA and recombinant proteins either sourced commercially or produced in-house. Hybridoma were generated by electrofusion, and the supernatants were screened by enzyme-linked immunosorbent assay (ELISA) on recombinant proteins as well as by flow cytometry on cells overexpressing CD33 and AML cell lines with endogenous CD33 expression. After completion of subcloning and sequencing, 7 unique monoclonal antibodies (mAbs) were identified. Two antibodies bound to the IgC2 domain, and 5 to the IgV domain. Chimeric antigen receptors (CARs) were generated using variable Heavy (VH) and variable Light (VL) chain sequences formatted into single chain fragment variable (scFvs) domains as building blocks.
- VH variable Heavy
- VL variable Light
- the 3 -Pl 4 and 4-B2 antibodies were selected as the front-runner lead candidates based on the following biological and functional properties:
- human CD33 protein was sourced commercially from R&D Systems and Aero Biosystems. Mouse and cynomolgus monkey CD33 proteins were purchased from Sino Biological.
- the human CD33 IgC2 type domain (residue 140-259) with a terminal mouse IgGl Fc or 6xHis-tag, was produced at LakePharma.
- DNA coding for human CD33 IgC2 extracellular domain or IgC2 followed by the CD33 transmembrane segment was cloned into vector for DNA immunizations. All proteins and DNA reagents were subjected to rigorous quality control prior to use for antibody generation, screening and characterization. Multiple cohorts of AlivaMab® mice were immunized with recombinant proteins or plasmid DNA coding for the CD33 IgC2 type domain as shown in Table 13. The immunization approach for cohorts 2 and 3 aimed at developing cross-reactive antibodies, whereas the strategy for cohorts 4-6 was designed to generate membrane-proximal domain antibodies. Complete Freund’s Adjuvant (CFA) was used for the prime injection, followed by 8- 12 boosts in TiterMax or RIBI over the course of 28-34 days. Proteins were administered via the hock route, while DNA was injected into the tail vein.
- CFA Complete Freund’s Adjuvant
- AMM K/X AlivaMab® mice with kappa and lambda human light chains: hu: human; mo: mouse; cyno: cynomolgus.
- Serum was collected on days 17, 24, 28 and 31, and the immune response was analyzed by ELISA using recombinant human CD33 ECD-6xHis and CD33 IgC2-6xHis proteins. Mice from cohorts 1, 2 and 4 developed midpoint titers greater than 1 : 10,000 and were selected for the final boost, hybridoma generation and screening.
- lymph nodes were collected and pooled for each cohort, followed by isolation of IgG-producing B cells by magnetic sorting.
- the enriched B cells were electrofused with mouse myeloma cells to generate hybridoma, which were plated for screening.
- Hybridoma screening Hybridoma supernatants were analyzed by screening. Binding to human CD33 (full ECD and IgC2), cynomolgus monkey and mouse CD33 was analyzed by ELISA. Tertiary screening was carried out by flow cytometry utilizing cells stably overexpressing human CD33 (NTH-3 T3 full-length and IgC2 domain only) and AML cell lines that endogenously express CD33 (U937). NALM6 cells, which are CD33 negative, were used to test for non-specific binding.
- the primary screen by ELISA using soluble, His-tagged human CD33 resulted in 96 hits.
- 31 supernatants gave a signal above background on these cells, with 5 clones targeting the IgC2 domain. Binding was tested on the AML cell lines U937 and Set2. All 31 clones were confirmed on these AML lines.
- Table 14 Binding of selected parental clones to recombinant proteins 2 .
- RLU Relative light unit
- Table 15 Binding of selected parental hybridoma supernatants to CD33 + and CD33" cells 3 .
- MFI Mean fluorescence intensity
- One subclone from each parental antibody was selected and purified from a 30-ml hybridoma supernatant culture using Protein G or Protein A depending on the murine IgG isotype subclass.
- the purified antibodies were characterized by FACS and ELISA as follows:
- TCP target candidate profile
- 3P14 and 4B2 in VH-VL SCFV orientation designated as “TDI-Y-006” and “TDI-Y-007”, respectively
- 1 J19 were selected.
- the targets were tested in a series of in vitro binding and functional assays.
- the antibodies were produced recombinantly with a human IgGl constant region.
- Antibody Hl 95 (lintuzumab) was included as a reference for comparison.
- TDI-Y-006 and TDI-Y-007 bound to a NIH-3T3 cell line overexpressing CD33 with EC50 of 6.54 nM and 17 nM, respectively.
- TDI-Y-006 and TDI-Y-007 bound to U937 cells, a human AML cell line that endogenously expresses CD33 with EC50 values of 8.5 nM and 45 nM, respectively.
- Binding to Recombinant CD33 Protein was carried out by ELISA using human CD33-His (full-length or IgC2 domain), cynomolgus monkey CD33-His and mouse CD33-His. Recombinant proteins at 5 pg/mL were captured by pre-blocked Ni-NTA plates.
