WO2022256933A1 - Method and compositions for neuronal reprogramming - Google Patents

Method and compositions for neuronal reprogramming Download PDF

Info

Publication number
WO2022256933A1
WO2022256933A1 PCT/CA2022/050923 CA2022050923W WO2022256933A1 WO 2022256933 A1 WO2022256933 A1 WO 2022256933A1 CA 2022050923 W CA2022050923 W CA 2022050923W WO 2022256933 A1 WO2022256933 A1 WO 2022256933A1
Authority
WO
WIPO (PCT)
Prior art keywords
transcription factor
ascl1
mutant
bhlh
vector
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/CA2022/050923
Other languages
English (en)
French (fr)
Inventor
Carol SCHUURMANS
Joanne Mclaurin
Cindy MORSHEAD
Eunjee PARK
Tarlan KEHTARI
Lakshmy VASAN
Maryam FAIZ
Tom ENBAR
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Toronto
Sunnybrook Research Institute
Original Assignee
University of Toronto
Sunnybrook Research Institute
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Toronto, Sunnybrook Research Institute filed Critical University of Toronto
Priority to KR1020247000754A priority Critical patent/KR20240032021A/ko
Priority to CA3222129A priority patent/CA3222129A1/en
Priority to JP2023575711A priority patent/JP2024521401A/ja
Priority to IL309190A priority patent/IL309190A/en
Priority to AU2022288230A priority patent/AU2022288230A1/en
Priority to CN202280051836.7A priority patent/CN117881692A/zh
Priority to BR112023025888A priority patent/BR112023025888A2/pt
Priority to US18/568,747 priority patent/US20250282837A1/en
Priority to MX2023014769A priority patent/MX2023014769A/es
Priority to EP22819038.5A priority patent/EP4352085A4/en
Publication of WO2022256933A1 publication Critical patent/WO2022256933A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4705Regulators; Modulating activity stimulating, promoting or activating activity
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/1703Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • A61K38/1709Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • A61K48/0058Nucleic acids adapted for tissue specific expression, e.g. having tissue specific promoters as part of a contruct
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00Vector systems having a special element relevant for transcription
    • C12N2830/008Vector systems having a special element relevant for transcription cell type or tissue specific enhancer/promoter combination

Definitions

  • the vertebrate central nervous system is comprised of a diverse array of neuronal and macroglial (astrocytes and oligodendrocytes) cell types that make up and connect functional brain regions in a complex manner to allow for higher order cognitive functioning and motor and sensory processing.
  • the basic ⁇ helix ⁇ loop ⁇ helix (bHLH) family of transcription factors are essential regulators of neural cell fate specification and differentiation during embryonic development.
  • proneural and neuronal differentiation bHLH genes promote neuronal differentiation in the embryonic brain, and in some cellular contexts can also induce oligodendrocyte fate specification.
  • Neural ⁇ specific bHLH genes with proneural activity include Neurog1, Neurog2, Ascl1, Neurod4, Atoh1 and Atoh7. These bHLH genes act in transcriptional cascades, turning on other bHLH genes, which function at later developmental stages to control neuronal differentiation. In particular, several bHLH genes are expressed and function later in the development of neural lineages; either in committed neuronal/glial precursors or in post mitotic neuronal and glial cells.
  • bHLH genes that play important roles in neuronal and glial differentiation and maturation, including members of the NeuroD (Neurod1, Neurod2/Ndrf, Neurod6/Math2), Nscl (Nhlh1/Nscl1, Nhlh2/Nscl2), and Olig (Olig1, Olig2, Olig3, Bhlhe22) families.
  • NeuroD Neurod2/Ndrf, Neurod6/Math2
  • Nscl Nhlh1/Nscl1, Nhlh2/Nscl2
  • Olig Olig1, Olig2, Olig3, Bhlhe22
  • bHLH genes are not active in all cellular contexts, and can be inhibited by environmental signals.
  • Recently bHLH neuronal differentiation (Neurod1) and proneural (Neurog2, Ascl1) genes have been used to promote the conversion of astrocytes to neurons in vitro and in vivo.
  • An object of the present application is to provide compositions and methods of use thereof in neuronal reprogramming for the treatment or prevention of a neurodegenerative disease or disorder, or for the treatment of neurological (e.g., brain) injury.
  • mutant basic ⁇ helix ⁇ loop ⁇ helix (bHLH) transcription factor wherein the mutant bHLH transcription factor comprises a mutation of one or more phosphoacceptor sites for proline ⁇ directed serine ⁇ threonine kinases found in the corresponding wild ⁇ type bHLH transcription factor, and wherein the mutant bHLH transcription factor exhibits reduced inhibition of function from phosphorylation by proline ⁇ directed serine ⁇ threonine kinases than the corresponding wild ⁇ type bHLH transcription factor.
  • the mutant comprises a mutation of two or more, or three or more, or four or more, phosphoacceptor sites for proline ⁇ directed serine ⁇ threonine kinases found in the corresponding wild ⁇ type bHLH transcription factor.
  • all of the phosphoacceptor sites for proline ⁇ directed serine ⁇ threonine kinases found in the corresponding wild ⁇ type bHLH transcription factor are mutated.
  • an additional conserved serine or threonine residue in the conserved HLH domain that is a target of protein kinase A (PKA) phosphorylation, an evolutionarily conserved and inhibitory on ⁇ off switch is also mutated.
  • PKA protein kinase A
  • the mutant bHLH transcription factor is in an isolated and/or purified form that is, for example, suitable for administration to a subject.
  • each mutation of a phosphoacceptor site for proline ⁇ directed serine ⁇ threonine kinases and/or PKA comprises substitution of a serine or threonine within the phosphoacceptor site with another amino acid selected from the group consisting of alanine, glycine, valine, leucine, isoleucine, D ⁇ serine, D ⁇ threonine, D ⁇ alanine, D ⁇ glycine, D ⁇ valine, D ⁇ leucine and D ⁇ isoleucine.
  • the mutant bHLH transcription factor is a mutant of a proneural bHLH transcription factor selected from the group consisting of Neurog2, Ascl1, and Neurod4, which is, optionally, (a) at least 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO:1 or SEQ ID NO:2; (b) at least 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO:13 or SEQ ID NO:14; or (c) at least 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO:19 or SEQ ID NO:20.
  • mutant bHLH transcription factors are human ASCL1 ⁇ SA5, mouse Ascl1 ⁇ SA6, human ASCL1 ⁇ SA6 (optionally with additional PKA site mutation), mouse Ascl1 ⁇ SA7 (optionally with additional PKA site mutation), human NEUROD4 ⁇ SA4TA6, mouse Neurod4 ⁇ SA3TA4, human NEUROD4 ⁇ SA5TA6 (optionally with additional PKA site mutation), mouse Neurod4 ⁇ SA4TA4 (optionally with additional PKA site mutation), human NEUROG2 ⁇ SA8TA1, mouse Neurog2 ⁇ SA9, human NEUROG 2 ⁇ SA8TA2 (optionally with additional PKA site mutation), and mouse Neurog2 ⁇ SA9TA1 (optionally with additional PKA site mutation).
  • the mutant bHLH transcription factor is a mutant of a Neurod1 neuronal differentiation transcription factor, which is, optionally, at least 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO:7 or SEQ ID NO:8.
  • mutant bHLH transcription factors are human NEUROD1 ⁇ SA6, mouse Neurod1 ⁇ SA6, human NEUROD1 ⁇ SA7 (optionally with additional PKA site mutation), and mouse Neurod1 ⁇ SA7 (optionally with additional PKA site mutation).
  • nucleic acids that encode a mutant bHLH transcription factor as described herein, which can be operably associated with one or more regulatory elements.
  • the nucleic acid can be in a viral (e.g., an AAV, lentiviral or retroviral vector) or non ⁇ viral vector.
  • a pharmaceutical composition comprising the mutant bHLH transcription factor as described herein or the nucleic acid encoding the mutant bHLH transcription factor, and a pharmaceutically acceptable carrier or excipient.
  • the composition is optionally formulated for direct intracranial administration, intracranial injection, intracerebroventricular injection, intracisternal injection, intrathecal injection, intravenous injection, intraperitoneal injection, delivery via nanoparticles, delivery via extracellular vesicles, and/or administration using focused ultrasound.
  • mutant bHLH transcription factor as described herein or the nucleic acid encoding the mutant bHLH transcription factor for neuronal transformation of glial cells in a subject in need thereof can be for prevention or treatment of a neurodegenerative disease or disorder, or for treatment of a brain injury, such as stroke, in the subject.
  • a method for neuronal transformation of glial cells in a subject comprising administering to the subject the mutant bHLH transcription factor as described herein or the nucleic acid encoding the mutant bHLH transcription factor or the pharmaceutical composition containing the mutant bHLH transcription factor or the encoding nucleic acid.
  • This method is useful for preventing or treating a neurodegenerative disease or disorder or for treating of a CNS injury, such as a brain injury, in the subject.
  • the neurodegenerative disease or disorder is selected from the group consisting of amyotrophic lateral sclerosis (ALS), Alzheimer's disease (AD), Parkinson's disease (PD), down's syndrome, dementia pugilistica, multiple system atrophy, frontal temporal dementia, progressive supranuclear palsy, prion diseases, Huntington's disease, motor neuron diseases and Lewy body diseases.
  • ALS amyotrophic lateral sclerosis
  • AD Alzheimer's disease
  • PD Parkinson's disease
  • down's syndrome dementia pugilistica
  • multiple system atrophy dementia
  • frontal temporal dementia progressive supranuclear palsy
  • prion diseases Huntington's disease
  • a ZBTB18 transcription factor or a nucleic acid encoding the ZBTB18 transcription factor for neuronal transformation of glial cells in a subject in need thereof.
  • the ZBTB18 transcription factor has an amino acid sequence that is at least 80%, 85%, 90%, 95%, or 97% identical to one of SEQ ID NOs:36, 38, 40, 42, 44, 46, 48, 50, 52 or 54.
  • a method for neuronal transformation of glial cells in a subject comprising administering to the subject a ZBTB18 transcription factor or a nucleic acid encoding the ZBTB18 transcription factor.
  • a vector comprising a nucleic acid encoding a ZBTB18 transcription factor comprising an amino acid sequence that is at least 80%, 85%, 90%, 95%, or 97% identical to one of SEQ ID NOs:36, 38, 40, 42, 44, 46, 48, 50, 52 or 54, wherein the vector is a non ⁇ viral vector or a viral vector.
  • a pharmaceutical composition comprising the ZBTB18 transcription factor as described herein or the nucleic acid encoding the ZBTB18 transcription factor, and a pharmaceutically acceptable carrier or excipient.
  • composition is optionally formulated for direct intracranial administration, intracranial injection, intracerebroventricular injection, intracisternal injection, intrathecal injection, intravenous injection, intraperitoneal injection, delivery via nanoparticles, delivery via extracellular vesicles, and/or administration using focused ultrasound.
  • Figure 1 Images (A) of brain sections from mice treated with Ascl1 ⁇ t2a ⁇ iCre and Ascl1 ⁇ SA6 ⁇ t2a ⁇ iCre vectors immunostained with tdtomato and NeuN antibodies and quantified (B) to show expression of Ascl1 ⁇ SA6 was more efficient than Ascl1 at promoting conversion of cortical astrocytes to neurons (bars represent mean+/ ⁇ SEM.
  • FIG. 1 Immunostaining and quantified expression results from stereotactic injections of AAV5 ⁇ GFAP ⁇ iCre (control) and AAV5 ⁇ GFAP ⁇ Ascl1 ⁇ SA6 ⁇ t2a ⁇ iCre into 16 weeks old hSOD G93A transgenic ALS mice, demonstrating efficient induction of neuronal lineage conversion by Ascl1 ⁇ SA6 expression (bars represent mean+/ ⁇ SEM. p ⁇ values: ns ⁇ not significant, ⁇ 0.05 *, ⁇ 0.01 **, ⁇ 0.001 ***).
  • Figure 4 Graphical representation of neuronal density measurements taken from mice following treatment with AAV5 ⁇ GFAP ⁇ iCre (control) and AAV5 ⁇ GFAP ⁇ Ascl1 ⁇ SA6 ⁇ t2a ⁇ iCre showing trend towards increased neuronal density in Ascl1 ⁇ SA6 vs control injected animals (bars represent mean+/ ⁇ SEM. p ⁇ values: ns ⁇ not significant, ⁇ 0.05 *, ⁇ 0.01 **, ⁇ 0.001 ***).
  • Figure 5 Graphical representation of neurological score (NS) measurements captured by ALSTDI ⁇ Neuroscore, demonstrating improved health (the score gets higher with disease progression) in longer surviving animals following treatment with Ascl1 ⁇ SA6 vs control injections (bars represent mean+/ ⁇ SEM. p ⁇ values: ns ⁇ not significant, ⁇ 0.05 *, ⁇ 0.01 **, ⁇ 0.001 ***).
  • FIG. 7 Characterization of A ⁇ plaques and tau hyperphosphorylation.
  • Figure 8 Qualitative analysis of NeuN immunohistochemical staining in the hippocampus of 12 ⁇ month old TgF344 AD rats and their nTg littermates, with no differences detected in the number of NeuN+ neurons or synaptic markers in TgF344 AD rats in comparison to nTg littermates.
  • Figure 9 GABAergic neuronal deficits in TgF344 AD rats. Analyses of the Western blot (Ai) showed an increase in GAD65/GAD2 (Aii) and no change in GAD67/GAD1 (Aiii) protein levels. In contrast, cell counts (Bi) demonstrated a loss of GAD67+ cells that expressed SST or NPY.
  • Figure 10 Analyses of the Western blot (Ai) demonstrated an increase in ⁇ 5 (Aiii) and ⁇ (Aiv) but not ⁇ 1 (Aii) GABA A receptor subunits when comparing TgF344 AD to nTg rats. Bars are mean ⁇ SEM. * p ⁇ 0.05.
  • Figure 11 Representative traces of raw (black) and filtered (theta in the lower end of the modulation index, high ⁇ gamma in higher end of the modulation index) recordings from the HPC in an nTg rat (A).
  • Figure 12 AAV2/8 ⁇ Ascl1 ⁇ mCherry transduction of 12 month old TgF344 AD rat hippocampus is illustrated by the colocalization of GFAP immunoreactivity (light grey) with mCherry expression (dark grey).
  • FIG. 13 Transdifferentiation of reactive astrocytes into neurons was confirmed by the presence of NeuN+mCherry+ cells without the presence of GFAP+mCherry+ cells within the hilus of the hippocampus.
  • Panel A is the control vector, AAV ⁇ mCherry, injected hemisphere while panel B is the AAV ⁇ Ascl1 ⁇ mCherry injected hemisphere, with panel C being a magnification of the AAV ⁇ Ascl1 ⁇ mCherry hemisphere.
  • Scale bars 250 ⁇ m (A&B), 100 ⁇ m (C).
  • Figure 14 The differentiation of new neurons into GABAergic interneurons was confirmed by the presence of GAD67+ mCherry+ neurons in the hilus of the hippocampus. Following intracranial stimulation in the hippocampus of Tg and nTg subjects (black arrow) nTg rat showed comparable responses between the mCherry transfected and the Ascl1 ⁇ mCherry transfected hippocampi (A). On the other hand, TgF344 AD rat showed larger responses in the Ascl1 ⁇ mCherry hippocampus than in the mCherry transfected (B). These results suggest improved neuronal network function after transduction of new neurons.
  • FIG. 15 Respective immunofluorescence images of GFAP+ cells in the hippocampal hilus (i: 10X, ii ⁇ vi: 20X).
  • Figure 18 Ascl1 ⁇ SA6 leads to a significant decrease in plaque coverage in the hippocampal hilus in vivo.
  • FIG. 1 Immunofluorescence images using anti ⁇ MOAB2 antibody in na ⁇ ve and treated TgF344 AD rats (20x).
  • Figure 19 Viral delivery of Ascl1 and Ascl1 ⁇ SA6 led to significant changes in plaque ⁇ associated microglia and mean plaque size in vivo.
  • A Immunofluorescence of IBA ⁇ 1+4G8+ cells in the hippocampal hilus (20x).
  • FIG. 20 Viral delivery of Ascl1 ⁇ SA6 leads to a decrease in activated and increase in ramified IBA ⁇ 1+ cells in vivo.
  • A Immunofluorescence of IBA+ cells in the hippocampal hilus (20x).
  • B High magnification of a (i) activated and (ii) ramified IBA ⁇ 1+ cells.
  • FIG. 21 Transient expression of Ascl1 ⁇ SA6 leads to a decrease in hypertrophic and increase in physiologic astrocytes in vivo.
  • A Immunofluorescence of GFAP+ cells in the hippocampal hilus (20x).
  • B High magnification of a (i) hypertrophic and (ii) physiologic astrocyte.
  • A Immunofluorescence of S100 ⁇ + cells in the hippocampal hilus (20x).
  • C In situ hybridization for C3 and immunofluorescence staining for S100 ⁇ in AD. Modified from Liddelow et al, Nature 541, 481 ⁇ 487 (2017).
  • FIG. 23 Direct lineage reprogramming leads to decreases in necrotic neurons in vivo.
  • A Immunofluorescence of ⁇ III ⁇ tubulin+ and RIPK1+ cells in na ⁇ ve and treated TgF344 AD rats (20x).
  • Figure 24 Direct lineage reprogramming leads to increased interneurons in vivo.
  • A Quantification of GAD67+ cells in na ⁇ ve and Ascl1 or Ascl1 ⁇ SA6 treated TgF344 AD rats.
  • Figure 25 Direct lineage reprogramming leads to improved cognitive function.
  • TgF344 AD rats learned the Barnes maze task significantly slower than TgF344 AD rats treated with Ascl1 ⁇ SA6 and NTg rats both treated and untreated.
  • TgF344 AD rats treated with Ascl1 ⁇ SA6 were not significantly different from NTg rats both treated and untreated.
  • Figure 26 Ascl1 ⁇ SA6 is more efficient at astrocyte to neuron reprogramming following stroke.
  • A Schematic of experimental paradigm. Mice received ET ⁇ 1 stroke (single) on day 0 and reprogramming (AAV ⁇ Cre; AAV ⁇ Ascl1; AAV ⁇ Ascl1 ⁇ SA6) and were sacrificed on PSD28 for tissue analysis.
  • TdTom+NeuN+/TdTom+ cells The percent reprogramming (TdTom+NeuN+/TdTom+ cells) reveals significantly greater astrocyte to neuron reprogramming in AAV ⁇ Ascl1 and AAV ⁇ Ascl1 ⁇ SA6 treated mice relative to controls (AAV ⁇ Cre). Ascl1 ⁇ SA6 treated mice had a greater percentage of reprogrammed neurons compared to AAV ⁇ Ascl1 treated mice.
  • C Representative images from stroke injured cortices of (i) AAV ⁇ Cre (ii) AAV ⁇ Ascl1 and (iii) AAV ⁇ Ascl1 ⁇ SA6 brains on PSD28. White arrows indicate examples of TdTom+ (AAV transduced), NeuN+.
  • FIG. 27 Ascl1 ⁇ SA6 overexpression results in improved motor function in a subacute model of stroke at 3 weeks post ⁇ AAV transduction.
  • Percent slippage of the Hindpaw (B) and Forepaw (C) was assessed at baseline (prior to stroke, PSD4 (prior to reprogramming) and PSD29. Mice that received Ascl1 ⁇ Sa6 were has significantly reduced %slippage at 21 days post ⁇ reprogramming. Data represents means +/ ⁇ SEM.
  • FIG. 29 Ectopic expression of Ascl1 ⁇ SA6 improves skilled motor behaviour in the horizontal ladder task:
  • A Schematic of experimental design to assess skilled motor function in the horizontal ladder task in mice that receive a triple ET ⁇ 1 stroke.
  • B The average percent slippage of the impaired forepaw (left slips/left steps*100) reveals that AAV ⁇ Ascl1 ⁇ SA6 treated mice are significantly improved by PSD29 compared to their PSD4 performance, whereas AAV ⁇ Cre and AAV ⁇ Ascl1 treated mice remain impaired at PSD29.
  • FIG. 30 Ascl1 and Ascl1 ⁇ SA6 are able to promote functional recovery in the grip test at PSD28 following ET ⁇ 1 stroke:
  • A Schematic of the experimental design to assess forepaw strength (g) following a single ET ⁇ 1 stroke.
  • B Stroke_AAV ⁇ Cre mice did not demonstrate grip strength improvement at any time examined. Mice that received Ascl1 or Ascl1 ⁇ SA6 show significant improvement by PSD28 (not significantly different from baseline performance (100%) pre ⁇ stroke). Data represents means +/ ⁇ SEM.
  • FIG. 31 Ectopic expression of Ascl1 ⁇ SA6 promotes functional recovery in the grip strength task at a faster rate than Ascl1 in a more severe model of stroke:
  • A Schematic of the experimental design to assess forepaw strength (g) following a triple ET ⁇ 1 stroke.
  • B Stroke_AAV ⁇ Cre mice were significantly impaired from baseline (pre ⁇ stroke) performance at all times examined. Mice that received Ascl1 or Ascl1 ⁇ SA6 show significant improvement by PSD120 (not significantly different from baseline performance pre ⁇ stroke). Mice that received AAV ⁇ Ascl1 ⁇ SA6 recovered grip strength by PSD59 and the recovery was maintained to PSD120 (the longest time examined). Data represents means +/ ⁇ SEM.
  • FIG. 32 Schematic of the experimental workflow for cerebral organoid (CO) culture.
  • Figure 33 In COs injected with AAV2/8 ⁇ GFAP ⁇ mCherry (left panel), GFAP expression (astrocyte marker) was co ⁇ localized with mCherry expressed under GFAP promoter.
  • Figure 35 (A) In human CO's (90 days) injected with AAV2/8 ⁇ GFAP ⁇ Ascl1 ⁇ mCherry or AAV2/8 ⁇ mCherry showed a decreased proportion of astrocytes (GFAP) with a concomitant increase in neuronal markers (NeuN, mature neurons; DCX, immature neurons at 21 days following transduction; (B) Photomicrograph showing transduced astrocytes co ⁇ labeled with NeuN (arrows) at 21 days (i); (II) mCherry transduced cells (arrows) express NeuN (iii) and not GFAP (iv); DAPI (v).
  • GFAP astrocytes
  • Figure 36 Establishing a lineage tracing system to follow the fate of cortical astrocytes transduced in vivo.
  • A Schematic illustration of AAV8 ⁇ GFAPlong ⁇ mCherry vectors and injection strategy into the rostral cerebral cortex in vivo.
  • B mCherry co ⁇ expression with GFAP or Dcx one ⁇ month post ⁇ transduction, and with GFAP or NeuN two ⁇ months post ⁇ transduction. Blue is DAPI counterstain.
  • C Quantification of the percentage of mCherry + transduced cells expressing NeuN after transduction with AAV8 ⁇ GFAPlong ⁇ Ascl1 ⁇ mCherry.
  • FIG. 1 Schematic illustration of AAV5 ⁇ GFAPshort ⁇ iCre vectors and injection strategy into the cortex in vivo.
  • E zsGreen expression in the cortex of Rosa ⁇ zsGreen mice injected with AAV5 ⁇ GFAPshort ⁇ Ascl1 ⁇ iCre at two ⁇ months post ⁇ transduction. Blue is DAPI counterstain.
  • F,G Colorimetric RNA in situ hybridization (F) and fluorescent RNAscope analysis of Ascl1 transcript distribution in cortices transduced with AAV5 ⁇ GFAPshort ⁇ iCre (G) or AAV5 ⁇ GFAPshort ⁇ Ascl1 ⁇ iCre (F,G) at two ⁇ months post ⁇ transduction.
  • Figure 37 Ascl1 ⁇ SA6 induces more transduced cortical cells that express NeuN, a mature neuronal marker, than Ascl1.
  • A Schematic illustration of Cre ⁇ based lineage tracing strategy, using AAV5 ⁇ GFAPshort vectors and Rosa ⁇ tdtomato or Rosa ⁇ zsGreen transgenic animals.
  • FIG. 1 AvsGreen cortex transduced with AAV5 ⁇ GFAPshort ⁇ iCre at 21 days post ⁇ transduction, showing zsGreen epifluorescence and NeuN expression.
  • C Rosa ⁇ tdtomato cortex transduced with AAV5 ⁇ GFAPshort ⁇ iCre, AAV5 ⁇ GFAPshort ⁇ Ascl1 ⁇ t2a ⁇ iCre, and AAV5 ⁇ GFAPshort ⁇ Ascl1 ⁇ SA6 ⁇ t2a ⁇ iCre at 21 days post ⁇ transduction, showing tdtomato epifluorescence and NeuN expression.
  • D Quantification of the percentage of tdtomato + cells that co ⁇ express NeuN.
  • Optogenetic stimulation of ChR2 actuator reveals that Ascl1 ⁇ SA6 transduced cells have a shorter decay constant.
  • A Schematic illustration of optogenetic experiment in which we injected AAVs carrying ChR2 ⁇ (H134R) ⁇ YFP, an optogenetic actuator, with Cre ⁇ based AAVs into the cortex of Rosa ⁇ zsGreen mice. Four weeks later, photostimulation experiments were performed.
  • FIG. 1 Schematic representation of the rostrocaudal positions of analysis.
  • B DAPI staining of cortical sections at Bregma 2.15, 1.85 and 1.34.
  • C ⁇ F Coronal sections through C57Bl/6 control (C,E) and hSod1 G93A (D,F) motor cortices immunostained with Ctip2 (green) and Iba1 (red) at 3 mo (C,D) and 5 mo (E,F) of age. Blue is DAPI counterstain.
  • G ⁇ I Quantification of the %Ctip2 + cells/DAPI + nuclei at 3 mo and 5 mo of age, showing counts at Bregma 2.15 (G), 1.85 (H) and 1.34 (J).
  • J ⁇ O Analysis of microgliosis, showing the %Iba1 + cells/DAPI + nuclei in C57Bl/6 control and hSod1 G93A motor cortices at 3 ⁇ and 5 ⁇ mo of age (J). Characterization of Iba1 + cell density (K), mean soma size (L) and branches per cell (M) in 3 mo and 5 mo C57Bl/6 control and hSOD1 G93A motor cortices.
  • K,O Identification of activated microglia using MORPHIOUS, showing the tuning process used to optimally identify activated cells. Red in the heatmap indicates larger values, and black denotes 0, shown at 3 mo (N) and 5 mo (O) of age.
  • FIG. 42 Astrogliosis is not evident in hSod1 G93A brains at 3 and 5 months of age.
  • A Schematic representation of the rostrocaudal positions of analysis.
  • B ⁇ E Coronal sections through C57Bl/6 control (B,D) and hSod1 G93A
  • C,E motor cortices immunostained with GFAP (green) and Sox9 (red) at 3 mo (B,C) and 5 mo (D,E) of age. Blue is DAPI counterstain.
  • Figure 43 Cluster analysis and assignment in uninjected, iCre, Ascl1 and Ascl1 SA6 injected hSod1 G93A motor cortices.
  • A,B Experimental protocol, showing the injections of the 3 AAVs into the motor cortex of 16 ⁇ week ⁇ old hSod1 G93A ;Rosa ⁇ zsGreen mice using a stereotax (A). After 28 dpi, the brains were sectioned onto the Visium capture spots, the tissue was permeabilized to capture mRNA on barcoded primers (A). Primer sequences include spatial barcodes, a UMI and poly dT tail (B). The Fiducial frame and capture area of each ‘spot' are shown (B).
  • FIG. 1 ST analysis of hSod1 G93A motor cortex injected with Ascl1 SA6 , showing H&E ⁇ stained section in the Fiducial frame, spatial map, and UMAP (I). Heatmap of the top 50 variably expressed genes across the tissue (J). Cluster assignments in D,F, H,J) were made using the Allen Brain Atlas and comparing to a brain palette of 266 genes in a molecular brain atlas 39 . [0068] Figure 44: iCre transduced cells are associated with an inflammatory transcriptional signature. (A ⁇ E) Mapping iCre transcript distribution onto the spatial maps for the uninjected, iCre, Ascl1 and Ascl1 SA6 transduced brains (A).
  • FIG. F Venn diagrams showing the distributions of DEGs that are upregulated and downregulated when comparing Ascl1 to iCre or Ascl1 SA6 to iCre (F).
  • FIG. 45 Quality control of spatial transcriptomics (ST) data.
  • a ⁇ A ST analysis of uninjected hSod1 G93A motor cortex, showing H&E ⁇ stained section in the Fiducial frame (A), a tSNE plot with UMI counts in each cluster (A), a spatial map (A') and a corresponding, color ⁇ coded tSNE plot (A'). Sequencing saturation is also indicated (A").
  • (B ⁇ B) ST analysis of hSod1 G93A motor cortex injected with iCre, showing H&E ⁇ stained section in the Fiducial frame (B), a tSNE plot with UMI counts in each cluster (B), a spatial map (B') and a corresponding, color ⁇ coded tSNE plot (B'). Sequencing saturation is also indicated (B”).
  • (C ⁇ C) ST analysis of hSod1 G93A motor cortex injected with Ascl1, showing H&E ⁇ stained section in the Fiducial frame (C), a tSNE plot with UMI counts in each cluster (C), a spatial map (C') and a corresponding, color ⁇ coded tSNE plot (C').
  • Sequencing saturation is also indicated (C").
  • D ⁇ D ST analysis of hSod1 G93A motor cortex injected with Ascl1 SA6 , showing H&E ⁇ stained section in the Fiducial frame (D), a tSNE plot with UMI counts in each cluster (D), a spatial map (D') and a corresponding, color ⁇ coded tSNE plot (D'). Sequencing saturation is also indicated (D”).
  • Figure 46 Neuron ⁇ associated gene expression is enriched in Ascl1 and Ascl1 SA6 transduced cells.
  • FIG. 47 Identification of a GRN involving Zbtb18 and Id TFs activated by Ascl1 and Ascl1 SA6 in vivo.
  • a ⁇ C GRNs comprised of TFs were built from the ST data for iCre (A), Ascl1 (B) and Ascl1 SA6 (C) transduced brains.
  • the darkest grey boxes (originally red) surround DEGs specifically upregulated either in iCre alone, or in Ascl1 and/or Ascl1 SA6 transduced brains.
  • the dark grey boxes (originally orange) surround DEGs upregulated in iCre and either Ascl1 and/or Ascl1 SA6 transduced brains.
  • Lightest grey boxes (originally blue) surround DEGs specifically downregulated either in iCre alone, or in Ascl1 and/or Ascl1 SA6 transduced brains.
  • Medium grey boxes (originally purple) surround DEGs specifically downregulated in iCre and either Ascl1 and/or Ascl1 SA6 transduced brains.
  • (J,K) Log2FC in transcript reads for upregulated (J) and downregulated (K) DEGs, showing values for iCre (black circles), Ascl1 (blue circles) and Ascl1 SA6 (green circles).
  • (L,M) Generation of an embryonic cortical GRN inferred from a published scRNAseq dataset 96 , showing TFs that are upregulated (dark grey squares) or downregulated (light grey squares) in response to Ascl1 SA6 overexpression in glioblastoma cells (GSE153823; 25 ), either in an unperturbed state (L) or following an in silico knock ⁇ out (‘KO') of Zbtb18 (M).
  • Figure 48 Comparison of in vivo (ST data) to published in vitro neuronal reprogramming datasets. (A ⁇ C) Comparative analysis of upregulated DEGs from the in vivo ST data in this study to upregulated DEGs from in vitro reprogramming of postnatal astrocytes using ASCL1 (GSE06389; 10 ). Shown are comparisons to iCre (A), Ascl1 (B) and Ascl1 SA6 (C) ST data, focusing on upregulated DEGs.
  • AAV injections and behavior test timeline iCre and Ascl1 SA6 were injected bilaterally into 16 ⁇ week ⁇ old Rosa ⁇ zsGreen (control) and 16 ⁇ week ⁇ old (symptomatic) hSOD1 G93A ;Rosa ⁇ zsGreen mice, both male and female. Body weight and motor behavioural tests were performed weekly and compared to 15 ⁇ week baseline measures.
  • Figure 50 Neurological scores and survival curves for iCre and Ascl1 SA6 injection at 16 weeks in male and female hSOD1 G93A mice. Behavioural tests were performed weekly and continued until humane endpoint.
  • A,B NS assignments for male (A) and female (B) hSOD1 G93A mice.
  • C Kaplan ⁇ Meier survival curves for iCre and Ascl1 SA6 ⁇ injected male (C) and female (D) mice.
  • Figure 51 Rotarod and grip strength for iCre and Ascl1 SA6 injection at 16 weeks in hSOD1 G93A and control mice.
  • hSOD1 G93A female mice injected with Ascl1 SA6 had an increased ability to stay on the rotarod and showed significant differences at 23 and 25 weeks ⁇ of ⁇ age. ( ⁇ dák's multiple comparisons test, p 0.0359 and p ⁇ 0.0001, respectively)
  • C,D Grip strength measurements of neuromuscular function were performed at 15 ⁇ weeks (baseline) and weekly from 17 weeks after AAV injections at 16 weeks ⁇ of ⁇ age in male (C) and female (D) hSOD1 G93A and control mice.
  • Figure 52 Gait analysis for iCre and Ascl1 SA6 treated control and hSOD1 G93A mice at 16 weeks of age. Gait analysis of stride length distance based on measurement of fore and hindlimb paw prints in male (A) and female (B) control and hSOD G93A mice. (A) hSOD1 G93A male mice injected with Ascl1 SA6 displayed a trend towards increased stride length but did not show significant differences.
  • FIG. 54 Body weight measures after iCre and Ascl1 SA6 injection at 19 weeks ⁇ of ⁇ age in hSOD1 G93A and control mice. Body weight was measured weekly and compared to 18 ⁇ week baseline measures in male (A) and female (B) mice.
  • Figure 55 Neuroscores and Kaplan ⁇ Meier survival curves for iCre and Ascl1 SA6 injected hSOD1 G93A mice at 19 weeks of age. Behavioural tests were performed weekly and continued until humane endpoint.
  • Rotarod assays were performed at 18 ⁇ weeks (baseline) and weekly from 20 weeks after AAV injections at 19 weeks ⁇ of ⁇ age in male (A) and female (B) hSOD1 G93A and control mice.
  • hSOD1 G93A male treated with Ascl1 SA6 trended towards an increase in their ability to stay on the rotarod (A).
  • hSOD1 G93A female mice injected with Ascl1 SA6 or iCre did not show a difference in latency to fall on the rotarod (B) (C,D) Grip strength measurements of neuromuscular function were performed at 18 ⁇ weeks (baseline) and weekly from 20 weeks after AAV injections at 19 weeks ⁇ of ⁇ age in male (C) and female (D) hSOD1 G93A and control mice.
  • hSOD1 G93A male mice injected with Ascl1 SA6 showed a trend towards increased grip strength.
  • Figure 57 CatWalk XT ® gait analysis of right (RH) and left (LH) hindlimb stride distances after iCre and Ascl1 SA6 injections at 19 weeks.
  • FIG. 58 Ascl1 ⁇ SA7 represses Sox9 expression, a glioblast marker, in transduced cortical cells more efficiently than Ascl1 and to the same extent as Ascl1 ⁇ SA6.
  • A Rosa ⁇ zsGreen cortex transduced with AAV8 ⁇ GFAPshort ⁇ iCre, AAV8 ⁇ GFAPshort ⁇ Ascl1 ⁇ t2a ⁇ iCre, AAV8 ⁇ GFAPshort ⁇ Ascl1 ⁇ SA6 ⁇ t2a ⁇ iCre and AAV8 ⁇ GFAPshort ⁇ Ascl1 ⁇ SA7 ⁇ t2a ⁇ iCre at 21 days post ⁇ transduction, showing zsGreen epifluorescence, Sox9 and GFAP (white) expression.
  • DAPI was used as a counterstain. Shown are merged images (top panel) and separated Sox9 (second panel) and GFAP (bottom pannel) channels.
  • A Rosa ⁇ zsGreen cortex transduced with AAV8 ⁇ GFAPshort ⁇ iCre, AAV8 ⁇ GFAPshort ⁇ Ascl1 ⁇ t2a ⁇ iCre, AAV8 ⁇ GFAPshort ⁇ Ascl1 ⁇ SA6 ⁇ t2a ⁇ iCre and AAV8 ⁇ GFAPshort ⁇ Ascl1 ⁇ SA7 ⁇ t2a ⁇ iCre at 21 days post ⁇ transduction, showing zsGreen epifluorescence and NeuN expression.
  • B Quantification of the percentage of zsGreen+ cells that co ⁇ express NeuN. Scalebars in 100 ⁇ m.
  • an effective amount of a transcription factor, or a nucleic acid encoding a transcription factor is an amount sufficient to transdifferentiate a sufficient number of target cells of a target tissue of a subject.
  • a target tissue is neuronal tissue (e.g., brain tissue, such as, but not limited to, cerebral cortex (CCTX), hippocampus (HIPPO), entorhinal cortex (EC), pre ⁇ frontal cortex (PFC), posterior medial cortex (PMC), locus coeruleus (LC), thalamus (TH), inferior colliculus (IC), olfactory bulb (OB), anterior olfactory nucleus (AON), hypothalamus (HT), cerebellum (CBL), striatum, basal ganglia, limbic system (LC), default mode network (DMN), medial temporal lobes (MTL), brain stem, cerebellum, and spinal cord).
  • CCTX cerebral cortex
  • HIPPO hippocampus
  • EC entorhinal cortex
  • an effective amount of a composition or vector may be an amount sufficient to have a therapeutic benefit in a subject, e.g., to provide neuronal reprogramming of astrocytes to neurons, to extend the lifespan of a subject, to delay, prevent or treat a neurodegenerative disease or disorder or injury in the subject, or to treat a central nervous system disease, disorder or injury in the subject, etc.
  • the effective amount will depend on a variety of factors such as, for example, the species, sex, age, weight, health of the subject, and the mode of administration or site of administration, and may thus vary among subjects and administrations.
  • a “subject” or “patient” or “individual” to be treated by the method of the invention is meant to refer to either a human or non ⁇ human animal.
  • a “non ⁇ human animal” includes any vertebrate or invertebrate organism, but is preferably a mammal.
  • a human subject can be of any age, gender, race or ethnic group, e.g., Caucasian (white), Asian, African, black, African American, African European, Hispanic, Middle Eastern, etc.
  • the subject can be a patient or other subject in a clinical setting.
  • the subject is already undergoing treatment.
  • the subject is a neonate, infant, child, adolescent, adult, or an elderly adult.
  • protein and “polypeptide” are used interchangeably and thus the term polypeptide may be used to refer to a full ⁇ length protein and may also be used to refer to a fragment of a full ⁇ length protein, and/or functional variants thereof.
  • polynucleotide and “nucleic acid sequence” may be used interchangeably and may comprise genetic material including, but not limited to: RNA, DNA, mRNA, cDNA, etc., which may include full length sequences, functional variants, and/or fragments thereof.
  • the term “vector” is meant to refer to a vehicle to artificially carry foreign genetic material into a host cell, such as a recombinant plasmid or virus that comprises a nucleic acid to be delivered into the host cell, either In vitro or in vivo.
  • a host cell such as a recombinant plasmid or virus that comprises a nucleic acid to be delivered into the host cell, either In vitro or in vivo.
  • expression vector refers to a vector that directs expression of an RNA or polypeptide from sequences linked to transcriptional regulatory sequences on the vector. The sequences expressed will often, but not necessarily, be heterologous to the host cell.
  • An expression vector may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, for example in human cells for expression and in a prokaryotic host for cloning and amplification.
  • expression refers to the cellular processes involved in producing RNA and proteins and, as appropriate, secreting proteins, including where applicable, but not limited to, for example, transcription, transcript processing, translation and protein folding, modification and processing.
  • Expression products include RNA transcribed from a gene, and polypeptides obtained by translation of mRNA transcribed from a gene.
  • gene means the nucleic acid sequence which is transcribed (DNA) to RNA in vitro or in vivo when operably linked to appropriate regulatory sequences.
  • the gene may be a mutant gene and may or may not include regions preceding and following the coding region, e.g., 5' untranslated (5'UTR) and Kozak sequence, or “leader” sequences and 3' UTR or “trailer” sequences, as well as intervening sequences (introns) between individual coding segments (exons).
  • 5' untranslated (5'UTR) and Kozak sequence or “leader” sequences and 3' UTR or “trailer” sequences, as well as intervening sequences (introns) between individual coding segments (exons).
  • the present invention relates to products and methods of their use in direct neuronal reprogramming, for example, for the treatment of central nervous system (e.g., neurodegenerative) diseases or disorders or central nervous system injury (e.g., stroke).
  • central nervous system e.g., neurodegenerative
  • central nervous system injury e.g., stroke
  • the product of the invention comprises a proneural or neuronal differentiation basic ⁇ helix ⁇ loop ⁇ helix (bHLH) transcription factor (e.g., Neurog2, Ascl1, Neurod1, Neurod4) that includes one or more mutations to de ⁇ sensitize the transcription factor to inhibitory environmental controls, or a nucleic acid encoding the mutant bHLH transcription factor.
  • bHLH basic ⁇ helix ⁇ loop ⁇ helix
  • the present inventors have surprisingly found that incorporation of phosphoacceptor site mutations allow the bHLH transcription factor Ascl1 to maintain its activity even in cellular contexts in which it is not normally active.
  • bHLH transcription factors include, for example, Neurog2 ⁇ SA9, Ascl1 ⁇ SA6, Neurod1 ⁇ SA6, Neurod4 ⁇ SA3/TA4.
  • glial cells e.g., astrocytes, oligodendrocytes and microglia
  • bHLH Transcription Factor Mutants [0096] As noted above, bHLH transcription factors can be classified based on functional properties into proneural and neuronal differentiation genes (D.J. Dennis et al./Brain Research 1705 (2019) 48–6549). Proneural bHLH genes with proneural activity include Neurog1, Neurog2, Ascl1, Neurod4, Atoh1 and Atoh7.
  • Neural differentiation bHLH transcription factors which function later in the development of neural lineages, include NeuroD (Neurod1, Neurod2/Ndrf, Neurod6/Math2), Nscl (Nhlh1/Nscl1, Nhlh2/Nscl2), and, in some contexts, Olig (Olig1, Olig2, Olig3, Bhlhe22) families.
  • NeuroD Neurod2/Ndrf, Neurod6/Math2
  • Nscl Nhlh1/Nscl1, Nhlh2/Nscl2
  • Olig Olig1, Olig2, Olig3, Bhlhe22
  • bHLH transcription factors comprise nucleotides encoding serines (S) or threonines (T) adjacent to proline (P) residues (designated SP or TP), which are phosphoacceptor sites for proline ⁇ directed serine ⁇ threonine kinases. Phosphorylation of these bHLH proteins by proline ⁇ directed serine threonine kinases (e.g., GSK3, ERK, CDK1) inhibits the ability of these transcription factors to bind DNA and induce neuronal differentiation. Such inhibition is an environmental inhibitory control.