- Candidate antibodies were added at 10 p g/mL in triplicate and detected using horseradish peroxidase (HRP)-conjugated anti-human Fc antibody. As shown in Figure 3, TDI-Y-006 and TDI-Y-007 bound to both human CD33 ECD and IgC2 domain protein.
- the binding affinity to human CD33 protein was measured by biolayer interferometry (BLI) using an Octet Red96e. All experiments were carried out using kinetic buffer (PBS pH 7.4, 0.01% BSA, 0.002% Tween-20). The antibodies were captured by an anti-huFc biosensor and a 7-point, 2-fold dilution series of huCD33-His was used as analyte. The data was processed by double reference subtraction, and response curves were globally fit to a 1 : 1 Langmuir binding model. The results are shown in Table 17 below.
- TDI-Y-006, TDI-Y-007, and 1J19 had dissociation constants (KD) of 1-2 nM, with slight variations in on-rate and off-rate.
- KD dissociation constants
- the binding affinities are similar to the Hl 95 reference antibody.
- Table 17 Binding kinetics of TDI-Y-006, TDI-Y-007 and 1 JI 9 to CD33 in solution.
- the binding affinity to cynomolgus monkey CD33 was also measured by BLI using an Octet Red96e as described above. None of the antibodies, including Hl 95, showed binding to cynomolgus monkey CD33 at 500 nM concentration.
- AlexaFluor 647-conjugated goat anti-human F(ab’)2 was added to cells for 30 minutes on ice, washed and analyzed by flow cytometry, normalized to secondary only staining (MFI ratio). EC50 values were determined by non-linear regression.
- TDI-Y-006 bound to 3T3-CD33 overexpressing and U937 cells with EC50 values of 5 and 8.5 nM, respectively.
- TDI-Y-007 bound 3T3-CD33 and U937 cells with EC50 values of 17 and 45 nM, respectively.
- 1 J19 andH195 bound 3T3-CD33 and U937 cells with EC50 values in the singledigit nM range ( Figures 4A and 4B; and Table 18). No binding was observed with NALM6 (CD33 negative) or U937CD33KO at 666 nM (data not shown).
- Table 18 EC50 of tested antibodies on overexpressing (3T3) and AML line (U937)
- TDI-Y-007 A 40-fold difference between KD in solution and EC50 on cells was observed for TDI-Y- 007.
- the epitope for this antibody may be close to the cell membrane and thus less accessible on cells than to a soluble protein.
- the epitope of TDI-Y-006, which has KD and EC50 values within 5-to 7-fold and was distinct from TDI-Y-007 (see below), may be located in a part of the IgC2 domain that is equally accessible in both recombinant protein as well as on cell surface.
- Epitope Binning Epitope Binning was carried out by a BLI competition experiment using an Octet Red96e. Human CD33-His was captured by an anti-penta-His biosensor. A 4x4 matrix with TDI-Y-006, TDI-Y-007, 1 J19 and H195 was tested. A reference biosensor was used to determine the overall capture level for each antibody. After pre-binding the antibodies at saturation levels, the biosensors were dipped into antibody solutions to assess competition. The data is shown in Table 19. When TDI-Y-007 was pre-bound, TDI-Y-006 still showed significant capture. However, when TDI-Y-006 was pre-bound, binding of TDI-Y-007 was blocked.
- TDI-Y-006 and TDI-Y-007 have epitopes that are in close proximity or may be partially overlapping but are not identical.
- 1 J19 and H195 have epitopes that partially overlap.
- No competition was observed between antibodies binding to the membrane-proximal IgC2 domain (TDI-Y-006 and TDI-Y-007) and antibodies binding to the membrane-distal IgV domain (1 JI 9 and H195).
- Table 19 Epitope Binning of CD33 lead mAbs 4 .