  • mutants of bHLH transcription factors that do not include phosphoacceptor sites for proline ⁇ directed serine ⁇ threonine kinases, or that have a reduced number of phosphoacceptor sites for proline ⁇ directed serine ⁇ threonine kinases have a surprising ability to efficiently reprogram astrocytes within the CNS, for example, the brain, into functional neurons, in a manner that is not susceptible to environmental inhibitory controls.
  • the ability of bHLH genes to promote neurogenesis has been found to be highly dependent on the environment; neuronal conversion efficiencies vary at different developmental times, in different brain regions and in the diseased or injured brain depending on inhibitory mechanisms present. This is demonstrated by the summary provided in the table below. Also, shown is how reducing phosphorylation of a bHLH transcription factor can significantly improve and stabilize neuronal conversion efficiencies.
  • the transcription factor mutants provided herein comprise a substitution mutation, such as a serine to alanine or threonine to alanine, at one or more proline ⁇ directed serine ⁇ threonine kinase phosphoacceptor sites.
  • the substitution mutation functions to stop phosphorylation at the mutated site without affecting the transcription factor activity.
  • substitutions of serine or threonine to alanine other substitutions are possible.
  • the serine or threonine of the targeted proline ⁇ directed serine ⁇ threonine kinase phosphorylation site(s) can be replaced with an amino acid having biochemical properties (e.g., size, charge and hydrophobicity) that are similar to alanine; such as, glycine, valine, leucine or isoleucine.
  • the mutants can contain substitutions of serine or threonine to a D ⁇ amino acid, such as D ⁇ serine, D ⁇ threonine, D ⁇ alanine, D ⁇ glycine, D ⁇ valine, D ⁇ leucine or D ⁇ isoleucine.
  • the bHLH transcription factor mutants provided herein comprise a substitution of the serine or threonine at one or more proline ⁇ directed serine ⁇ threonine kinase phosphoacceptor sites.
  • the mutant bHLH transcription factor comprises a substitution of serine or threonine residues at two or more proline ⁇ directed serine ⁇ threonine kinase phosphoacceptor sites, or at three or more proline ⁇ directed serine ⁇ threonine kinase phosphoacceptor sites, or at four or more proline ⁇ directed serine ⁇ threonine kinase phosphoacceptor sites, or at five or more proline ⁇ directed serine ⁇ threonine kinase phosphoacceptor sites.
  • the bHLH transcription factor mutant comprises a substitution of the serine or threonine at all of the proline ⁇ directed serine ⁇ threonine kinase phosphoacceptor sites present in the naturally occurring sequence.
  • the genes encoding mammalian bHLH transcription factors are highly conserved. This conservation is illustrated from a BLAST alignment of mouse vs. human coding sequences (using the NCBI reference sequences), which provides the following percent identities: Ascl1 89.73%; Neurod1 90.78%; Neurod4 87.41%; Neurog2 82.54%.
  • the mutant bHLH transcription factor is based on a human or mouse sequence. However, given the sequence similarity, a mutant based on a non ⁇ human mammalian sequence, such as mouse sequence, is useful in humans.
  • the mutant bHLH transcription factor protein can comprise a polypeptide sequence that is at least 90%, or more preferably at least 93%, at least 95% or at least 97% identical to the corresponding sequence of the naturally occurring protein, and which comprises a mutation of at least one proline ⁇ directed serine ⁇ threonine kinase phosphorylation site, as described above.
  • Percent sequence identity is calculated by determining the number of matched positions in aligned amino acid sequences, dividing the number of matched positions by the total number of aligned amino acids, and multiplying by 100. A matched position refers to a position in which identical amino acids occur at the same position in aligned amino acid sequences. Percent sequence identity also can be determined for any nucleic acid sequence.
  • the mutant bHLH transcription factor is a mutant proneural bHLH transcription factor.
  • the mutant transcription factor is based on the human or mouse proneural bHLH transcription factor.
  • the mutant bHLH transcription factor is a mutant neuronal differentiation bHLH transcription factor.
  • the mutant transcription factor is based on the human or mouse neuronal bHLH transcription factor.
  • bHLH transcription factor sequences originating from other organisms are to be used for the design of corresponding mutants, corresponding amino acids positions can be readily determined, for example by means of pairwise or multiple sequence alignment.
  • the proline ⁇ directed serine ⁇ threonine kinase phosphoacceptor site mutations are incorporated in combination with a mutation of a single conserved S/T residue at the Loop/Helix 2 (L ⁇ H2) junction, which is phosphorylated by PKA, and acts as a binary ‘off' switch for both vertebrate and invertebrate proneural TFs (Quan et al. Cell 2016 Jan 28:164(3):460 ⁇ 75. Doi: 10.1016/j.cell.2015.12.048).
  • Table 1 lists the number of proline ⁇ directed serine ⁇ threonine kinase phosphorylation sites present in these transcription factors, of which those including a serine are identified as “SP” and those including a threonine are identified as “TP”.
  • Table 1 [00110] Exemplary amino acid sequences of a human and a mouse wild ⁇ type ASCL1 are shown below, where the phosphorylation sites are shaded and the residue shown in a box is serine 155/150, the conserved serine residue at the L ⁇ H2 junction that is phosphorylated by PKA: Human (SEQ ID NO:1): MESSAKMESGGAGQQPQPQPQPFLPPAACFFATAAAAAAAAAAAAAAAQSAQQQQQQ QQQQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQ QQPAAVARRNERERNRVKLVNLGFATLREHVPNGAANKKMSSKVETLRSAVE
  • ASCL1 transcription factor mutant is at least 85%, 90%, 95%, 97% identical to SEQ ID NO:1 or SEQ ID NO:2.
  • nucleic acids encoding an ASCL1 transcription factor mutant that is at least 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO:1 or SEQ ID NO:2 and comprises a mutation of at least one, at least two, at least three or at least four phosphoacceptor sites, where each mutation eliminates phosphorylation at the corresponding mutated phosphoacceptor site. These mutants retain transcription factor activity.
  • the bHLH transcription factor mutant is human Ascl1 ⁇ SA5 or mouse Ascl1 ⁇ SA6 (S62/88/185/189/202/218A; SEQ ID NO:3).
  • the bHLH transcription factor mutant is human Ascl1 ⁇ SA6 or mouse Ascl1 ⁇ SA7 (S62/88/150/185/189/202/218A; SEQ ID NO:5), in which the serine at the L ⁇ H2 junction is also substituted.
  • nucleic acid coding sequence for the mouse Ascl1 ⁇ SA6 mutant is provided below, where the mutant codons are shaded: ATGGAGAGCTCTGGCAAGATGGAGAGTGGAGCCGGCCAGCAGCCGCAGCCCCCGCAG CCCTTCCTGCCTCCCGCAGCCTGCTTCTTTGCGACCGCGGCGGCGGCGGCAGCGGCG GCGGCCGCGGCAGCTCAGAGCGCGCAGCAGCAACAGCCGCAGGCGCCGCCGCAGCAG GCGCCGCAGCTGGCCCCGGTGGCCGACAGCCAGCCCTCAGGGGGCGGTCACAAGTCA GCGGCCAAGCAGGTCAAGCCAGCCAGCTCGTCCGCTCCGGAACTGATGCGCTGCAAA CGCCGGCTCAACTTCAGCGGCTTCGGCTACAGCCTGCCACAGCAGCAGCCGGCCGCC GTGGCGCGCCGCAACGAGCGCGAGCGCAACCGGGTCAAGTTGGTCAACCTGGGCTTT GCCACCCTCCGGGAGCAT
  • the Neurod1 transcription factor mutant is at least 85%, 90%, 95%, 97% identical to SEQ ID NO:7 or SEQ ID NO:8.
  • nucleic acids encoding a Neurod1 transcription factor mutant that is at least 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO:7 or SEQ ID NO:8 and comprises a mutation of at least one, at least two, at least three or at least four phosphoacceptor sites, where each mutation eliminates phosphorylation at the corresponding mutated phosphoacceptor site.
  • the bHLH transcription factor mutant is human Neurod1 ⁇ SA6 or mouse Neurod1 ⁇ SA6 (S162/ 223/ 228/ 259/ 266/ 274A; SEQ ID NO:9).
  • the bHLH transcription factor mutant is human Neurod1 ⁇ SA7 or mouse Neurod1 ⁇ SA7 (S138/162/ 223/ 228/ 259/ 266/ 274A; SEQ ID NO:11), in which the serine at the L ⁇ H2 junction is also substituted.
  • nucleic acid coding sequence for the mouse Neurod1 ⁇ SA6 mutant is provided below, where the mutant codons are shaded: ATGACCAAATCATACAGCGAGAGCGGGCTGATGGGCGAGCCTCAGCCCCAAGGTCCC CCAAGCTGGACAGATGAGTGTCTCAGTTCTCAGGACGAGGAACACGAGGCAGACAAG AAAGAGGACGAGCTTGAAGCCATGAATGCAGAGGAGGACTCTCTGAGAAACGGGGGA GAGGAGGAGGAGGAAGATGAGGATCTAGAGGAAGAGGAGGAAGAAGAAGAAGAAGAAGAAGGAGGAG GAGGATCAAAAGCCCAAGAGACGGGGTCCCAAAAAGAAAAAAAAAGATGACCAAGGCGCGC CTAGAACGTTTTAAATTAAGGCGCATGAAGGCCAACGCCCGCGAGCGGAACCGCATG CACGGGCTGAACGCGGCGCTGGACAACCTGCGCAAGGTGGTACCTTGCTACTCCAAG ACCCAGAAACTGTCTAAAATAGAGAC
  • the Neurod4 transcription factor mutant is at least 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO:13 or SEQ ID NO:14.
  • nucleic acids encoding a Neurod4 transcription factor mutant that is at least 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO:13 or SEQ ID NO:14 and comprises a mutation of at least one, at least two, at least three or at least four phosphoacceptor sites, where each mutation eliminates phosphorylation at the corresponding mutated phosphoacceptor site.
  • the bHLH transcription factor mutant is human Neurod4 ⁇ SA4TA6 or mouse Neurod4 ⁇ SA3TA4 (S206/ 211/ 269A; T245/ 253/ 295/ 301A; SEQ ID NO:15).
  • the bHLH transcription factor mutant is human Neurod4 ⁇ SA5TA6 or mouse Neurod4 ⁇ SA4TA4 (S124/206/ 211/ 269A; T245/ 253/ 295/ 301A; SEQ ID NO:17), in which the serine at the L ⁇ H2 junction is also substituted.
  • the Neurog2 transcription factor mutant is at least 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO:19 or SEQ ID NO:20.
  • nucleic acids encoding a Neurod4 transcription factor mutant that is at least 70%, 75%, 80%, 85%, 90%, 95%, or 97% identical to SEQ ID NO:19 or SEQ ID NO:20 and comprises a mutation of at least one, at least two, at least three or at least four phosphoacceptor sites, where each mutation eliminates phosphorylation at the corresponding mutated phosphoacceptor site.
  • the bHLH transcription factor mutant is human Neurog2 ⁇ SA8TA1 or mouse Neurog2 ⁇ SA9TA1 (S24 /66 /192 /203 /205 /215/224/231/234A;T31A; SEQ ID NO:21).
  • the bHLH transcription factor mutant is human Neurog2 ⁇ SA8TA2 or mouse Neurog2 ⁇ SA9TA2 (S24/66/192/203/205/215/224/231/234A;T31/149A; SEQ ID NO:23), in which the serine at the L ⁇ H2 junction is also substituted.
  • the bHLH transcription factor mutant is mouse Neurog2 ⁇ SA9 (S24/66/192/203/205/215/224/231/234A; SEQ ID NO:25).
  • the nucleic acid coding sequence (SEQ ID NO:22) for the mouse Neurog2 ⁇ SA9TA1 mutant is provided below, where the mutant codons are shaded: ATGTTCGTCAAATCTGAGACTCTGGAGTTGAAGGAGGAAGAGGAGGTACTGATGCTG CTGGGCTCGGCTGCCCCGGCCTCGGCGACCCTGGCCCCGATGTCCTCCAGCGCGGAC GAGGAGGAGGACGAGGAGCTGCGCCGGCCGGGCTCCGCGCGTGGGCAGCGTGGAGCG GAAGCCGGGCAGGGGGTGCAGGGCTCCGGCGTCGGGTGCCGGGGGTTGCCGGCCA GGGCGGCTGCTGGGCCTGATGCACGAGTGCAAGCGTCGCCCGTCGCGCTCACGGGCC GTCTCCCGAGGTGCCAAGACGGCGGAGACGGTGCCAAGACGGCGGAGA
  • Such additional substitutions would introduce one or more conservative changes, which replace amino acids with other amino acids of similar chemical structure, similar chemical properties or similar side ⁇ chain volume.
  • the amino acids introduced will have similar polarity, hydrophilicity, hydrophobicity, basicity, acidity, neutrality or charge to the amino acids they replace.
  • the conservative change may introduce another amino acid that is aromatic or aliphatic in the place of a pre ⁇ existing aromatic or aliphatic amino acid.
  • Conservative amino acid changes are well known in the art and may be selected in accordance with the properties of the 20 main amino acids. Conservative substitutions do not affect the function of the protein or polypeptide.
  • a mammal e.g., a mammal having a neurodegenerative disease or disorder, or a CNS or brain injury
  • a mammal can be treated by delivering an isolated mutant bHLH transcription factor as described above, to glial cells, preferably astrocytes, within the mammalian brain (e.g., cerebral cortex) in a manner that triggers the glial cells to form neurons.
  • the formed neurons may or may not be electrophysiologically functional.
  • the formed neurons function to enhance neuroplasticity, support growth and development of other cell types, and/or modify their microenvironment (e.g., reduce toxicity of their microenvironment).
  • the mutant bHLH transcription factor can be delivered either directly as an isolated or purified protein, or via expression of a nucleic acid encoding the mutant bHLH transcripton factor.
  • two or more mutant bHLH transcription factors are used in the treatment of a subject. The two or more mutants can be used simultaneously or in sequence.
  • the neurodegenerative disease or disorder can be, for example, Alzheimer's disease (AD), presenile and senile forms; mild cognitive impairment; Alzheimer's disease ⁇ related dementia; tauopathy; ⁇ synucleinopathy; Parkinson's disease; Amyotrophic Lateral Sclerosis (ALS); motor neuron Disease; Spastic paraplegia; Huntington's Disease, spinocerebellar ataxia, Freidrich's Ataxia; neurodegenerative diseases associated with intracellular and/or intraneuronal aggregates of proteins with polyglutamine, polyalanine or other repeats arising from pathological expansions of tri ⁇ or tetra ⁇ nucleotide elements within corresponding genes; Down's syndrome; Prion related disease; Familial British Dementia; Familial Danish Dementia; Presenile Dementia with Spastic Ataxia; Cerebral Amyloid Angiopathy, British Type; Presenile Dementia With Spastic Ataxia Cerebral Amyloid Angiopathy, Danish Type
  • the neurodegenerative disease or disorder is ALS, AD, Alzheimer's disease ⁇ related dementia, Parkinson's disease, Down's syndrome, dementia pugilistica, multiple system atrophy, frontal temporal dementia, progressive supranuclear palsy, prion diseases, Huntington's disease, a motor neuron disease or a Lewy body disease.
  • a brain or CNS injury can be, for example, trauma, concussion, stroke, tumor, infection, substance abuse, hypoxia, anoxia, aneurysm, injury resulting from neurological illness, toxins, embolisms, hematomas, brain hemorrhaging, injury resulting from a genetic disease, or a coma.
  • compositions comprising a mutant bHLH transcription factor and one or more pharmaceutically acceptable diluent, excipient or carrier.
  • the composition for delivery of one or more mutant bHLH transcription factor can be in the form of a nanocarriers or nanoparticles, such as, for example, liposomes, or biomaterials (for a review of such delivery formulations, see, Khait NL, Ho E, and Shoichet MS, Advanced Functional Materials, special issue on Advanced Materials for Drug Delivery and Theranostics. (2021) 2010674: 1 ⁇ 32).
  • Such delivery formulations can additionally incorporate targeting elements to specifically direct the mutant bHLH transcription factor(s) to the target glial cells in the CNS.
  • the mutated bHLH transcription factor is used together with one or more other transcription factors (TFs).
  • TFs that act as fate determinants that may be expressed together with the mutant bHLH transcription factor described herein include, but are not limited to, homeodomain TFs that specify a regional identity (Dlx1, Dlx2, Pax6, Emx1, Lhx2), layer V determinants (Fezf2, Ctip2), Nurr1 (official gene name, Nr4a2, increases neuronal reprogramming efficiency), Brn2 (official gene name, Pou3f2, cooperates with Ascl1 to promote neurogenesis), Sox family TFs (specify a neural identity), and Myt1l, which is a multi ⁇ lineage repressor of alternative, non ⁇ neural cell fates.
  • a mammal e.g., a mammal having a neurodegenerative disease or disorder, or a CNS or brain injury
  • a nucleic acid designed to express a mutant bHLH transcription factor as described above to glial cells, preferably astrocytes, within the mammal's brain (e.g., cerebral cortex) in a manner that triggers the glial cells, preferably astrocytes, to form neurons.
  • the formed neurons may or may not be electrophysiologically functional.
  • the formed neurons function to enhance neuroplasticity, support growth and development of other cell types, and/or modify their microenvironment (e.g., reduce toxicity of their microenvironment).
  • the present application further provides a nucleic acid, or nucleic acid construct, designed to express a mutant bHLH transcription factor polypeptide.
  • the nucleic acid comprises a polynucleotide encoding a mutant bHLH transcription factor as described herein operably linked to one or more control sequences that direct the expression of the coding sequence in a suitable host cell under conditions compatible with the control sequences.
  • the nucleic acid is designed for expression target glial cells.
  • the nucleic acid is designed for expression in an in vitro system, such as in a bacterial system, for manufacture of the mutant bHLH transcription factor.
  • compositions comprising such nucleic acids and one or more diluent, excipient or carrier, which is one or more pharmaceutically acceptable diluent, excipient or carrier when the composition is for administration to treat a subject.
  • the nucleic acid can contain one or more regulatory elements operably linked to the coding sequence.
  • operably linked refers to positioning of a regulatory element in a vector relative to a nucleic acid in such a way as to permit or facilitate expression of the encoded polypeptide.
  • regulatory elements can include, without limitation, translation initiation sequences (e.g., a Kozak consensus sequence or a tissue ⁇ specific Kozak sequence (e.g., McClements et al. Mol. Vis.
  • a promoter can be included in the nucleic acid to facilitate transcription of the nucleic acid encoding a mutant bHLH transcription factor polypeptide.
  • a promoter can be constitutive or inducible, and can affect the expression of a nucleic acid encoding a polypeptide in a general or tissue ⁇ specific manner.
  • Examples of cell ⁇ specific and/or tissue ⁇ specific promoters that can be used to drive expression of a mutant bHLH transcription factor polypeptide in glial cells include, without limitation, Nestin, Vimentin, NG2, GFAP, gfaABC 1 D (minimal GFAP promoter), Olig2, CAG, EF1a, Aldh1L1, CMV and CBA (chimeric CMV ⁇ chicken ⁇ actin) promoters.
  • a GFAP promoter can be included in a viral vector to facilitate transcription of a nucleic acid encoding a mutant bHLH transcription factor polypeptide in astrocytes.
  • the additional regulatory elements that can be included in the nucleic acid for expression of the mutant bHLH transcription factor are 3'UTR and/or 5'UTR sequences.
  • the nucleic acid incorporates the 3'UTR of wild ⁇ type Ascl1.
  • the 3'UTR in wild ⁇ type Ascl1 includes an intron that targets the message for nonsense ⁇ mediated decay (NMD).
  • NMD nonsense ⁇ mediated decay
  • Addition of the Ascl1 3'UTR to the nucleic acid encoding a mutant bHLH transcription factor may make the transcript less stable so that it is degraded following cell conversion to a neuron and, thereby avoids continued expression after neuronal reprogramming has been achieved.
  • bHLH proteins are able to convert P1 brain NSCs to neurons, but these neurons die over time if the bHLH protein expression is maintained (L. Cai, E.M. Morrow, and C.L. Cepko, Misexpression of basic helix ⁇ loop ⁇ helix genes in the murine cerebral cortex affects cell fate choices and neuronal survival. Development 127 (2000) 3021 ⁇ 30). Accordingly, it can be beneficial, in some embodiments, to incorporate such a regulatory sequence useful for turning off expression of the mutant bHLH transcription factor gene. [00143] The sequence of the Ascl1 3'UTR sequence (SEQ ID NO: 38) is shown below (NM_008553.5).
  • RNAs that act as fate determinants that may be expressed together with the mutant bHLH transcription factor described herein include, but are not limited to, homeodomain TFs that specify a regional identity (Dlx1, Dlx2, Pax6, Emx1, Lhx2), layer V determinants (Fezf2, Ctip2), Nurr1 (official gene name, Nr4a2, increases neuronal reprogramming efficiency), Brn2 (official gene name, Pou3f2, cooperates with Ascl1 to promote neurogenesis), Sox family TFs (specify a neural identity), and Myt1l, which is a multi ⁇ lineage repressor of alternative, non ⁇ neural cell fates.
  • a ribosome skipping sequence e.g., v2A, t2A, p2A
  • a nucleic acid can comprise coding sequences for two or more mutant bHLH transcription factors, which are separated by a ribosome skipping sequence (e.g., v2A, t2A, p2A), to allow for stoichiometric expression of multiple genes from a polycistronic transcript.
  • a ribosome skipping sequence e.g., v2A, t2A, p2A
  • the nucleic acid can comprise sequences encoding a first mutant bHLH transcription factor and a second, different, mutant bHLH transcription factor, and an intervening t2a polypeptide sequence.
  • Such a nucleic acid is useful for expression of two mutant bHLH transcription factors in tandem to increase neuronal reprogramming efficiency.
  • the nucleic acid encoding one or more mutant bHLH transcription factor polypeptide can be administered to a mammal using one or more vectors, such as viral vectors.
  • Vectors for administering nucleic acids can be prepared using appropriate materials (e.g., packaging cell lines, helper viruses, and vector constructs). See, for example, Gene Therapy Protocols (Methods in Molecular Medicine), edited by Jeffrey R. Morgan, Humana Press, Totowa, N.J. (2002) and Viral Vectors for Gene Therapy: Methods and Protocols, edited by Curtis A. Machida, Humana Press, Totowa, N.J. (2003).
  • virus ⁇ based vectors can be used to express nucleic acid in dividing cells.
  • virus ⁇ based vectors can be used to express nucleic acid in non ⁇ dividing cells.
  • virus ⁇ based vectors can be used to express nucleic acid in both dividing cells and non ⁇ dividing cells.
  • Virus ⁇ based nucleic acid delivery vectors for delivering nucleic acid designed to express a mutant bHLH transcription factor polypeptide within the CNS of a living mammal can be derived from animal viruses, such as adenoviruses, adeno ⁇ associated viruses, retroviruses, lentiviruses, vaccinia viruses, herpes viruses, and papilloma viruses.
  • nucleic acid encoding a mutant bHLH transcription factor polypeptide can be delivered to astrocytes using adeno ⁇ associated virus (AAV) vectors (e.g., AAV serotype 2, AAV serotype 2/5, AAV serotype 2/8, AAV serotype 5, or AAV serotype 9 viral vector), lentiviral vectors, retroviral vectors, adenoviral vectors, herpes simplex virus vectors, or poxvirus vector.
  • AAV adeno ⁇ associated virus
  • nucleic acid encoding a mutant bHLH transcription factor polypeptide can be administered to a mammal using adeno ⁇ associated virus vectors to express the mutant bHLH transcription factor polypeptide in both dividing and non ⁇ dividing cells.
  • Examples of site ⁇ specific recombination elements that can be incorporated in the nucleic acid encoding the mutant bHLH transcripition are, without limitation, recombination target sites (e.g., LoxP sites), or flip ⁇ excision (FLEx) switches that modulate site ⁇ specific recombination of a nucleic acid.
  • recombination target sites e.g., LoxP sites
  • FLEx flip ⁇ excision
  • the choice of element(s) that may be included in a viral vector depends on several factors, including, without limitation, inducibility, targeting, the level of expression desired, and the desired recombination site.
  • the nucleic acid encoding one or more mutant bHLH transcription factor can be formulated in a non ⁇ viral vector.
  • non ⁇ viral vectors include, but are not limited to, lipoplexes, inorganic nanoparticles and naked or plasmid DNA.
  • Non ⁇ viral vectors typically do not rely on any viral component.
  • the non ⁇ viral vector is a transposon or mobile DNA element that can integrate the sequence encoding the one or more mutant bHLH transcription factor into target cell chromosomes.
  • the viral vector or non ⁇ viral vector nucleic acid for expression of one or more mutant bHLH transcription factor polypeptide can be formulated in nanocarriers or nanoparticles, such as, for example, DNA Trojan Horse, liposomes, or biomaterials (for a review of such delivery formulations, see, Khait NL, Ho E, and Shoichet MS, Advanced Functional Materials, special issue on Advanced Materials for Drug Delivery and Theranostics. (2021) 2010674: 1 ⁇ 32).
  • Such formulations can additionally incorporate targeting elements to specifically direct the nucleic acid to the target glial cells in the CNS.
  • Nucleic acids encoding a mutant bHLH transcription factor polypeptide can be produced by techniques including, without limitation, molecular cloning, polymerase chain reaction (PCR), chemical nucleic acid synthesis techniques, and combinations of such techniques.
  • PCR polymerase chain reaction
  • RT ⁇ PCR can be used with oligonucleotide primers designed to amplify nucleic acid (e.g., genomic DNA or RNA) encoding a mutant bHLH transcription factor polypeptide.
  • nucleic acid encoding a mutant bHLH transcription factor polypeptide into the appropriate location within a viral vector (e.g., AAV, such as AAV2/5, AAV2/8, AAV9) or a non ⁇ viral vector.
  • AAV a viral vector
  • Delivery of the nucleic acid for expression of one or more mutant bHLH transcription factor polypeptides to glial cells in a subject results in efficient expression of the mutant bHLH transcription factor polypeptide and subsequent reprogramming of the glial cells, without any, or with minimal, effect from environmental inhibitory controls.
  • any appropriate method can be used to deliver one or more mutant bHLH transcription factor polypeptide, or nucleic acid designed to express one or more mutant bHLH transcription factor polypeptide, to glial cells within the CNS (e.g., astrocytes).
  • compositions described herein that contain one or more mutant bHLH transcription factor polypeptide, or nucleic acid designed to express one or more mutant bHLH transcription factor polypeptide can be administered to glial cells within the CNS (e.g., astrocytes), such as within the cerebral cortex via, for example, direct intracranial administration, intrastriatal injection, intracerebroventricular injection, intracisternal injection, intraparenchymal injection, intrathecal injection, intraperitoneal administration, intravenous administration, intra ⁇ arterial, intranasal administration, intramuscular administration, or oral administration in nanoparticles and/or drug tablets, capsules, or pills.
  • CNS e.g., astrocytes
  • a mutant bHLH transcription factor polypeptide, or nucleic acids designed to express a mutant bHLH transcription factor polypeptide, or any combination thereof can be administered to a mammal (e.g., a human) having a neurodegenerative disease or disorder, or a CNS injury (e.g., stroke) to treat or prevent the disease or disorder or to treat the injury.
  • a mammal e.g., a human
  • a CNS injury e.g., stroke
  • the administered mutant bHLH transcription factor(s) or expressed mutant bHLH transcription factor(s) functions to treat or prevent the neurodegenerative disease or disorder, or to treat the injury, by converting glial cells (e.g., astrocytes in the CNS) into neurons, rebalancing neuron:glia ratios, rebalancing excitation:inhibition, repairing damaged brain tissue, reducing glial scar, reducing neuroinflammation, restoring the blood ⁇ brain ⁇ barrier, and/or reducing the amount of toxic microglia.
  • the method for treatment or prevention of the neurodegenerative disease or disorder, or for treatment of the injury can comprise expression of two or more mutant bHLH transcription factor polypeptide, in parallel or in sequence.
  • mutant bHLH transcription factor polypeptide or the nucleic acid designed to express a mutant bHLH transcription factor polypeptide, or any combination thereof can be administered to a mammal (e.g., a human) having, or at risk of developing, ALS.
  • the administered or expressed mutant bHLH transcription factor polypeptide(s) functions to treat or prevent ALS in the mammal, by converting glial cells (e.g., astrocytes) into functional neurons, rebalancing neuron:glia ratios, rebalancing excitation:inhibition, repairing damaged brain tissue (e.g., repairing neuronal degeneration in the motor cortex and/or spinal cord), reducing pathogenic TDP ⁇ 43 protein aggregation, and/or reducing neuroinflammation.
  • the method for treatment or prevention of ALS can comprise administration or expression of two or more mutant bHLH transcription factor polypeptide, in parallel or in sequence.
  • mutant bHLH transcription factor polypeptide or the nucleic acid designed to express a mutant bHLH transcription factor polypeptide, or any combination thereof can be administered to a mammal (e.g., a human) having or at risk of developing Alzheimer's Disease (AD).
  • a mammal e.g., a human having or at risk of developing Alzheimer's Disease (AD).
  • AD Alzheimer's Disease
  • the administered or expressed mutant bHLH transcription factor polypeptide functions to treat or prevent AD in the mammal, by converting glial cells (e.g., astrocytes) into neurons, in particular glutamatergic and GABAergic neurons, rebalancing excitation:inhibition, rebalancing neuron:glia ratios, reducing neuroinflammation, increasing hippocampal neuronal connectivity, increasing microglial association with plaques and/or stimulating amyloid plaque clearance.
  • the method for treatment or prevention of AD can comprise administration or expression of two or more mutant bHLH transcription factor polypeptide, in parallel or in sequence.
  • the mutant bHLH transcription factor polypeptide or the nucleic acid designed to express a mutant bHLH transcription factor polypeptide, or any combination thereof can be administered to a mammal (e.g., a human) following a brain injury, such as stroke.
  • the administered or expressed mutant bHLH transcription factor polypeptide functions to treat the injury in the mammal, by converting glial cells (e.g., astrocytes) into neurons, for example, glutamatergic and GABAergic neurons, rebalancing excitation:inhibition, rebalancing neuron:glia ratios, reducing scar formation, reducing neuroinflammation, increasing neuronal connectivity, increasing neuroplasticity.
  • the method for treatment of stroke can comprise administration or expression of two or more mutant bHLH transcription factor polypeptide, in parallel or in sequence.
  • composition(s) comprising the herein disclosed nucleic acid(s), vector(s), and/or protein(s).
  • the composition may be a pharmaceutical composition that comprises one or more pharmaceutically acceptable diluents, excipients, carriers or the like.
  • the brain e.g., the cerebral cortex
  • a mammal e.g., a living mammal
  • a mammal e.g., a living mammal
  • Any appropriate method can be used to determine whether or not a disease or disorder, or a brain injury, present within a mammal is being effectively treated.
  • imaging techniques and/or laboratory assays can be used to assess the number astrocytes and/or the number of neurons present within a mammal's brain.
  • imaging techniques and/or laboratory assays can be used to assess whether or not any mutant bHLH transcription factor ⁇ mediated effects (e.g., converting glial cells (e.g., astrocytes) into functional neurons, rebalancing neuron:glia ratios, repairing damaged brain tissue (e.g., reducing glial scar formation), reducing neuroinflammation, restoring the blood ⁇ brain ⁇ barrier, restoring the neurovascular unit, reducing the amount of toxic microglia, increasing hippocampal neuronal connectivity, increasing microglial association with plaques and/or stimulating amyloid plaque clearance) are observed.
  • imaging techniques and/or laboratory assays can be used to assess mutant bHLH transcription factor ⁇ mediated effects can be as described in the Examples.
  • kits that include one or more mutant bHLH transcription factor polypeptide described herein (e.g., Neurog2 ⁇ SA9, Ascl1 ⁇ SA6, Neurod4 ⁇ SA3/TA4, Neurod1 ⁇ SA6 or any combination thereof) or nucleic acid encoding one or more mutant bHLH transcription factor polypeptide described herein.
  • the kits also can include instructions for performing any of the methods described herein. In some cases, the kits can include at least one dose of any of the compositions described herein.
  • kits can provide a means (e.g., a syringe) for administering any of the compositions described herein.
  • a means e.g., a syringe
  • the kits can provide a means (e.g., a syringe) for administering any of the compositions described herein.
  • a means e.g., a syringe
  • the following examples are set forth. It should be understood that these examples are for illustrative purposes only. Therefore, they should not limit the scope of this invention in any way.
  • EXAMPLES [00163] EXAMPLE 1: Neuronal lineage conversion for ALS therapy [00164] Amyotrophic lateral sclerosis (ALS) is a terminal neurodegenerative disease that results in a loss of motor neurons in the brain and spinal cord, leading to a deterioration of motor function and ultimately culminating in death.
  • ALS Amyotrophic lateral sclerosis
  • neuronal lineage conversion of motor cortex astrocytes was studied as a means to delay disease progression using hSOD1 G93A transgenic mice, which express a human SOD1 transgene carrying a G93A mutation that is found in ALS patients.
  • To promote astrocyte to neuron conversion mis ⁇ expression of a modified form of the proneural gene Ascl1 in which six serines were converted to alanines (Ascl1 ⁇ SA6), enhances neuronal conversion rates in the embryonic brain.
  • Gene delivery was achieved using adeno ⁇ associated virus (AAV) 2/5 as a vector, under the control of a glial fibrillary acidic protein (GFAP) promoter. It was first confirmed that Ascl1 ⁇ SA6 could convert cortical astrocytes to neurons more efficiently than Ascl1. Then the effects of mis ⁇ expressing Ascl1 ⁇ SA6 in cortical astrocytes on disease progression were monitored, revealing that hSOD1 G93A transgenic mice were better able to maintain their body weight, retained a better (i.e., lower) neuroscore, and had signs of improved motor function. Taken together, these data demonstrate that neuronal lineage conversion targeted to motor cortex astrocytes can be used as a therapeutic strategy for the treatment of ALS.
  • AAV adeno ⁇ associated virus
  • GFAP glial fibrillary acidic protein
  • ALS is associated with the death of upper motor neurons in the motor cortex and their innervation targets, lower motor neurons in the brainstem and spinal cord, which innervate skeletal, visceral and cardiac muscles 1,2 .
  • the loss of lower motor neurons causes muscle denervation, muscle atrophy, and ultimately death 2 .
  • Most studies of this disease focused on the pathology seen in spinal cord motor neurons, but recent evidence supports a dying forward model, in which neuronal degeneration begins in the motor cortex and then proceeds to the spinal cord.
  • TMS transcranial magnetic stimulation
  • hSOD1 G93A transgenic mice an animal model of ALS, dendritic regression, spine loss and hyperexcitability are observed in the motor cortex before symptom onset at postnatal day (P) 30 4 .
  • the dying ⁇ forward model also proposed that pathology in the motor cortex may not only precede spinal cord disease, but also drives the disease forward. As a corollary to this model, it has been suggested that by preventing the death of upper motor neurons, disease progression could be stalled. Consistent with this finding, knockdown of mutant SOD1 in the motor cortex of hSOD1 G93A rats prior to symptom onset delays disease progression, increases survival, and delays lower motor neuron and neuromuscular junction degeneration 5 .
  • hSOD1 G93A transgenics which differentiate into astrocytes secreting glial cell ⁇ derived neurotrophic factor (GDNF), delays both upper and lower motor neuron death 6 .
  • GDNF glial cell ⁇ derived neurotrophic factor
  • Proneural genes including Neurog1, Neurog2, Ascl1 and Neurod4, encode bHLH transcription factors (TFs) that have emerged as critical architects of neurogenesis in the embryonic brain and neuronal reprogramming in the adult 9 .
  • TFs bHLH transcription factors
  • These bHLH genes act in transcriptional cascades, turning on other bHLH genes, such as Neurod1, which functions at later developmental stages to control neuronal differentiation.
  • these bHLH genes are not active in all cellular contexts, and can be inhibited by environmental signals.
  • Neurog2 is only sufficient (by gain ⁇ of ⁇ function 10 ) and necessary (by loss ⁇ of ⁇ function) to specify a glutamatergic neuronal fate between embryonic day (E) 11.5 to E14.5, despite continued expression at later stages during the neurogenic period, which ends at E17 11 ⁇ 13 .
  • One way that proneural bHLH TF function is inhibited is by phosphorylation by proline ⁇ directed serine threonine kinases (e.g.
  • GSK3, ERK1/2, Cdks which act in a “rheostat ⁇ like fashion”; the more serine ⁇ proline (SP) or threonine ⁇ proline (TP) sites phosphorylated, the less capable these TFs are to bind DNA and transactivate their target genes to promote neuronal fate specification and differentiation 10,14 ⁇ 16 .
  • SP serine ⁇ proline
  • TP threonine ⁇ proline
  • mutation of six serines (SP) to alanines (SA) to generate Ascl1 ⁇ SA6 reduced the pro ⁇ proliferative/gliogenic activity of Ascl1 so that it almost exclusively promotes neurogenesis 16 .
  • Neurog2 is phosphorylated by GSK3 on SP sites, which reduces Neurog2 proneural activity. When Neurog2 phosphorylation is inhibited, Neurog2 has a more robust proneural activity, even at E14.5 of development.
  • the cell context ⁇ dependent activities of the proneural genes extends to the adult brain and neuronal reprogramming: Ascl1 can efficiently drive neuronal lineage conversion of fibroblasts 17 ⁇ 22 , hepatocytes 23 , cardiomyocytes 24 , astrocytes 25 and the differentiation of pluripotent cells 26 , but Ascl1 is less efficient in the adult neocortex 27 , hippocampus and spinal cord 28,29 .
  • Neurog2 is used less often for neuronal reprogramming as it must be combined with other signals to become a potent lineage converter 30 .
  • Ascl1 ⁇ SA6 modified version of Ascl1, termed Ascl1 ⁇ SA6, which was designed such that it would not be subject to environmental inhibitory controls, under the control of an astrocytic promoter (i.e., GFAP).
  • Methods [00173] Animals and genotyping. Animal procedures were approved by the Sunnybrook Research Institute (21 ⁇ 757) in compliance with the Guidelines of the Canadian Council of Animal Care.
  • hSOD1 G93A (B6.Cg ⁇ Tg(SOD1*G93A)1Gur/J, JAX #008230) and Rosa ⁇ ZsGreen (JAX #007906) mice were purchased from Jackson Laboratory and maintained on a C57BL/6 background. Mice were housed in cages under 12:12 hour light/dark cycles with ad libitum access to food and water. PCR primers and conditions for genotyping were conducted using Jackson Laboratory protocols: hSOD1 G93A forward: CAT CAG CCC TAA TCC ATC TGA (SEQ ID NO: 26); reverse: CGC GAC TAA CAA TCA AAG TGA (SEQ ID NO:27).
  • Rosa ⁇ ZsGreen wild ⁇ type forward: CTG GCT TCT GAG GAC CG (SEQ ID NO: 28); wild ⁇ type reverse: AAT CTG TGG GAA GTC TTG TCC (SEQ ID 29); mutant forward: ACC AGA AGT GGC ACC TGA C (SEQ ID NO: 30); mutant reverse: CAA ATT TTG TAA TCC AGA GGT TGA (SEQ ID NO: 31).
  • hSOD1 G93A mice were monitored closely for symptoms, including weekly body weight measurements and daily behavioural assessment to determine disease progression. Disease onset and progression measures was monitored using an ALSTDI ⁇ Neuroscore. As detailed in Hatzipetros, T., Kidd, J. D., Moreno, A.
  • Assign NS 1 First symptoms if the following is observed: When the mouse is suspended by the tail, the hindlimb presents an abnormal splay, i.e., it is collapsed or partially collapsed towards lateral midline OR it trembles during tail suspension OR it is retracted/clasped. When the mouse is allowed to walk, normal OR slightly slow gait is observed. 3. Assign NS 2 (Onset of paresis) if the following is observed: When the mouse is suspended by the tail, the hindlimb is partially OR completely collapsed, not extending much. (There might still be joint movement).
  • AAV2/5 ⁇ GFAP ⁇ iCre and AAV2/5 ⁇ GFAP ⁇ Ascl1 ⁇ SA6 ⁇ t2a ⁇ iCre were cloned by GenScriptTM and packaged by VectorBuilderTM Inc.
  • Intracranial injection of AAVs were cloned by GenScriptTM and packaged by VectorBuilderTM Inc.
  • mice 16 ⁇ week ⁇ old C57BL/6 (littermate control) or hSOD1 G93A mice were anaesthetized using isoflurane (2%, 1L/min) and injected subcutaneously with buprenorphine (0.1 mg/kg), baytril (2.5 mg/kg), and saline (0.5 ml). A burr hole was drilled through the skull over the motor cortex and a stereotax was used to identify bregma and lambda levels for injection (AP: +2.15 mm, L/M: ⁇ 1.7 mm, DV: ⁇ 1.7mm).
  • AAV2/5 ⁇ GFAP ⁇ iCre or AAV2/5 ⁇ GFAP ⁇ Ascl1 ⁇ SA6 ⁇ 2a ⁇ iCre were injected at 1.0x10 12 /ml in a 1 ⁇ L total volume at 0.1 ⁇ l/min over the span of 10 mins using a 5 ⁇ l Hamilton syringe with 30 ⁇ gauge needle. 21 days later, animals were sacrificed and tissues were harvested as described. Disease progression was measured by checking their body weight, NS, motor behavior test (Rotarod, grip strength, and gait analysis) until the experimental endpoint. When mice were not able to right themselves within 30 sec after being placed on either side, they were sacrificed. [00178] Tissue processing and sectioning.
  • mice were anesthetized with ketamine (75 mg/kg) and xylazine (10 mg/kg) prior to perfusion.
  • Intracardial perfusion was performed with approximately 20x of their blood volume using a peristaltic pump at a flow rate of 10 ml/min with ice cold saline (0.9% NaCl), followed by 4% paraformaldehyde (PFA) in phosphate buffer saline (PBS) for approximately five minutes.
  • Brains and spinal cords were collected and post ⁇ fixed overnight in 4% PFA in PBS, cryoprotected at 4oC in 20% sucrose/1X PBS overnight, embedded in O.C.T. compound (Tissue ⁇ Tek® O.C.T.