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Hematology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Microbiology (AREA)
- Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3228414A CA3228414A1 (en) | 2021-09-02 | 2022-09-02 | Anti-cd33 antibodies and uses thereof |
| CN202280069909.5A CN118234750A (zh) | 2021-09-02 | 2022-09-02 | 抗cd33抗体和其用途 |
| EP22865602.1A EP4396235A4 (en) | 2021-09-02 | 2022-09-02 | ANTI-CD33 ANTIBODIES AND THEIR USES |
| AU2022340645A AU2022340645A1 (en) | 2021-09-02 | 2022-09-02 | Anti-cd33 antibodies and uses thereof |
| JP2024513937A JP2024533162A (ja) | 2021-09-02 | 2022-09-02 | 抗cd33抗体及びその使用 |
| US18/592,427 US20240262910A1 (en) | 2021-09-02 | 2024-02-29 | Anti-cd33 antibodies and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163240220P | 2021-09-02 | 2021-09-02 | |
| US63/240,220 | 2021-09-02 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US18/592,427 Continuation US20240262910A1 (en) | 2021-09-02 | 2024-02-29 | Anti-cd33 antibodies and uses thereof |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2023034564A2 true WO2023034564A2 (en) | 2023-03-09 |
| WO2023034564A3 WO2023034564A3 (en) | 2023-04-06 |
Family
ID=85412855
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/042448 Ceased WO2023034564A2 (en) | 2021-09-02 | 2022-09-02 | Anti-cd33 antibodies and uses thereof |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20240262910A1 (https=) |
| EP (1) | EP4396235A4 (https=) |
| JP (1) | JP2024533162A (https=) |
| CN (1) | CN118234750A (https=) |
| AU (1) | AU2022340645A1 (https=) |
| CA (1) | CA3228414A1 (https=) |
| WO (1) | WO2023034564A2 (https=) |
Family Cites Families (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2008535823A (ja) * | 2005-03-25 | 2008-09-04 | キュラジェン コーポレイション | テネイシンの主要な抗原に対する抗体 |
| DK2356270T3 (da) * | 2008-11-07 | 2016-12-12 | Fabrus Llc | Kombinatoriske antistofbiblioteker og anvendelser deraf |
| JO3246B1 (ar) * | 2009-09-09 | 2018-03-08 | Regeneron Pharma | اجسام مضادة بشرية ذات ألفة تفاعل عالية مع مستقبل 2 المفعل بالبروتين البشري |
| JP6488520B2 (ja) * | 2013-08-20 | 2019-03-27 | 国立研究開発法人科学技術振興機構 | ヒト抗体κ型軽鎖複合体含有組成物及びその製造方法 |
| TWI702229B (zh) * | 2014-12-19 | 2020-08-21 | 美商再生元醫藥公司 | 流行性感冒病毒血球凝集素之人類抗體 |
| AU2017252233A1 (en) * | 2016-04-22 | 2018-11-15 | Alligator Bioscience Ab | Novel bispecific polypeptides against CD137 |
| JOP20190116A1 (ar) * | 2018-05-24 | 2019-11-24 | Janssen Biotech Inc | الأجسام المضادة لتكتل التمايز 33 (cd33)، والأجسام المضادة ثنائية النوعية لتكتل التمايز 33 (cd33)/تكتل التمايز 3 (cd3) واستخداماتها |
| JP7303314B2 (ja) * | 2019-01-18 | 2023-07-04 | ヤンセン バイオテツク,インコーポレーテツド | Gprc5dキメラ抗原受容体及びそれを発現する細胞 |
-
2022
- 2022-09-02 AU AU2022340645A patent/AU2022340645A1/en active Pending
- 2022-09-02 CA CA3228414A patent/CA3228414A1/en active Pending
- 2022-09-02 EP EP22865602.1A patent/EP4396235A4/en active Pending
- 2022-09-02 JP JP2024513937A patent/JP2024533162A/ja active Pending
- 2022-09-02 CN CN202280069909.5A patent/CN118234750A/zh active Pending
- 2022-09-02 WO PCT/US2022/042448 patent/WO2023034564A2/en not_active Ceased
-
2024
- 2024-02-29 US US18/592,427 patent/US20240262910A1/en active Pending
Also Published As
| Publication number | Publication date |
|---|---|
| WO2023034564A3 (en) | 2023-04-06 |
| AU2022340645A1 (en) | 2024-02-29 |
| CN118234750A (zh) | 2024-06-21 |
| US20240262910A1 (en) | 2024-08-08 |
| EP4396235A2 (en) | 2024-07-10 |
| EP4396235A4 (en) | 2025-07-02 |
| JP2024533162A (ja) | 2024-09-12 |
| CA3228414A1 (en) | 2023-03-09 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2020203132B2 (en) | Humanized and chimeric monoclonal antibodies to CD47 | |
| JP6959390B2 (ja) | B細胞成熟化抗原を標的化する抗体および使用の方法 | |
| CN107206077B (zh) | 靶向g-蛋白偶联受体的抗体和使用方法 | |
| CN109071654B (zh) | 靶向Fc受体样5的抗体及使用方法 | |
| US10040862B2 (en) | Humanized and chimeric monoclonal antibodies to CD99 | |
| CN114641503B (zh) | 抗cd371抗体及其用途 | |
| US20240262910A1 (en) | Anti-cd33 antibodies and uses thereof | |
| CN119505001B (zh) | 靶向cd22的全人源抗体及其应用 | |
| US20250340636A1 (en) | Antibodies targeting l1cam and uses thereof | |
| WO2025255296A1 (en) | Antibodies targeting mesothelin and uses thereof | |
| HK40002168B (en) | Antibodies targeting fc receptor-like 5 and methods of use | |
| BR122021001159B1 (pt) | Anticorpo do receptor acoplado à anti-proteína g família c grupo 5 membro d (gprc5d) ou fragmento de ligação ao antígeno do mesmo, seu uso, composições, imunoconjugado, molécula biespecífica, molécula de ácido nucleico, vetor de expressão, método para detecção de gprc5d em uma célula inteira ou tecido e kit para tratar um tumor |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22865602 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3228414 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2022340645 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2022340645 Country of ref document: AU Date of ref document: 20220902 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024513937 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022865602 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022865602 Country of ref document: EP Effective date: 20240402 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280069909.5 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22865602 Country of ref document: EP Kind code of ref document: A2 |