  • Coronal brain sections were cut at 30 ⁇ m on a Leica CM3050TM cryostat (Leica Microsystems Canada Inc., Richmond Hill, ON, Canada) and collected on FisherbrandTM SuperfrostTM Plus Microscope Slides (Thermo Fisher Scientific, Ottawa, ON, Canada). [00179] Immunostaining. Slides were washed in PBS, then incubated for 1 hour at room temperature in 10% horse serum (HS), 0.075% bovine serum albumin (BSA), and 0.3% Triton ⁇ X ⁇ 100 in PBS.
  • HS horse serum
  • BSA bovine serum albumin
  • Blocking was followed by an overnight incubation at 4 °C with rabbit anti ⁇ GFAP (1:500, #G9260, Sigma Aldrich Canada, Mississauga, ON, Canada) in antibody solution (10% HS, 0.75% BSA, and 0.1% Triton ⁇ X ⁇ 100 in PBS).
  • RNA ⁇ in situ hybridization was performed using a digoxygenin ⁇ labeled Ascl1 riboprobe as previously described 31 .
  • Fluorescent RNA ⁇ ISH was performed using an RNAscope ® Multiplex Fluorescent Detection Kit v2 (ACD #323110) following the manufacturer's instructions. Briefly, brain sections were post ⁇ fixed (4% PFA/1XPBS) for 15 min at 4°C, and then, at room ⁇ temperature, dehydrated in 50%, 70% and 100% ethanol for 5 min each, and incubated in H 2 O 2 solution for 10 min.
  • RNA probes (Mm ⁇ Ascl1 #313291 and provided negative and positive control probes) were incubated on the sections for 2 hrs at 40°C. Amplification and staining steps were completed following the manufacturer's instructions, using an Opal TM 570 (Akoya #FP1488001KT; 1:1500) fluorophore.
  • Imaging To calculate volume of brain targeted with the gene therapy, a Zeiss AxioscanTM Slide Scanner was used.
  • mice were trained on the rotarod one week before recording the data. Mice were placed onto a cylinder and rotation started with 2rpm. Within 180 sec the rotation speed increased up to 18rpm over a min. with the occurrence of motor neuron symptoms animals get weaker and fall onto the sensing platforms. The time of drop is sensed by magnetic switches and shown on the display at the end of the experiment [00184]
  • Grip strength A grip strength meter (BiosebTM) was used to study neuromuscular function. Mice were held by the tail over a 100 x 80 mm at an angle of 20° grid holder. Once mice were firmly grasping the grid, they were pulled along the axis of the force sensor until they released the grid.
  • Gait abnormalities The footprint pattern of mice was monitored as they walked along a 50 cm long and 10 cm wide runway. Forelimbs were painted with a red dye and hindlimbs were painted with a blue dye. Footprint patterns were analyzed for three step parameters: 1) stride length, to measure the average distance of forward movement between each stride; 2) sway distance, to measure the average distance between left and right hind footprints; 3) stance length, to measure the average distance from left or right front footprint to right or left hind footprint. [00186] Quantification and statistics. Statistical analyses were conducted using GraphPad PrismTM Software.
  • Ascl1 To make the proneural gene Ascl1 insensitive to inhibitory cues in the environment (especially in an injury or neurodegenerative disease), a mutant form of Ascl1 mutant was engineered in which the six nucleotides encoding serines (S) adjacent to prolines in Ascl1 were replaced with alanines (A), referred to herein as Ascl1 ⁇ SA6. Ascl1 (wild ⁇ type, unmodified gene), Ascl1 ⁇ SA6 or Neurod1, as a control, were cloned into an AAV2/5 vector, under the control of an astrocytic promoter (GFAP), that also carried a t2a ⁇ iCre cassette.
  • GFAP astrocytic promoter
  • the AAV vectors were injected intracranially into the motor cortex of Rosa ⁇ tdtomato mice, a cre ⁇ reporter line, which allowed the fate of transduced neurons to be followed. Three weeks later, brains were dissected and sectioned and immunostained with tdtomato and NeuN antibodies. Strikingly, it was found that while Ascl1 and Neurod1 had similar conversion efficiencies of ⁇ 50%, the mis ⁇ expression of Ascl1 ⁇ SA6 nearly reached a 75% neuronal conversion efficiency (i.e., %NeuN + tdtomato + /tdtomato + cells) (Figure 1).
  • AD Alzheimer's disease
  • a ⁇ amyloid beta peptide
  • neurofibrillary tangles formation of neurofibrillary tangles
  • neuronal loss 1 synaptic loss is postulated to initiate symptoms of AD and has provided the best neurophysiological correlate of cognitive decline to date 2,3 , suggesting that neuronal dysfunction is critical for disease progression.
  • Cognitive decline is not driven by disturbances in a few synapses in isolation, but by an aberration in the functioning of the entire neuronal network, which is assembled through interactions between excitatory, inhibitory and neuromodulatory cells. As disease progresses, loss of specific populations of cells exacerbates cognitive function and renders a point of no return for present therapeutic interventions.
  • Brain circuitry processes information by rapidly and selectively engaging specific subsets of neurons forming the neuronal networks. The dynamic formation of networks is often evident in rhythmically synchronized neuronal activity that tightly correlates with perceptual, cognitive, and motor performance 2 .
  • the spectral content of electrophysiological recordings is classically divided into frequency bands and oscillatory activities are related to global states or specific behaviors. Neural oscillations occur at various frequencies; important to AD are the theta waves (4 ⁇ 8 Hz), which are associated with motor behavior and memory formation, and gamma waves (30 ⁇ 200 Hz), which play a role in conscious thought. Importantly, theta and gamma oscillations interact via cross ⁇ frequency coupling during normal network communication. The impaired cognitive functions associated with AD in both humans and rodents are related to temporal modulation of theta oscillations and theta ⁇ gamma coupling 9,10 which depends on the balance between excitatory and inhibitory neuronal activity.
  • the phase of theta oscillations affects memory processing through modulation of neuronal plasticity (i.e., neuronal changes in response to experience) and induction of long ⁇ term ⁇ potentiation in hippocampal and cortical areas (i.e., strengthening of neuronal synapses, or connections to other neurons, based on patterns of activity).
  • a variety of cognitive processes including working memory, modulates gamma oscillations 11,12 , which are in turn modulated by theta oscillations 13 : this modulation of gamma by theta is known to depend on an intact inhibitory network of gamma ⁇ aminobutyric acid (GABAergic) interneurons.
  • GABAergic gamma ⁇ aminobutyric acid
  • GABAergic interneurons There are several types of GABAergic interneurons characterized by their expression of neuropeptides and calcium binding proteins. Memory acquisition requires changes in firing patterns of parvalbumin (PV) and somatostatin (SST) expressing hippocampal (GABAergic) interneurons 14,15 . These inhibitory interneuronal sub ⁇ populations control the activity of hippocampal excitatory granule cells, with PV ⁇ expressing interneurons targeting granule cell soma and axon segments to control the action potential output of granule cells while SST ⁇ expressing cells target dendrites to control input to granule cells 16 .
  • PV parvalbumin
  • SST somatostatin
  • GABAergic targeting drugs as well as exogenous stem cell replacement have shown promise in rodent models of AD for improving memory, but they have resulted in severe side ⁇ effects in patients.
  • GABAergic modulating drugs often induce sedative or anxiolytic side effects, and their chronic administration is associated with worsening of cognitive function with aging 21 .
  • GABAergic drug interventions may have a limited temporal window of action as interneurons continue to deteriorate.
  • GABAergic drug interventions may have a limited temporal window of action as interneurons continue to deteriorate.
  • progenitor cells from the medial ganglionic eminence of the embryonic ventral telencephalon has demonstrated the potential to induce appropriate sub ⁇ type specific interneurons in various disease states, supporting the potential of cell replacement therapies 28,29 .
  • a more accessible and safer source of GABAergic neurons is required.
  • a potentially safer alternative is to convert endogenous cells into neurons by direct neuronal reprogramming using supra ⁇ physiological expression of lineage ⁇ specific transcription factors 31 ⁇ 33 .
  • the present treatment strategy is to rebalance the neuronal network by AAV ⁇ delivered transcription factor induction of transdifferentiation of endogenous activated astrocytes into fully integrated GABAergic neurons that respond appropriately to environment signals.
  • spatial memory representations of the neuronal network are related to temporal modulation of theta oscillations and theta ⁇ gamma coupling.
  • AD patients present a reduced coupling of resting state EEG rhythm; and coupling of cortical rhythms at specific frequency bands may be a specific marker of AD.
  • loss of GABAergic interneuron function and ultimately cell loss results in neuronal network dysfunction and contributes to cognitive dysfunction.
  • restoration of GABAergic interneuron function will rebalance excitatory ⁇ inhibitory neurotransmission leading to improved cognitive function.
  • the proneural transcription factors, Ascl1, Ascl1 ⁇ SA6, Neurod1 were transiently expressed in reactive, GFAP+ astrocytes to induce transdifferentiation to fully functional and integrated GABAergic neurons within the hippocampal region.
  • astrocytes are not only reactive but also proliferative; reactive astrocytes activated under different pathological conditions have been shown to exhibit different proliferation rates.
  • stab injury reactive astrocytes can be highly proliferative, whereas reactive astrocytes in APPPS1 or CK/p25 mice have lower rates of proliferation 42 .
  • This lower proliferation may actually be a benefit in AD, as the aim is to rebalance the network not produce an overpopulation of inhibitory cells that would change the balance from predominantly excitatory to inhibitory, which could also be detrimental.
  • AD affects both males and females
  • 4 sex ⁇ balanced groups of Tg344 AD and nTg (non ⁇ transgenic) rats were used: 1) AAV2/8 ⁇ mCherry control virus infected and 2) AAV2/8 ⁇ Ascl1 ⁇ mCherry infected or Ascl1 ⁇ SA6 or Neurod1.
  • AAV2/8 prefers neurons in prenatal and post ⁇ natal rodents, it targets astrocytes in adult animals 40 , which in conjunction with GFAP promoter increases vector specificity.
  • GABAergic neuronal loss occurs in the hippocampus and, in particular, in the hilus in early stages of disease, activated astrocytes were infected using stereotactic injections as dictated by disease state. Although invasive, this strategy allows for controlled delivery of a finite viral load within a defined location such that it is possible to determine the role of GABAergic loss in each hippocampal region individually and in concert.
  • Some studies have examined astrocyte transdifferentiation to glutamatergic neurons at 3 weeks post viral infection 40 ; while other studies have suggested that maturation of GABAergic neurons occurred 28 ⁇ 42 days post infection 54 : therefore, the present assays were performed at 4 ⁇ and 7 ⁇ weeks post ⁇ infection.
  • Viral infection was initiated at the stage following significant overt GABAergic neuronal loss, at 9 and 14 months of age.
  • Viral Administration To induce lineage conversion in the transgenic AD rat model, AAV2/8 ⁇ Ascl1 ⁇ mCherry and AAV2/8 ⁇ mCherry (control) vectors were used initially. These vectors were previously shown to promote the transdifferentiation of astrocytes into neurons in the dorsal midbrain 41 .
  • AAV2/5 vectors were then used for the comparison of the proneural transcription factors as this was subsequently shown to be more efficient within the CNS. Furthermore, due to the inclusion of the iCre, the mCherry tag was not necessary in the vectors. [00213] Stereotaxic injections of AAV ⁇ GFAP ⁇ proneural transcription factor vectors were made into the hilus of each hemisphere of the hippocampus of anesthetized TgF344 ⁇ AD rats and their nTg littermates through a burr hole drilled through the skull.
  • Diffusion of AAV is limited by interstitial fluid flow changes as a function of the stereotactic injection and AAV has a short half ⁇ life in the extracellular space as it is removed by glymphatic drainage 65,66 . Since the goal of this project was to rebalance the excitatory/inhibitory activity within the hippocampal network and GABAergic neurons account for only 10% of the neuronal population, the goal was to obtain sufficient but limited numbers of mCherry+NeuN+GAD67+ neurons. Viral titres of 4.0x10 8 and 1.2x10 9 were used and it was found that the lower viral titre was more conducive to a limited conversion rate and a benefit to the neuronal network.
  • a two ⁇ shank linear multielectrode array (LMA) was lowered into each window.
  • Each shank was equipped with two platinum/iridium recording site (200 ⁇ m in diameter, MicroprobesTM for LifeScience). Resting state local field potentials were amplified between 0.3 Hz and 5 kHz, sampled at 20 kHz and stored for analysis.
  • the frequency bands of interest (Theta (3 ⁇ 9 Hz), Alpha (10 ⁇ 14 Hz), Beta (15 ⁇ 30 Hz), low Gamma (30 ⁇ 58) and high Gamma (62 ⁇ 120 Hz)), have been hypothesized to arise from dynamic motifs that are based on structural circuits and to dictate behavioural function after input ⁇ output transformation 67 .
  • High Gamma activity is modulated by sensory, motor, and cognitive events, is functionally distinct from low gamma, and has distinct physiological origins 68 .
  • the phenomenon by which one frequency band can modulate the activity of a different frequency band has been observed in both animal and human data and is termed cross ⁇ frequency coupling 69 .
  • the phase of theta wave can modulate the amplitude of gamma bands and this phenomenon, named phase ⁇ amplitude coupling, can be resolved with intracortical local field potential 52,70,71 .
  • MI Modulation Index
  • Pathological Characterization To evaluate GABAergic interneuronal loss/rescue, global GAD65/67, neuropeptide expression including SST, NPY, CCK, and VIP, as well as GABA A (fast inhibition) and GABA B (slow inhibition) receptor subunit expression was quantified using Western blot analyses 20 . It was determined whether the GABAergic neuronal populations, GAD67+, are fully matured using co ⁇ expression with NeuN. The expression and colocalization of GABA to mCherry + cells was examined immunohistochemically. Evaluation of AD ⁇ related outcomes and confirmation of the effect size immunohistochemical analyses of amyloid plaques, was done following previously described protocols 53,63,86 .
  • the rat strain has been used as a model of normal aging for the last 40 years 43 , thus having known temporal evolution of cognitive deficits 44,45 .
  • Six to eight month old F344 rats exhibit subtle executive function deficits, but no memory deficits 46 .
  • these rats show an age ⁇ dependent increase in rat A ⁇ accumulation, reduced A ⁇ brain ⁇ to ⁇ blood efflux, and decreased cholinergic synaptic function that has been correlated with cognitive dysfunction, similar to that reported in the aging human population 43 ⁇ 46 .
  • the cognitive and amyloid phenotype in the colony used in the present study has been demonstrated and aligns well with the original publication on this model 8 .
  • the animals have no amyloid plaques at 3 months of age; some parenchymal plaques at 6 months of age; and cerebrovascular amyloid angiopathy, tau hyperphosphorylation, and amyloid tissue plaques by 9 months of age (Figure 7).
  • the TgF344 AD rats exhibited normal activities of daily living and cognition up to 6 months of age.
  • the TgAD animals showed deficits in open field test, in burrowing activity and in the Barnes Maze task (Figure 7C).
  • the neuronal marker NeuN was used to label the nuclei of post ⁇ mitotic neurons 47 .
  • Qualitative analysis of NeuN immunohistochemical staining showed comparable number of NeuN+ cells in the hippocampus of 12 ⁇ month old TgF344 AD rats and their non ⁇ transgenic (nTg) littermates, as shown previously ( Figure 8). Accordingly, the levels of pre ⁇ synaptic proteins, synaptophysin, syntaxin, and synaptotagmin as well as the post ⁇ synaptic protein PSD95 were indistinguishable between the two cohorts (Figure 8). The majority of hippocampal neurons are excitatory, and about 10% are inhibitory GABAergic interneurons.
  • GAD Glutamic acid decarboxylate
  • the neuropeptides expressed by GABAergic interneurons include cholecystokinin (CCK), somatostatin (SST), vasoactive intestinal polypeptide (VIP), and neuropeptide Y (NPY).
  • the calcium binding proteins are parvalbumin (PV), calbindin, and calretinin (CR).
  • GABA A and GABA B were examined.
  • GABA A receptors have been implicated in disease states including AD 49 .
  • GABA A receptors are composed of multiple subunits with the most common type in the brain being a pentamer with combinations of 2 ⁇ x, 2 ⁇ x and 1 ⁇ x subunits.
  • GABA A receptors are localized either intra ⁇ synaptically or extra ⁇ synaptically, mediating phasic and tonic inhibition, respectively.
  • Subunit ⁇ 1 is a part of intra ⁇ synaptic receptors; ⁇ 5 can be either intra ⁇ synaptic or extra ⁇ synaptic; whereas ⁇ subunit is exclusively extra ⁇ synaptic 49,50 .
  • Increased expression of ⁇ 5 and ⁇ but not ⁇ 1 GABA A receptor subunits was observed when comparing TgF344 AD to nTg rats suggesting an increase in tonic inhibition (Figure 10). Although GABAergic interneuronal deficits have been previously reported in different AD rodent models, the sub ⁇ type level changes, as classified by neuronal neuropeptide and calcium binding protein expression, vary depending on transgene(s) expression.
  • CFC Cross Frequency Coupling
  • GFAP is a stable structural protein with a slow turnover rate and since mCherry expression is governed by the GFAP promoter it will also decrease over time due to lack of translation.
  • AAV2/8 ⁇ Ascl1 ⁇ mCherry infected hemisphere had extensive mCherry+NeuN+ double ⁇ labelled cells located in the region populated by reactive astrocytes. Based on the morphological characteristics and location of the mCherry+NeuN+ cells, it is proposed that these cells are immature and have not migrated and fully integrated into the neuronal network.
  • Ascl1 preferentially promotes the differentiation of GABAergic and oligodendroglial cells depending on environmental cues whereas Neurod1 preferentially promotes glutamatergic neuronal fate.
  • these transcription factors are controlled by the phosphorylation of serine/threonine residues throughout the sequence that results in inactivation of the transcription factors at precise developmental stages.
  • alanine residues were incorporated in all 6 of the serine phosphorylation sites normally used to turn off Ascl1 activity (S to A point mutations).
  • Ascl1 ⁇ SA6 expression resulted in ⁇ 50% reduction in astrocytes while Ascl1 reduced astrocytes by 15% and Neurod1 only reduced astrocytes by 5%.
  • the loss of reactive astrocytes appeared to be of a lower fold change than that of the increase of neurons for Ascl1 and Neurod1 induced transdifferentiation, however, reactive astrocytes were decreased.
  • some of the reactive astrocytes may have transdifferentiated into neurons while others may represent quiescent phenotypes that do not contribute to AD pathology.
  • Amyloid is degraded by activated microglial cells surrounding plaques while soluble amyloid ⁇ beta peptide is degraded by non ⁇ plaque associated microglial cells.
  • an anti ⁇ 4G8 antibody which is specific for amino acid residues 17 ⁇ 24 of A ⁇ peptides and an anti ⁇ IBA ⁇ 1 antibody
  • pathological tissues were used to quantify IBA ⁇ 1+4G8+ cells (Figure 19). Although there was an increase of approximately 60% in IBA ⁇ 1+4G8+ cells following lineage reprogramming with Neurod1, this was not significant from na ⁇ ve transgenic rats. Rats that received Ascl1 exhibited significant increases in plaque ⁇ associated microglia with a fold ⁇ change of approximately 1.7x.
  • Ascl1 ⁇ SA6 resulted in decreases in four factors indicative of astrogliosis ⁇ reductions in GFAP+ cells, S100 ⁇ + cells, C3+ astrocytes and changes in astrocytic morphology.
  • Previous studies have shown that in CNS diseases, astrocytic and microglial activation results in an upregulation of an inflammatory gene signature. This results in RIPK1 activation in neurons and eventual cell death. In fact, RIPK1 inhibition results in abatement of AD pathology and prevents neuronal cell death in mouse models.
  • Ascl1 ⁇ SA6 reduction in reactive astrocytes altered the hippocampal environment such that amyloid plaque load clearance was endogenously stimulated.
  • the decrease in amyloid plaques was accompanied by increased microglial association with plaques, which is one mechanism to decrease plaque load within the brain.
  • the parenchymal environment in the hippocampus was shifted towards a homeostatic phenotype as illustrated by the morphological changes in astrocytes and microglial cells, decrease in inflammatory mediators, S100 ⁇ and C3, and reduced necrotic neurons.
  • RAS/ERK signaling controls proneural genetic programs in cortical development and gliomagenesis. J Neurosci. 2014, 34, 2169–2190. 60. Masserdotti G, et al., Transcriptional Mechanisms of Proneural Factors and REST in Regulating Neuronal Reprogramming of Astrocytes. Cell Stem Cell. 2015, 17, 74–88. 61. Pang ZP, et al., Induction of human neuronal cells by defined transcription factors. Nature. 2011, 476, 220–223. 62. Treutlein B, et al., Dissecting direct reprogramming from fibroblast to neuron using single ⁇ cell RNA ⁇ seq. Nature. 2016, 534, 391–395.
  • Murlidharan G Samluski RJ, Asokan A. Biology of adeno ⁇ associated viral vectors in the central nervous system. Frontiers in Mol Neurosci 2014, 7, article 76, 1 ⁇ 9. 66. Murlidharan G, et al., Glymphatic fluid transport controls paravascular clearance of AAV vectors from the brain. J. Clin. Invest. Insight 2016, 1, e88034. 67. Womelsdorf T, et al., Dynamic circuit motifs underlying rhythmic gain control, gating and integration. Nature Neurosci 2014, 17, 1031 ⁇ 1039 68. Edwards E, et al., High gamma activity in response to deviant auditory stimuli recorded directly from human cortex.
  • Stroke is an ischemic injury that leads to a loss of neurons and glial cells, concomitant with gliosis at the site of injury and in the perilesional parenchyma. Stroke also results in mechanical and cellular alterations, as well as global changes in excitatory ⁇ inhibitory balance at the neuronal network level due to the loss, damage, and ectopic proliferation of neural cells. [00244] Introduction [00245] Stroke can happen at any age but it more prominent in the adult and aging population.
  • Stroke is one of the major contributors to the global burden of disease 4 .
  • a stroke occurs when blood flow to the brain is interrupted. This can happen through a hemorrhagic stroke ( ⁇ 15% of stroke cases), which occurs when a blood vessel in the brain ruptures, or through an ischemic stroke, which occurs when blood flow to the brain is occluded.
  • Ischemic strokes lead to increased pressure on the brain due to leaked blood and are associated with increased risk of mortality.
  • 5 Ischemic strokes are the most prevalent type of stroke, accounting for ⁇ 85% of total cases.
  • 6 Ischemic stroke results in decreased glucose and oxygen delivery to the brain, resulting in rapid cell neuronal cell death and leading to impaired neural function.
  • Ischemic stroke results in a loss of cells within minutes following stroke through mechanisms of excitotoxicity, calcium dysregulation, oxidative and nitrosative stress, cortical spreading depolarization, disruption of the blood ⁇ brain barrier (BBB), edema, and inflammation.
  • BBB blood ⁇ brain barrier
  • astrocytes activated astrocytes
  • 9 ⁇ 11 Reactive astrocytes upregulate the intermediate filament protein GFAP (Glial Fibrillary Acidic Protein) and along with proteoglycans and inflammatory cells (e.g., macrophages, microglia), form a dense barrier that surrounds the injured tissue.
  • GFAP Glial Fibrillary Acidic Protein
  • proteoglycans and inflammatory cells e.g., macrophages, microglia
  • tissue plasminogen activator is an FDA approved treatment for stroke that breaks down blood clots to restore flow and in turn, prevent further cell loss after the initial insult.
  • tPA tissue plasminogen activator
  • Stroke is an ideal target for cell ⁇ based therapies due to the need for therapeutic interventions to replace lost cells, expand the therapeutic window, and ultimately promote functional recovery.
  • the conversion of resident brain cells to new neurons, to replace those lost to injury, is an attractive approach for brain repair.
  • the non ⁇ progressive nature of the stroke insult likely affords cellular reprogramming the greatest potential for a single dose gene therapy. Once the injured brain has been resolved, treatment ensues and neurons are replaced, leading to functional recovery and the opportunity of “regression” is less likely.
  • recent studies have highlighted astrocyte heterogeneity following stroke 15 , and have identified subpopulations of “toxic” astrocytes within the glial scar which can contribute to neuronal cell death.
  • the present study uses a modified version of the proneural gene Ascl1, termed Ascl1 ⁇ SA6, which has been designed such that it will not be subject to environmental inhibitory controls that would be found in the stroke injured brain.
  • the efficacy of astrocyte to neuronal conversion was examined and compared using the native Ascl1 gene (wild type) and Ascl1 ⁇ SA6 (mutant) in the stroke injured brain in a subacute model of ischemic stroke.
  • the functional outcomes following cellular reprogramming was compared in two models of focal ischemic stroke using Ascl1 and Ascl1 ⁇ SA6 under the control of an astrocytic promoter (i.e., GFAP).
  • Methods [00254] Stroke model.
  • Stroke is an ischemic injury that leads to a loss of neurons and glial cells, with astrogliosis at the site of injury and in the perilesional parenchyma.
  • ET ⁇ 1 is a vasoconstricting peptide that induces a focal ischemic injury, astrocyte reactivity and persistent motor deficits, making it ideal for recovery studies.
  • mice including R26R ⁇ YFP (Jackson Labs: B6.129X1 ⁇ Gt(ROSA)26Sortm1(EYFP)Cos/J) and R26R ⁇ tdTomato (Jackson Labs: Gt(ROSA)26Sor tm9(CAG ⁇ tdTomato)Hze ) Cre ⁇ conditional transgenic mice and C57/Bl6 mice. Briefly, mice were anaesthetized using isoflourane and placed onto a stereotaxic apparatus. The scalp was incised and a small hole was drilled into the skull at the injection locations (above).
  • ET ⁇ 1 dissolved in sterile PBS was injected using a bevel tip 26 ⁇ gauge Hamilton syringe at a rate of 0.1 ul/min. The needle was left in place for 10 minutes after completion of the ET ⁇ 1 injection then slowly withdrawn. Body temperature was maintained at 37°C using a heating pad and animals recovered under a heat lamp. Ketoprofen (5.0 mg/kg; s.c.) was administered for post ⁇ surgery analgesia. [00255] AAV injections.
  • AAV2/5 ⁇ GFAP ⁇ Cre or AAV2/5 ⁇ GFAP ⁇ Ascl1 ⁇ t2a ⁇ Cre or AAV2/5 ⁇ GFAP ⁇ Ascl1 ⁇ SA6 ⁇ t2a ⁇ Cre in Cre ⁇ conditional transgenic mice) or AAV2/5 ⁇ Flex::GFP + AAV2/5 ⁇ GFAP ⁇ Ascl1 ⁇ Cre or AAV2/5 ⁇ Flex::GFP + AAV2/5 ⁇ GFAP ⁇ Ascl1 ⁇ SA6 ⁇ Cre or empty vector (AAV2/5 ⁇ Flex::GFP + AAV2/5 ⁇ GFAP ⁇ Cre) in C57/Bl6 mice were injected into the ipsilesional cortex 7 days post ⁇ stroke or sham injury.
  • Ketoprofen (5.0 mg/kg; s.c.) is administered for post ⁇ surgery analgesia.
  • Groups included stroke+AAV (Cre only, Ascl1, Ascl1 ⁇ SA6) and Sham (uninjured mice)+AAV (Cre), depending on the experiment. All mice were tested on a battery of behaviour tasks prior to stroke (baseline) and on post ⁇ stroke day 3 or 4 (PSD3/4) (to ensure motor impairments were observed following stroke). Stroke injured mice that show a functional impairment on were used for behavioural assessments in order to confirm that the therapeutic intervention was assessing behavioural recovery. Mice underwent behaviour testing for up to 4 months post ⁇ stroke, depending on the task as detailed below. [00256] AAV constructs.
  • Sections were blocked with 10% normal goat serum (NGS) and 0.3% triton in PBS and labeled with primary antibodies (as per the table below) in PBS overnight at 4°C, followed by incubation with secondary antibodies and DAPI in PBS for 1 h at room temperature. Sections were analyzed for overlapping expression of markers in 5 ⁇ 9 images from ⁇ 3 coronal sections per mouse viewed at 20x magnification, located within the region of +1.6 and ⁇ 1.0 AP from bregma.
  • NGS normal goat serum
  • DAPI secondary antibodies
  • BIOSEP Grip Strength Test which provides a readout of the maximal peak force of paw grip
  • horizontal ladder task and (3) foot fault task which are used to evaluate skilled coordination
  • Foot Fault Analysis Mice were placed onto a metal grid (1 cm spacing) that was suspended 12 inches above a table surface. Animals were allowed to walk around the grid for 3 mins and were recorded from below. The number of steps and paw slips made with the contralesional forepaw and hindpaw were analyzed (and considered separately), and the percent slips was calculated as #slips/#steps.
  • Gait Analysis Gait analysis was performed using the automated Noldus CatWalk XT system (Noldus, The Netherlands). Mice were allowed to traverse a glass walkway illuminated with a light, and a number of gait parameters were measured. A minimum of 3 successful trials was required wherein the mouse took a direct path and speed did not vary more than 60% during the passage.
  • Ladder Task The horizontal ladder test consisted of a raised ladder with unevenly spaced rungs with a goal box at the end of the apparatus. Mice were acclimated in the goal box for 2 minutes and then prompted to across the ladder 3 consecutive times per trial day. Mice were recorded during the trials and the videos were examined for the number of contralateral forepaw steps and slips to calculate percent slippage of the injured forepaw.
  • Grip Strength A grip strength meter (BiosebTM) was used to assess forelimb neuromuscular function. Mice were held by the tail and allowed to grab the metal pull bar with their forepaws. The mouse was gently pulled away in a horizontal plane along the axis of the force sensor until the bar is released and the value of the sensor is recorded. Mice perform the grip test 3 times in one trial and the average value is recorded for the trial days (baseline, PSD3/4, PSD14 and PSD28/29).
  • mice that received triple ET ⁇ 1 stroke were assessed in the task on PSD28, PSD59, PSD89, and PSD120 to examine long term deficits and recovery. Mice that had >30% change in grip strength (force exerted in grams) relative to baseline on PSD3/4, were included in the analyses. [00263] Data acquisition and statistical analyses: All experiments were conducted with an experiments blind to the injury/treatment condition. Statistical analyses were conducted using PrismTM (v.9, GraphPadTM). One ⁇ factor analysis of variance (ANOVAs) was used to compare 3 or more groups. Two ⁇ way repeated measures ANOVA was used for behavioural data analysis. Differences were considered significant at p ⁇ 0.05. Values are presented as means ⁇ SEM.
  • Ascl1 ⁇ SA6 mutant form of Ascl1 (engineered with six serine (S) nucleotides adjacent to prolines being replaced with alanines (A), termed Ascl1 ⁇ SA6), which is designed to be insensitive to the inhibitory cues in the microenvironment, is more efficient at the conversion in the uninjured cortex.
  • the Ascl1 and Ascl1 ⁇ SA6 were cloned into an AAV2/5 vector and under the control of the GFAP promoter to target astrocytes and also carried a t2A ⁇ Cre cassette, which served as the control vector in the absence of Ascl1 or Ascl1 ⁇ SA6.
  • AAV vectors (AAV ⁇ Ascl1, AAV ⁇ Ascl1SA6 or AAV ⁇ Cre) were injected intracranially into adult cre ⁇ reporter mice (Rosa ⁇ YFP or Rosa ⁇ TdTom) that received a sensory ⁇ motor cortical stroke, to permit fate tracking of the AAV ⁇ transduced astrocytes.
  • Mice received an ET ⁇ 1 injection to induce a focal, ischemic stroke on day 0 and AAV injections into the lesioned cortex on day 7, which represents the subacute phase post ⁇ stroke.
  • the Et ⁇ 1 stroke results in neuronal cell death and glial scar formation with surrounding the lesion site (Shen X ⁇ Y et al, 2021; Livingston et al., 2020).
  • PSD28 post ⁇ stroke day 28
  • the brains were removed, sectioned and stained for mature neurons (NeuN+).
  • the total numbers of tdTomato+ (AAV transduced GFAP expressing cells) and tdTomato+/NeuN+ (reprogrammed neurons) is shown in Figure 26.
  • Ascl1 resulted in a significant increase in the percentage reprogrammed neurons compared to Cre controls (48.32 ⁇ 3.21 vs.
  • the foot fault task was performed in mice that received a single ET ⁇ 1 stroke and AAV injections (AAV ⁇ Ascl1, AAV ⁇ Ascl1 ⁇ SA6 or AAV ⁇ Cre controls) on day 7 post ⁇ stroke. Contralesional steps and slips (i.e., on the impaired side of the body that is opposite to the side of the stroke) were recorded for the forepaw and hindpaw. As shown in Figure 27, all mice that received stroke were significantly impaired at PSD3/4, with increased % slippage of the hindpaw (A) and forepaw (B).
  • mice that received AAV ⁇ Ascl1 ⁇ SA6 were significantly improved and performed similar to baseline. These data reveal that 21 days post ⁇ reprogramming is sufficient for Ascl1 ⁇ SA6 overexpression, but not Ascl1 overexpression, to improve motor outcomes following injury. [00271] Gait analysis was also performed, which is a sensitive assay to detect subtle motor deficits. In support of the foot fault data demonstrating impaired motor function on PSD28, stroke injured mice that received AAV ⁇ Cre were significantly impaired in contralesional (left) hindpaw print area and weight distribution (max intensity) compared to sham mice (uninjured mice that received AAV ⁇ Cre) on PSD28 ( Figure 28).
  • Ascl1 AAV5 ⁇ Flex::GFP + AAV5 ⁇ GFAP ⁇ Ascl1 ⁇ Cre
  • Ascl1 ⁇ SA6 AAV5 ⁇ Flex::GFP + AAV5 ⁇ GFAP ⁇ Ascl1 ⁇ SA6 ⁇ Cre
  • empty vector AAV5 ⁇ Flex::GFP + AAV5 ⁇ GFAP ⁇ Cre
  • Ascl1 ⁇ SA6 treatment improves functional outcomes.
  • Grip strength is improved following ectopic expression of Ascl1 and Ascl1 ⁇ SA6.
  • a grip strength analysis was performed in cohorts of mice that received either a single ET ⁇ 1 stroke or a triple ET ⁇ 1 stroke. Mice that received a single ET ⁇ 1 stroke were significantly impaired on PSD3 and AAV ⁇ Cre (control) treated mice were still impaired on PSD28.
  • hESCs were used to generate COs using media included in the STEMdiff Cerebral Organoid Kit (StemCell Tech;#08570) and STEMdiff Cerebral Organoid Maturation Kit (StemCellTech;#08571), with some modifications. Briefly, hESCs were plated in 96 ⁇ well V ⁇ shaped bottom ultra ⁇ low attachment plates at 12,000 cells/well in embryoid body (EB) formation medium with the presence of 50 ⁇ M Y ⁇ 27632 (ROCK inhibitor;StemCell Tech;#72302) until day 2.
  • EB embryoid body
  • Dual SMAD inhibitors (2 ⁇ M Dorsomorphin;StemCellTech;#72102, and 2 ⁇ M A83 ⁇ 01;StemCell Tech;#72022) were added from seeding day until day 5. Newly formed EBs were transferred to low binding 24 ⁇ well plates containing induction medium. On day 9, EBs with optically translucent edges were embedded in matrigel (Corning;#354277) and deposited into 6 ⁇ well ultra ⁇ low adherent plate with StemCell Tech expansion medium.
  • EXAMPLE 5 Ascl1 phospho ⁇ site mutations enhance neuronal conversion of adult cortical astrocytes in vivo
  • Neurological diseases are most often associated with the loss or dysfunction of specific neuronal populations. Once lost, neurons are not replaced, except in rare circumstances and in restricted brain niches [1; 2].
  • bHLH TFs act at the top of transcriptional cascades, turning on other TFs, such as Neurod1, which function at later developmental stages to control neuronal differentiation.
  • bHLH TFs are not active in all cellular contexts and can be inhibited by environmental signals.
  • Neurog2 is only sufficient (by gain ⁇ of ⁇ function; [8]) and necessary (by loss ⁇ of ⁇ function; [9; 10; 11]) to specify a glutamatergic neuronal fate between embryonic day (E) 11.5 to E14.5, despite continued expression at later stages during the neurogenic period, which ends at E17.
  • Ascl1 which specifies a GABAergic interneuron fate in the embryonic ventral telencephalon [12] can only induce ectopic GABAergic genes in dorsal telencephalic progenitors at early (E12.5) and not late (E14.5) embryonic stages [9; 10; 11].
  • the cell context ⁇ dependent activities of the proneural genes extends to neuronal reprogramming where there is growing consensus that the conversion of somatic cells to an induced neuron (iNeuron) fate is more efficient when the starter cell is more similar in identity (i.e., neural lineage).
  • Ascl1 is combined with other TFs, as in the initial “BAM” combination (Brn2/Pou3f2, Ascl1, Myt1l) [13; 14].
  • Ascl1 plays a crucial role as a pioneer TF, opening chromatin associated with a specific trivalent signature (H3K4me1, H3K27ac, H3K9me3), which is then accessed by Brn2 and other neurogenic TFs [14].
  • H3K4me1, H3K27ac, H3K9me3 a specific trivalent signature
  • Ascl1 can trigger human pericytes to transdifferentiate into iNeurons, but only when co ⁇ expressed with Sox2, which facilitates the transiting of cells through a neural stem/progenitor cell ⁇ like stage (i.e., conversion is not direct) [16; 17].
  • Sox2 which facilitates the transiting of cells through a neural stem/progenitor cell ⁇ like stage (i.e., conversion is not direct) [16; 17].
  • the ability of Ascl1 to induce neural progenitor cells to differentiate into neurons is in keeping with its developmental role [7], and has been recapitulated using progenitor cell lines [18] or pluripotent stem cells in vitro, with Ascl1 acting as a pioneer TF [15; 19; 20].
  • Astrocytes are common target cells for neuronal conversion as their activated state in neurodegenerative diseases and in injuries such as stroke contributes to disease pathology [5; 6].
  • Ascl1 can convert cortical astrocytes to iNeurons in vitro, either when misexpressed alone [21; 22; 23; 24] or together with other TFs, for instance, to make dopaminergic iNeurons [25].
  • Spinal cord astrocytes can also be reprogrammed to iNeurons, but interestingly, a distinct V2 interneuron like ⁇ identity is achieved, rather than a cortical phenotype [24].
  • Neurog2 can be combined with other signals, such as Bcl2, to become a potent lineage converter in vivo [30].
  • Bcl2 a transcriptional repressor of neurogenic genes
  • CRISPR ⁇ activation of mitochondrial genes enriched in neurons enhanced Neurog2 and Ascl1 reprogramming efficacy [33]. Identifying and targeting the regulatory events that block bHLH TF activity is thus proving a fruitful strategy to improve neuronal reprogramming.
  • GSK3, ERK1/2, Cdks which act in a “rheostat ⁇ like fashion”; the more serine ⁇ proline (SP) or threonine ⁇ proline (TP) sites phosphorylated, the less TF binding to DNA and transactivate their target genes to promote neuronal fate specification and differentiation [8; 34; 35; 36].
  • SP serine ⁇ proline
  • TP threonine ⁇ proline
  • S serines
  • T threonines
  • mice Male C57BL/6 wild ⁇ type mice, Rosa ⁇ ZsGreen (JAX #007906) and Rosa ⁇ tdtomato (JAX #007914) transgenic mice [43], maintained on a C57BL/6 background, and obtained from Jackson Laboratory. Mice were housed under 12 hour light/12 hour dark cycles with free access to food and water.
  • Rosa ⁇ ZsGreen wild ⁇ type forward: 5' ⁇ CTG GCT TCT GAG GAC CG ⁇ 3' (SED ID NO:28); wild ⁇ type reverse: 5' ⁇ AAT CTG TGG GAA GTC TTG TCC ⁇ 3' (SEQ ID NO:29); mutant forward: 5' ⁇ ACC AGA AGT GGC ACC TGA C ⁇ 3' (SEQ ID NO:30); mutant reverse: 5' ⁇ CAA ATT TTG TAA TCC AGA GGT TGA ⁇ 3' (SEQ ID NO:31).
  • Rosa ⁇ tdtomato mutant reverse: 5' ⁇ GGC ATT AAA GCA GCG TAT CC ⁇ 3' (SEQ ID NO:32); mutant forward: 5' ⁇ CTG TTC CTG TAC GGC ATG G ⁇ 3' (SEQ ID NO:33).
  • PCR cycles were as follows: 94°C 2 min, 10x (94°C 20 sec, 65°C 15sec * ⁇ 0.5c per cycle decrease, 68°C 10sec), 28x (94°C 15sec min, 60°C 15sec, 72°C 10sec), 72°C 2 min. [00303] AAV cloning and packaging.
  • AAV2/8 ⁇ GFAPlong ⁇ mCherry and AAV2/8 ⁇ GFAPlong ⁇ Ascl1 ⁇ mCherry were a gift from Leping Cheng and include a 2.2 kb GFAP promoter [26].
  • the Ascl1 was replaced with Ascl1 ⁇ SA6 in AAV2/8 ⁇ GFAPlong ⁇ Ascl1 ⁇ mCherry.
  • serines in all six SP sites was mutated to alanines (as in [34]).
  • AAV5 ⁇ GFAPshort ⁇ iCre was previously described [44] and includes a 681 bp (gfaABC(1)D modified GFAP promoter [41].
  • Intracranial injections 16 ⁇ week ⁇ old male C57BL/6 mice were performed as described in Example 1, using either buprenorphine (0.1 mg/kg; Vetergesic, 02342510] or Tramadol ⁇ HCL (20 mg/kg; Chiron, RxN704598) as an analgesic, along with baytril (2.5 mg/kg; Bayer, 02249243), and saline (0.5 ml, Braun, L8001).
  • buprenorphine 0.1 mg/kg; Vetergesic, 02342510]
  • Tramadol ⁇ HCL 20 mg/kg; Chiron, RxN704598
  • baytril 2.5 mg/kg; Bayer, 02249243
  • saline 0.5 ml, Braun, L8001
  • mCherry AAV injections in Figure 36B a total of 1.0 x 10 8 GC in a 1 ⁇ L total volume at coordinates (AP: +1.1, L/M: ⁇ 1.2 DV: ⁇ 2) was
  • AAV ⁇ injected mice were anesthetized using 2% isoflurane and a 4 mm craniotomy was performed (from bregma: AP 1.7mm, ML + ⁇ 2.15). After the removal of the dura, a silicone ⁇ based polydimethylsiloxane (PDMS) window was placed over a thin layer of 1% agarose (in PBS) covering the cortical tissue.
  • PDMS polydimethylsiloxane
  • mice were transferred to an FVMPE ⁇ RS multiphoton microscope (Olympus) and placed under a 25x/1.05NA objective lens (Olympus) while a tungsten electrode (0.255 mm ⁇ , A ⁇ M System) was inserted at a 30° angle, through the PDMS window, reaching a depth of 100 ⁇ m into the cortex.
  • An Insight Ti:Sapphire laser (SpectraPhysics) tuned to 900 nm was used to excite the Zs ⁇ green fluorescence, whose emission was then collected by a PMT aligned with a band ⁇ pass filter (485–540 nm).
  • a second channel (575–630 nm) was also recorded simultaneously to better visualize the position of the Tungsten electrode's tip into the tissue.
  • PS simultaneous focused photostimulation
  • ChR2 a raster scanned visible wave ⁇ length laser (458 nm) with a separate galvanometer was used.
  • the PS was presented over a circular area of 250 ⁇ m in diameter where Zs ⁇ green ⁇ positive cells were present.
  • the PS was repeated ten times over the same area with 10 sec intervals (PS off).
  • the PS was delivered over the circular area at 4 Hz with a power of 4 mW/mm2, and lasted for a total of 3 s.
  • the low ⁇ impedance tungsten electrode was used to acquire voltage changes in the LFP band (1 ⁇ 300 Hz), recorded in current clamp mode by the Axon multiclamp 700B amplifier (Molecular devices).
  • the analog signal was amplified 40 times (40mV/mV) and digitized by the data acquisition system Digidata 1440ATM (Molecular devices).
  • Digidata 1440ATM Molecular devices
  • a two ⁇ phase decay model was used to describe the repolarization phase of the LFP signal and the slower component was reported as the decay constant.
  • Intracardial perfusion was performed with approximately 20x blood volume using a peristaltic pump at a flow rate of 10 ml/min with ice cold saline (0.9% NaCl, Braun, L8001), followed by 4% paraformaldehyde (PFA, Electron Microscopy Sciences, 19208) in phosphate buffer saline (PBS, Wisent, 311 ⁇ 011 ⁇ CL) for five minutes. Brains were collected and post ⁇ fixed overnight in 4% PFA in PBS, cryoprotected at 4oC in 20% sucrose (Sigma, 84097)/1X PBS overnight.
  • Coronal brain sections were cut at 10 ⁇ 30 ⁇ m on a Leica CM3050TM cryostat (Leica Microsystems Canada Inc., Richmond Hill, ON, Canada) and collected on FisherbrandTM SuperfrostTM Plus Microscope Slides (Thermo Fisher Scientific, 12 ⁇ 550 ⁇ 15).
  • a Leica CM3050TM cryostat Leica Microsystems Canada Inc., Richmond Hill, ON, Canada
  • FisherbrandTM SuperfrostTM Plus Microscope Slides Thermo Fisher Scientific, 12 ⁇ 550 ⁇ 15.
  • RNA in situ hybridization Colorimetric RNA ⁇ in situ hybridization (ISH) was performed using a digoxygenin ⁇ labeled Ascl1 riboprobe as previously described [45]. Fluorescent RNA ⁇ ISH was performed using an RNAscope® Multiplex Fluorescent Detection Kit v2 (ACD #323110) and followed the manufacturer's instructions.
  • brain sections were post ⁇ fixed (4% PFA/1XPBS) for 15 min at 4°C, and then, at room ⁇ temperature, dehydrated in 50%, 70% and 100% ethanol (Commercial Alcohols, P016EAAN) for 5 min each, and incubated in H 2 O 2 solution for 10 min. Sections were then incubated in 1x target retrieval solution for 5 min at 95°C, washed in dH 2 O, and then incubated in Protease PlusTM (ACD, 322331) for 15 min at 40°C before washing in washing buffer. A labeled RNA probe was used for Ascl1 (Mm ⁇ Ascl1 #313291) and the negative and positive control probes provided were also used.
  • Imaging, quantification and statistics All images were taken using a Leica DMi8 Inverted Microscope (Leica Microsystems CMS, 11889113) with the following exceptions. Images in Figure 36E were acquired using a Zeiss Z1 Observer/ Yokogawa spinning disk (Carl Zeiss) microscope. Tiled images encompassing the entire motor cortex were acquired using 30 ⁇ m z ⁇ stacks with a 1 ⁇ m step ⁇ size at with a 20X objective.
  • AAV ⁇ GFAP ⁇ iCre can be used for long ⁇ term tracing of the fate of transduced cortical astrocytes in vivo
  • Cre ⁇ based, permanent lineage tracing system was used, specifically an AAV5 ⁇ GFAPshort ⁇ iCre vector previously used in a neuronal reprogramming study to misexpress Neurod1 [44], replacing Neurod1 with Ascl1 to create AAV5 ⁇ GFAPshort ⁇ Ascl1 ⁇ t2a ⁇ iCre ( Figure 36D).
  • the GFAPshort promoter is a 681 bp (gfaABC(1)D modified promoter that shows similar astrocyte ⁇ specificity as GFAPlong, but drives two ⁇ fold higher levels of gene expression [41].
  • Packaged AAVs (4.8 x 10 9 GC total in a 1 ⁇ L total volume) were stereotactically injected into the cortex of Rosa ⁇ zsGreen mice, using the same coordinates as in Figure 36B. Robust zsGreen expression was observed 2 months after transduction of AAV5 ⁇ GFAPshort ⁇ iCre control virus (not shown) or AAV5 ⁇ GFAPshort ⁇ Ascl1 ⁇ t2a ⁇ iCre ( Figure 36E).
  • the iCre system thus can be used to express Ascl1 and to trigger Cre ⁇ dependent reporter expression, which in turn can be used to trace the fate of transduced cells in the adult cerebral cortex [00317] Mutating serine phospho ⁇ acceptor sites in Ascl1 augments neuronal lineage conversion in the adult cortex [00318] The main goal of this study was to determine whether serine ⁇ to ⁇ alanine mutations in the six SP sites in Ascl1 (Figure 36H) would enhance neuronal conversion efficacy.
  • Each comparative group had a set of three genetic cargos: iCre alone (control), Ascl1 ⁇ t2a ⁇ iCre, or Ascl1 ⁇ SA6 ⁇ t2a ⁇ iCre.
  • the two main comparisons were AAV8 versus AAV5 with the short GFAP promoter, and GFAPshort versus GFAPlong in AAV5.
  • all packaged AAVs were injected using stereotactic surgery into the cerebral cortex of either Rosa ⁇ zsGreen or Rosa ⁇ tdtomato mice.
  • Figure 37C First the ability of AAV5 ⁇ GFAPshort constructs to induce NeuN expression when injected into the cortex of Rosa ⁇ tdtomato mice were compared ( Figure 37C).
  • Ascl1 ⁇ SA6 is more efficient at turning on neuronal gene expression, and less efficient at transactivating the Sox9 glial promoter compared to Ascl1 [34].
  • Ascl1 ⁇ SA6 could more efficiently downregulate Sox9 expression.
  • two systems were compared: the AAV5 vector with the GFAPlong promoter and the AAV8 vector with the GFAPshort promoter.
  • Ascl1 ⁇ SA6 induces electrophysiological properties of iNeurons in targeted astrocytes
  • iNeurons To promote functional recovery in pathological conditions, iNeurons must integrate into existing neural circuits by making synaptic connections with endogenous neurons and sending axons to appropriate neuronal targets.
  • AAVs carrying GFAP ⁇ iCre or GFAP ⁇ Ascl1 ⁇ SA6 were co ⁇ transduced with FLEX ⁇ ChR2 ⁇ (H134R) ⁇ YFP, a Cre ⁇ dependent optogenetic actuator that offers a sensitive way to photoactivate neurons and elicit large evoked potentials (Figure 40A).
  • This Example provides a detailed comparison of the capacity of Ascl1 and Ascl1 ⁇ SA6 to induce neuronal markers and suppress glial markers when expressed in adult cortical astrocytes in vivo. It was found that with each combination of AAV capsids, GFAP promoters and Rosa ⁇ reporter lines tested, a higher proportion of Ascl1 ⁇ SA6 transduced cells consistently expressed NeuN, a mature neuronal marker, compared to cells transduced with Ascl1 or iCre controls.
  • Ascl1 and Ascl1 ⁇ SA6 transduced cells had the signature of a transitory GFAP+Dcx+ neuroblast stage, suggesting that while Ascl1 may induce some features of immature neurons, it is less efficient than Ascl1 ⁇ SA6 at inducing a complete differentiation cascade.
  • both Ascl1 and Ascl1 ⁇ SA6 could suppress the expression of astrocytic markers (Sox9 and GFAP), although Ascl1 ⁇ SA6 was again superior in this regard.
  • ASCL1 ⁇ SA5 (note that the human ASCL1 gene has 5 SP sites) can induce a glioblastoma stem cell line to undergo terminal differentiation and exit the cell cycle more effectively than native ASCL1, leading to growth suppression of this tumor cell line [39].
  • Ascl1 ⁇ SA6 versus Ascl1.
  • EXAMPLE 6 Spatial transcriptomic analysis of in vivo astrocyte ⁇ to ⁇ neuron lineage conversion in a mouse model of amyotrophic lateral sclerosis
  • Direct neuronal reprogramming refers to the conversion of mature somatic cells to an induced (i) Neuron without going through pluripotency 1,2 , and was first documented even prior to the initial demonstration of reprogramming to a pluripotent state 3 .
  • Ascl1 is necessary and sufficient to specify a GABAergic, inhibitory neuronal identity
  • Neurog2 specifies a glutamatergic excitatory neuronal fate in a transcriptional cascade that includes Neurod1 5 ⁇ 9 .
  • bHLH TFs in neuronal reprogramming studies in vitro 10 ⁇ 17 , the efficiency of iNeuron conversion remains low when applied to endogenous cells in the brain in vivo 2 .
  • SA serine ⁇ to ⁇ alanine
  • neuronal reprogramming TFs were introduced into a mouse model of amyotrophic lateral sclerosis (ALS).
  • ALS amyotrophic lateral sclerosis
  • ALS is associated with the degeneration of upper motor neurons (MNs) in deep layers V and VI of the neocortex, which project to subcortical targets including the striatum (corticostriatal pathway) and spinal cord (corticospinal pathway). Subsequently, lower MNs in the brainstem and spinal cord, which innervate skeletal muscles and other muscle types (cardiac, visceral), also degenerate 31,32 . Ultimately the loss of lower MNs causes muscle denervation, muscle atrophy, and ultimately death within 3 ⁇ 5 years post diagnosis 32 . Most ALS diagnoses are sporadic, with only 5 ⁇ 10 % of cases inherited 33 .
  • SOD1 SOD1
  • hSOD1 G93A transgenic mice A transgenic mouse line carrying a human (h) SOD1 G93A mutant transgene recapitulates ALS motor deficits 36 , with upper motor neurons in the cortex degenerating before lower motor neurons in the spinal cord 37 .
  • Astrocytes are a major contributor to neuronal cell death in an ALS animal model, as they can induce pathology when transplanted into a healthy host brain 38 .
  • Example 5 To prevent toxicity associated with ALS astrocytes, and to potentially replace lost upper motor neurons, the present Example examined whether adeno ⁇ associated viruses (AAV) containing a glial fibrillary acidic protein (GFAP) promoter to drive the expression of neurogenic TFs (Ascl1, Ascl1 SA6 ) could be used to induce astrocyte ⁇ to ⁇ iNeuron conversion in the SOD1 G93A motor cortex.
  • AAV adeno ⁇ associated viruses
  • GFAP glial fibrillary acidic protein
  • the 10X Genomics Visium spatial transcriptomics (ST) platform was used to investigate gene expression changes in a spatially ⁇ defined manner. Brain regions were delineated histologically, clustered transcriptionally, and annotated using a Molecular Brain Atlas 39 . Unexpectedly, the control iCre vector induced an inflammatory gene signature, a phenotype that was dampened when the same AAVs were used to express either Ascl1 or Ascl1 SA6 .
  • Ascl1 and Ascl1 SA6 downregulated a subset of astrocytic genes (Nr4a1, Thra, Npas4, Clu) and activated a set of neurogenic genes, including those upregulated during in vitro neuronal conversion (e.g., Zbtb18, Id2, Id3) 10,23 .
  • GNN gene regulatory network
  • Rosa ⁇ zsGreen;hSOD1 G93A double heterozygous mice were generated by breeding Rosa ⁇ zsGreen females (B6.Cg ⁇ Gt(ROSA)26Sor tm6(CAG ⁇ ZsGreen1)Hze /J; JAX® stock #: 007906) with hSOD1 G93A males (B6;Cg ⁇ Tg(SOD1 ⁇ G93A)1Gur/J; JAX® stock #: 004435), which were both maintained on a C57B6/J genetic background. Double transgenic animals were identified by PCR ⁇ genotyping using Jackson Laboratory protocols.
  • transgene forward 5' ⁇ CAT CAG CCC TAA TCC ATC TGA ⁇ 3' (SEQ ID NO:26); reverse, 5′ ⁇ CGC GAC TAA CAA TCA AAG TGA – 3' (SEQ ID NO:27); internal positive control forward, 5' ⁇ CTA GGC CAC AGA ATT GAA AGA TCT – 3' (SEQ ID NO:34); internal positive control reverse, 5' ⁇ GTA GGT GGA AAT TCT AGC ATC C – 3' (SEQ ID NO:35)).
  • the hSOD1 G93A transgene band is 236 bp and the locus of insertion wild ⁇ type band is 324 bp.
  • Rosa ⁇ ZsGreen wild ⁇ type forward: 5' ⁇ CTG GCT TCT GAG GAC CG ⁇ 3' (SEQ ID NO:28); wild ⁇ type reverse: 5' ⁇ AAT CTG TGG GAA GTC TTG TCC ⁇ 3' (SEQ ID NO:29); mutant forward: 5' ⁇ ACC AGA AGT GGC ACC TGA C ⁇ 3' (SEQ ID NO:30); mutant reverse: 5' ⁇ CAA ATT TTG TAA TCC AGA GGT TGA ⁇ 3' (SEQ ID NO:31). [00338] AAV Delivery.
  • AAV5 ⁇ GFAP ⁇ iCre plasmid was a gift from Dr. Maryam Faiz 108 .
  • AAV5 ⁇ GFAP ⁇ Ascl1 SA6 ⁇ t2a ⁇ iCre (12.30x10 13 GC/ml) were packaged by VectorBuilder Inc. (Chicago, IL).
  • Each virus was diluted to deliver a total of 4.8 x 10 9 GC in a 1 ⁇ L volume, delivered at 0.1 ⁇ l/min over 10 mins with a 5 ⁇ l Hamilton syringe and 30 ⁇ gauge needle (Hamilton, 7803 ⁇ 07).
  • mice were anesthetized with isofluorane (2%, 1L/min; Fresenius Kabi, CP0406V2) and administered buprenorphine (0.1 mg/kg; Vetergesic, 02342510), baytril (2.5 mg/kg; Bayer, 02249243), and saline (0.5 ml, Braun, L8001) subcutaneously. Mice were sacrificed after 28 dpi. [00339] 10X Visium spatial transcriptomic section and library preparation. Mice were anesthetized with ketamin (75 mg/kg) and xylazine (10 mg/kg) prior to dissection.
  • Fresh brains were collected and placed in an isopentane (2 ⁇ methylbutane, Sigma) bath in a benchtop liquid nitrogen container for five minutes. Frozen brains were transferred into prechilled 50 ml falcon tubes and stored at ⁇ 80 oC. Fresh frozen tissues were cryosectioned using a Leica CM3050 cryostat (Leica Microsystems Canada Inc., Richmond Hill, ON, Canada) at ⁇ 20 oC and 10 ⁇ ⁇ coronal section was immediately placed within the framed capture areas on 10X Visium spatial slides. Slides were transferred on dry ice to the Princess Margaret Genomics Centre for further processing and spatial transcriptomic (ST) library production using Visium Spatial Tissue Optimization Reagents Kit (10X Genomics).
  • slides were dehydrated in ⁇ 20 oC prechilled MeOH for 30 min, dried in the Thermocycler with the lid open for 1 min at 37 oC and then stained with hematoxylin and eosin.
  • Tissue sections were exposed to 70 ⁇ ⁇ of permeabilization enzyme for 18 min, which was selected as the optimal time using the tissue optimization slide (10X Genomics), releasing the poly ⁇ adenylated mRNA that could then be captured by poly ⁇ dT primers containing Illumina TruSeq ReadTM, spatial barcode and UMI on the Visium slides.
  • First and second strand cDNA synthesis and amplification were performed in the Visium slide cassette in a Thermal cycler using a Visium Spatial Gene Expression Reagent Kit (10X Genomics) as per the manufacturer's protocol.
  • Dual Indexed, Illumina compatible libraries were created by Sample Index PCR as per the manufacturer's instructions using the Dual Index Kit TT Set A (10X Genomics) and E3, E4, E5 and E6 indexing primers.
  • 3' end sequencing was performed in the Princess Margaret Genomics Facility using an Illumina NovaSeq 6000TM system.
  • the Loupe Browser was also used to create a Spatial Map that shows the tissue image with color ⁇ coded sequencing spots that correspond to unique cellular clusters. It was also used to create a 2D T ⁇ distributed Stochastic Neighbor Embedding (tSNE) plots. tSNE projection to identify unique cellular clusters within the corresponding color ⁇ coded regions of the tissue section. Finally, the expression patterns of individual selected genes of interest were visualized using the Loupe Browser. [00341] Differentially Expressed Genes (DEGs). To perform additional Features Selection and clustering analyses, a Seurat v.3.2.3 R package tool for single cell genomics 109 was used. Seurat was used to select highly variable genes in the dataset (2000 genes by default).
  • the integrated data set was created with SelectIntegrationFeatures from Seurat.
  • the function integrates the data set based on N most variable features, which was 3000 in the present case. Therefore, these data sets have no p ⁇ value cutoff.
  • DEGs restricted to iCre positive were also examined between the samples (Ascl1 vs control; Ascl1 SA6 vs control; Ascl1 vs Ascl1 SA6 ).
  • the p ⁇ values were calculated from individual pairwise comparisons between iCre positive cell pools.
  • pathway clustering was obtained using pathfindR Bioconductor package 110 . GO categories were plotted as treemaps, which reflect semantic similarities.
  • the treemaps were prepared using the rrvgo Bioconductor package.
  • Cluster Annotation Molecular annotation of the tissues represented in individual clusters was inferred using a Brain PaletteTM of 266 unique genes expressed in different brain regions 39 . Average gene expression of all spots in each assigned cluster was used to compare to regional identities using a 3D ST Viewer at github and atlas visualization from the Brain Palette study 39 . Enrichment of GO terms in each cluster was performed by querying GO.BP and GO.CC (2021 version) with an enrichR R package, examined only differentially up ⁇ regulated genes with an adjusted p ⁇ value cutoff of 0.05 111 .
  • GNN Gene regulation network
  • GRN inference was performed as described in (Okawa et al., 2015) 112 for iCRE ⁇ CT, Ascl1 and Ascl1 SA6 .
  • PKNs were assembled from MetaCore (GeneGo Inc. (15871913)), TRRUST (29087512) and RegNetwork (26424082).
  • the Pearson correlation coefficient for each pair of TF and gene was computed over respective spatial transcriptomics sample. The intersection between the PKNs and Pearson correlation coefficient above 90 percentile was maintained.
  • Cytoscape v.3 was used for the visualization of GRNs (14597658), in which differentially up ⁇ regulated and down ⁇ regulated genes were indicated as red or orange and blue or purple nodes, respectively, whereas non ⁇ differentially expressed genes were indicated as white nodes.
  • the GRN among the differentially expressed TFs was reconstructed as described above, but using the scRNA ⁇ seq data of developing human cortex (26406371) for computing the Pearson correlation coefficient for each pair of TF and gene.
  • the ZBTB18 binding target genes were obtained from (30392794) and added to the GRN. In silico perturbation was performed by constantly repressing the expression of ZBTB18.
  • the GRN simulation was carried out by the Boolean network formalism using the majority voting logic rule.
  • the Boolean initial expression states 1 and 0 were assigned to differentially up ⁇ and down ⁇ regulated TFs, respectively.
  • a synchronous update was repeated 1000 times and the final GRN state was recorded. Cytoscape v.3 was used for the visualization of the GRN.
  • mice were anesthetized with ketamine (75 mg/kg) and xylazine (10 mg/kg) prior to perfusion. Intracardially perfusion was performed with approximately 20x of their blood volume using a peristaltic pump at a flow rate of 10 ml/min with ice cold saline (0.9% NaCl), followed by 4% paraformaldehyde (PFA) in phosphate buffer saline (PBS) for approximately five minutes. Brains were collected and post ⁇ fixed overnight in 4% PFA in PBS, transferred to a 20% sucrose/1X PBS at 4oC overnight for cryoprotection, embedded in O.C.T.
  • ketamine 75 mg/kg
  • xylazine 10 mg/kg
  • Intracardially perfusion was performed with approximately 20x of their blood volume using a peristaltic pump at a flow rate of 10 ml/min with ice cold saline (0.9% NaCl), followed by 4% paraformaldehyde (P
  • Blocking was followed by 72 hours incubation at 4°C in an antibody solution (10% HS, 0.75% BSA, and 0.1% Triton ⁇ X ⁇ 100 in PBS) using the following primary antibodies: goat anti ⁇ GFAP (1:500, #NB100 ⁇ 53809, Novus), rat anti ⁇ Ctip2 (1:300, #AB18465, Abcam), rat anti ⁇ Iba1 (1:500, #019 ⁇ 19741, FUJIFILM Wako Pure Chemical Corporation).
  • GFAP, Ctip2 and Iba1 expressing cells were quantified using FIJI/ImageJ 93 .
  • cortical regions of interest were delineated using the polygon tool.
  • immunofluorescent signal was thresholded using and positive cells were quantified using the “analyze particles” command.
  • GFAP immunofluorescent signal was thresholded using the adjust threshold “Triangle” algorithm and measured using the “Measure” command.
  • mean intensity and percent area were evaluated as a weighted average collected across multiple sections. Microglia were analyzed in FIJI/ImageJ using the macros provided with the MORPHIOUS analysis tool 41 .
  • Iba1 mean intensity and percent area were evaluated using an Autolocal threshold (Method: Phansalkar, parameter 1: 0, parameter 2: 0.
  • MORPHIOUS provides functionality to quantify skeleton metrics (e.g., number of branches, branch length) and cell soma metrics (e.g., soma size). Skeleton metrics were normalized to the number of microglia somas.
  • the nearest neighbor distance (NND) which represents the Euclidean distance for a microglial soma to its nearest neighboring microglial soma, was also evaluated. For each mouse, metrics were evaluated as a weighted average collected across multiple sections. [00349] Imaging and statistics.
  • Quantification of immunostained cells was performed on three brains per condition and a minimum of three sections per brain. Comparisons were made using a One ⁇ Way ANOVA and Tukey multiple comparisons. Significance was defined as p ⁇ values less than 0.05 and denoted as follows: ns ⁇ not significant, ⁇ 0.05 *, ⁇ 0.01 **, ⁇ 0.001 ***.
  • Neuronal reprogramming vectors were therefore delivered to the motor cortex of hSOD1 G93A mice, a model of ALS in which deep ⁇ layer pyramidal neurons in the motor cortex have been reported to degenerate by one ⁇ month of age 37 .
  • Ctip2 was used to immunolabel projection neurons in cortical layers V and VI 40 .
  • fewer Ctip2 + neurons were detected in the hSOD1 G93A motor cortex at three anterioposterior positions (Bregma 1.34, 1.85, 2.15) at both 3 ⁇ and 5 ⁇ months of age (Figure 41A ⁇ I).
  • MORPHIOUS a custom machine learning software package, was used to identify and quantify activated microglia and astrocytes 41 .
  • the number of Iba1 + microglia, their density, soma size and branch number were similar between C57 and hSOD1 G93A mice at 3 ⁇ month and 5 ⁇ months of age ( Figure 41J).
  • hSOD1 G93A motor cortices Targeting hSOD1 G93A motor cortices with neuronal reprogramming vectors
  • AAVs adeno ⁇ associated viruses carrying a short human GFAP promoter was used to drive the expression of native Ascl1 or mutated Ascl1 SA6 , both tethered to a t2a ⁇ iCre cassette, which was also in the control vector.
  • Example 5 using these constructs, it was demonstrated that Ascl1 SA6 , and to a lesser extent Ascl1, can increase neuronal marker expression when expressed in motor cortex astrocytes in Rosa ⁇ zsGreen reporter mice, which do not undergo neuronal degeneration.
  • AAVs were instead injected in 4 ⁇ month ⁇ old hSOD1 G93A ;Rosa ⁇ zsGreen mice, at a stage when neurodegeneration had already ensued, and behavioural symptoms had just initiated 42 (Figure 43A).
  • Ascl1 SA6 carries six serine ⁇ to ⁇ alanine mutations that enhance the capacity of this bHLH TF to convert embryonic cortical neural progenitor cells to neurons 19 and to induce neuronal marker expression and reduce glial marker expression in adult brain astrocytes in vivo 26 and in glioblastoma 23 and neuroblastoma 25 cells in vitro. Ascl1 and Ascl1 SA6 were linked to a t2a ⁇ iCre sequence so that transduced cells could be detected in Rosa ⁇ zsGreen reporter mice.
  • AAV5 GFAP ⁇ iCre hereafter, iCre control
  • AAV5 ⁇ GFAP ⁇ Ascl1 ⁇ t2a ⁇ iCre hereafter, Ascl
  • AAV5 ⁇ GFAP ⁇ Ascl1 SA6 ⁇ t2a ⁇ iCre hereafter, Ascl1 SA6
  • Each of the three AAVs were delivered using stereotaxic coordinates to the motor cortex (AP: +2.15, L/M: ⁇ 1.7, DV: ⁇ 1.7) of 4 ⁇ month ⁇ old hSOD1 G93A ;Rosa ⁇ zsGreen mice.
  • Hematoxylin and eosin (H&E) staining confirmed that sections collected from each of the four brains were within the motor cortex, albeit at slightly different rostrocaudal positions ( Figure 43C,E,G,I). At this level of resolution, sites of AAV injection were not readily visible in the H&E ⁇ stained tissue, but as zsGreen expression was evident (see Figure 44C), viral transduction was successful.
  • iCre was at the top of the 50 most variable genes across the tissue, as displayed in heatmaps for each of the transduced brains ( Figure 43F,H,J).
  • zsGreen transcripts were not detected, even though the mRNA sequence was added to the reference genome, and zsGreen epifluorescence was seen in each of the three AAV ⁇ injected brains (see Figure 44C). Therefore, iCre expression was relied on exclusively to identify the cell clusters transduced with the AAV vectors.
  • DEGs differentially expressed genes
  • the top ⁇ most variably expressed genes in the uninjected brain were primarily in olfactory regions of the spatial map (clusters 5 ⁇ 7,9,10; Figure 43D), which were less prevalent in the iCre ⁇ transduced brain ( Figure 43F).
  • Figure 43D the spatial map
  • Figure 43F the iCre ⁇ transduced brain
  • the AAV control vector induced an inflammatory transcriptional response that was above and beyond any degenerative signals seen in uninjected 5 mo ⁇ old hSOD1 G93A motor cortices (Figure 43D).
  • Figure 43D the spatial transcriptomes of the Ascl1 ⁇ and Ascl1 SA6 ⁇ transduced brains were analyzed, which were stratified into 11 and 10 cell clusters, respectively ( Figure 43G,I).
  • sequenced spots enriched in iCre expression fell within two clusters (clusters 3 and 5), straddling two transcriptionally distinct regions, both of which spatially mapped onto different domains of the motor cortex (Figure 43G).
  • iCre mRNA was used as a surrogate measure of Ascl1 transcripts as the two genes are transcribed from a single, bicistronic message separated by a t2a peptide sequence that promotes ribosome skipping and effective translation of two proteins 46 (Figure 44D).
  • Figure 44D As 3'end sequencing was performed in this study, only iCre (the 3' gene) was detected in the sequencing data set.
  • Figure 44E gene expression was normalized and scaled to isolate the DEGs that were specifically associated with the iCre transduced cells.
  • iCre control transduced cells express elevated levels of inflammatory markers
  • a heatmap was generated of the top 50 DEGs that are highly expressed in the iCre clusters, and not in the rest of the tissue ( Figure 44G).
  • the molecular signature associated with the transduction of the iCre control vector was first assessed by performing gene ontology (GO) analysis of the DEGs ( Figure 44H). Semantic similarity based treemap plots were used to image the GO terms, which allow hierarchical structures to be visualized, with the size of the space proportional to the GO score.
  • top GO categories associated with control iCre transduction included several immune system ⁇ specific terms, including “defense response to other organism”, “positive regulation of immune system”, “immune system process”, “antigen processing and presentation of peptide antigen”, “macrophage activation” and “microglial cell activation” ( Figure 44H).
  • Another branch of upregulated GO terms were associated with neuronal development, function and maturation, such as “regulation of trans ⁇ synaptic signaling”, “modulation of chemical synaptic transmission”, “regulation of neurogenesis”, “axon development” and “synapse pruning” (Figure 44H).
  • the expression of signatory genes was mapped onto the spatial maps ( Figure 44I).
  • Ascl1 ⁇ and Ascl1 SA6 ⁇ transduced cells express genes associated with neuronal ⁇ specific gene ontology categories [00376] Next spatial maps of gene expression were generated for a subset of the top 50 DEGs that were expressed at elevated levels in the Ascl1 ⁇ and Ascl1 SA6 ⁇ transduced spots (i.e., iCre + ) compared to the rest of the tissue ( Figure 44G).
  • One of the most variably expressed genes was prostaglandin D2 synthase (Ptgds), which synthesizes PGD2, a neuroprotective prostaglandin that is upregulated in astrocytes and oligodendrocytes in dymyelinating diseases as a stress reaction 53 .
  • GABAergic neuronal markers such as Pvalb, Gad1 and Sst, which are induced by Ascl1 expression in postnatal astroglia in vitro 13 , were among the top 50 DEGs (Figure 44G).
  • Ptgds, Pvalb1, Gad1 and Sst revealed unique enriched expression patterns for each gene, expression differences in the injection sites compared to the rest of the tissue were not readily discernable in each of the uninjected, iCre, Ascl1 and Ascl1 SA6 injected brains, likely due to the relatively high expression of each of these genes in cortical tissue in general (Figure 46A).
  • Upregulated GO terms in the Ascl1 ⁇ transduced brains included several neuronal terms, including “potassium ion transport”, “regulation of dendrite morphogenesis” and “modulation of chemical synaptic transmission” (Figure 46D). Strikingly, a different set of GO terms were enriched in Ascl1 SA6 transduced brains, suggesting that these two TFs have distinct effects. Included were neuronal categories, such as “protein localization to axon and junctional assembly”, along with general GO terms, such as “negative regulation of cell differentiation” (Figure 46F). [00379] Also of interest were the GO terms that were downregulated upon Ascl1 transduction, which included “glial cell proliferation”, consistent with a potential loss of glial identity.
  • GRNs Gene regulatory networks
  • Gfap an inflammatory astrocytic marker
  • Nfic a TF required for Gfap expression 58
  • Satb2 and Tbr1 layer ⁇ specific neuronal markers 59
  • Mbp a marker of myelination that is expressed at reduced levels in neurodegenerative diseases 60
  • Ctsb a lysosomal protease expressed in microglia and astrocytes that is associated with neuroinflammation 61
  • Figure 47A ⁇ C log2FC for inflammatory genes such as Gfap were highest in the iCre ⁇ transduced cells.
  • pro ⁇ inflammatory genes such as Stat1, a cytokine regulated TF 66 , Irf7, a TF regulator that forms a positive feedback loop with type 1 interferons 66 , Cxcl1, a neutrophil attracting cytokine 67 , Ccl5, a pro ⁇ inflammatory chemokine 68 , Nr4a1, a nuclear receptor upregulated in activated microglia following ischemic insult 69 , Egr1, an oxidative stress responsive TF 70 , Fabp5, which regulates blood ⁇ brain ⁇ barrier permeability 71 , Litaf, a TF regulator of the inflammatory response 72 , and Cepbd, a TF that increases Sod1 expression and oxidative stress in astrocytes 73 ( Figure 47A).
  • pro ⁇ inflammatory genes such as Stat1, a cytokine regulated TF 66 , Irf7, a TF regulator that forms a positive feedback loop with type 1 interferons 66 , Cxc
  • Neurod6 was also upregulated by iCre transduction, a bHLH gene that protects against oxidative stress by conferring cellular tolerance 74 , which may be a response to the pro ⁇ inflammatory state induced by AAV transduction (Figure 47A).
  • iCre transduction a bHLH gene that protects against oxidative stress by conferring cellular tolerance 74 , which may be a response to the pro ⁇ inflammatory state induced by AAV transduction
  • a set of DEGs was specifically down regulated by iCre 7 including the neural stem and progenitor cell (NSPC) markers Lhx2 75 , Hes5 76 , and Cux2 77 , and Ptprz1, a susceptibility gene for schizophrenia 25,78 7 (Figure 47A), also validated in log2FC plots ( Figure 47D).
  • NSPC neural stem and progenitor cell
  • Figure 47A a susceptibility gene for schizophrenia 25,78 7
  • Figure 47D also validated in log2FC plots
  • Gene regulatory networks associated with Ascl1 and Ascl1 SA6 transduction include upregulated neuronal and downregulated glial genes
  • Ascl1 and Ascl1 SA6 GRNs differed substantively from the iCre GRN, but also displayed some similarities to each other, including enriched expression of Ascl1 itself, along with Zbtb18 and Id2 ( Figure 47B,C).
  • Zbtb18 is a BTB/POZ ⁇ domain, zinc ⁇ finger transcriptional repressor, the mutation of which is associated with abnormal neocortical development, including microcephaly or macrocephaly, intellectual disability and epilepsy 81 .
  • the two GRNs differed, with genes elevated in the Ascl1 GRN including Egr3, which plays a role in neurite outgrowth 82 , Pcsk2, a prohormone convertase required for neuropeptide biosynthesis 83 , Bhlhe40, a bHLH TF, the loss of which leads to cortical hyperexcitability 84 , and Pou4f1, required to maintain mature postmitotic neurons 85 (Figure 4B,D).
  • Ascl1 SA6 additionally increased expression of Ptgds, a neuroprotective factor 53 , and Olig1, a bHLH TF that promotes oligodendrocyte differentiation 86 , as confirmed in log2FC plots ( Figure 4C,D).
  • both Ascl1 and Ascl1 SA6 have GRNs that share some common TF nodes (Zbtb18, Id3), but also differ in several respects.
  • Next gene expression that was downregulated Ascl1 or Ascl1 SA6 GRNs ( Figures 4B,C) was examined.
  • glia including Npas4, a neuroprotective bHLH ⁇ PAS domain TF, the loss of which activates cortical microglia and astrocytes 87 , Thra, a thyroid hormone nuclear receptor, which when knocked ⁇ out promotes precocious neurogenesis 88 , Junb, an immediate early gene, the expression of which is associated with short ⁇ term neuronal activity 89 , and Clu, or clusterin, also known as ApoJ, a gene expressed in astrocytes and in presynaptic terminals, the overexpression of which promotes excitatory neurotransmission and reduces AD risk 90 .
  • Npas4 a neuroprotective bHLH ⁇ PAS domain TF
  • the loss of which activates cortical microglia and astrocytes 87 , Thra a thyroid hormone nuclear receptor, which when knocked ⁇ out promotes precocious neurogenesis 88 , Junb, an immediate early gene, the expression of which is associated with short ⁇ term neuronal activity 89 ,
  • Nefl encodes a neurofilament light chain protein that forms neuronal intermediate filaments, and loss ⁇ of ⁇ function mutations are associated with neurodegeneration in Charcot ⁇ Marie ⁇ Tooth disease 92 .
  • the upregulation of Nefl may thus be a neuroprotective response to viral transduction in the brain (our study), and in vitro in brain astrocytes cultured in a dish 10 .
  • Hemoxygenase 1 similarly offers neuroprotection and is normally downregulated in ALS 93 .
  • Ptprz1 encodes a multifunctional receptor protein tyrosine phosphatase that is expressed in neurons and glia and is a susceptibility gene for schizophrenia 78 .
  • Ptprz1 may also participate in the immune response as it serves as a receptor for Interleukin ⁇ 34 (IL ⁇ 34) 94 , a pro ⁇ inflammatory cytokine 95 .
  • IL ⁇ 34 Interleukin ⁇ 34
  • control viral transductions have shared transcriptional profiles, whether transduced in vitro or in vivo, and irrespective of the viral vector source.
  • Zbtb18 is an essential node TF in Ascl1 GRNs
  • Ascl1 and Ascl1 SA6 GRNs were compared to the in vitro neuronal reprogramming studies. Strikingly, the expression of Ascl1 ERT2 in postnatal astrocytes, or ASCL1 and ASCL1 SA5 in neuroblastoma cells, all upregulated the expression of Zbtb18 and Id3 ( Figure 47G,J, Figure 48B,C).
  • Egr3 and Pcsk2 were upregulated by Ascl1 ERT2 in P5 astrocytes (Figure 48B,C) and by ASCL1 and ASCL1 SA5 in neuroblastoma cells ( Figure 47G,H,J,K).
  • Id3 expression was induced only by Ascl1 SA6 in the present study in vivo, and by ASCL1 SA5 in neuroblastoma cells in vitro ( Figure 47H,K).
  • Zbtb18 and Id2 are the two genes that are commonly upregulated by Ascl1 and Ascl1 SA mutants in both studies, but given the link between ZBTB18 mutations and cortical malformations 81 , the present study further focused on this TF.
  • Zbtb18 was expressed at higher levels in the glutamatergic lineage, although there were some positive cells in GABAergic cells as well 98 .
  • the main source of transcript variability in this data set corresponds to dorsoventral (DV) position, which can be represented graphically on a pseudo ⁇ DV plot ( Figure 47P).
  • Ascl1 and Neurog2 had ventral and dorsal biases, respectively, while Zbtb18 was evenly expressed across the D/V axis ( Figure 47P).
  • pseudotime comparisons were performed of Ascl1, Neurog2 and Zbtb18 in the dorsal (dark grey) and ventral (light grey) lineages (Figure 47Q).
  • the goal of this Example was to provide evidence for neuronal lineage conversion in vivo using a ST approach.
  • a 10X Visium platform was used to examine the global effect of expressing Ascl1 and Ascl1 SA6 TFs in astrocytes in the hSOD1 G93A motor cortex, at a time point when deep layer neuronal degeneration has initiated.
  • the delivery paradigm was based on AAV5 viral vectors carrying an astrocyte ⁇ specific GFAP promoter, along with a t2a ⁇ iCre sequence to allow visualization of viral transduction using a Rosa ⁇ zsGreen reporter.
  • Zbtb18 a neurogenic program centered on a novel TF, Zbtb18, is activated by Ascl1 and Ascl1 SA6 in vivo and in vitro.
  • ZBTB18 aka RP58
  • ZBTB18 is of interest as mutations in this gene are associated with abnormal neocortical development, including microcephaly or macrocephaly, intellectual disability and epilepsy 81 .
  • the knockdown of Zbtb18 in the embryonic cortex not only disrupts neuronal migration, but also the morphological maturation of newborn neurons, placing this TF as an essential neuronal differentiation gene 99 .
  • Id transcription factors block type II bHLH TFs such as Ascl1, either by forming non ⁇ functional heterodimers or by sopping up type I E ⁇ protein cofactors.
  • Id2 is induced by kainic acid injuries in the hippocampus that induce neuronal sprouting, which can be phenocopied when Id2 is mis ⁇ expressed in the adult brain, Id2 is also capable of driving sprouting of mossy fibers in the adult hippocampus 100 .
  • Id2 activated JAK/STAT and interferon signaling 100 .
  • Id2 induces the expression of downstream TF that include Bhlhe40 and Egr1 100 , and interestingly, both TFs are induced when Ascl1 is upregulated in adult astrocytes in this study.
  • Id2 was also shown to be necessary for Ascl1 ⁇ driven neurogenesis in the embryonic chick spinal cord 101 .
  • the reliance on Id2 was stronger for ventral spinal cord progenitors that rely on Ascl1 than the dorsal spinal cord progenitors that rely on Neurog2 101 .
  • transcriptional profiling revealed that the iCre control vector had the greatest effect on global gene expression, initiating a transcriptional pro ⁇ inflammatory response that included markers of reactive astrocytes, activated microglia and macrophage, and the complement system.
  • iCre clusters associated with Ascl1 or Ascl1 SA6 overexpression there was no observation of the same elevated expression of immune response genes triggered by the control vector.
  • the inflammatory signature of the iCre transduced cells was unexpected, especially given how far AAVs have moved into the clinic, with 11 FDA approvals 102 .
  • the present Example provides spatially resolved transcriptomic data that supports the use of bHLH transcription factors, particularly the mutant bHLH transcription factors described herein, promote neuronal lineage conversion when expressed in brain astrocytes in vivo.
  • the present data further identifies Zbtb18 as being useful as a new neuronal conversion factor, optionally together with a mutant bHLH transcription factor as described herein.
  • the present application further provides a ZBTB18 transcription factor or a nucleic acid encoding the ZBTB18 transcription factor for use in neuronal transformation of glial cells in a subject.
  • the ZBTB18 transcription factor has an amino acid sequence that is at least 80%, 85%, 90%, 95%, or 97% identical to to one of SEQ ID NOs:36, 38, 40, 42, 44, 46, 48, 50, 52 or 54.
  • the amino acid sequences of SEQ ID NOs: 36, 38, 40, 42, 44, 46, and 48 correspond with the sequence of mouse ZBTB18 variants transcription factor 1 – 7, respectively.
  • NCBI National Library of Medicine
  • NCBI Reference Sequences for the corresponding mRNA transcripts NM_00102330, NM_013915, NM_001355098, NM_001355099, NM_001355100, NM_001355101 and NM_001355102, respectively.
  • the mRNA sequences are listed in the present application as SEQ ID NOs: 37, 39, 41, 43, 45, 47, and 49, respectively.
  • the amino acid sequences of SEQ ID NOs:50, 52 or 54 correspond with the sequences of the human ZBTB18 transcription factor variants 1, 2 and 3, respectively.
  • compositions comprising a ZBTB18 transcription factor having an amino acid sequence that is at least 80%, 85%, 90%, 95%, or 97% identical to one of SEQ ID NOs:36, 38, 40, 42, 44, 46, 48, 50, 52 or 54, or a nucleic acid encoding the the ZBTB18 transcription factor having an amino acid sequence that is at least 80%, 85%, 90%, 95%, or 97% identical to one of SEQ ID NOs:36, 38, 40, 42, 44, 46, 48, 50, 52 or 54, which may be within a viral or non ⁇ viral vector.
  • the present applicaton further provides vectors comprising a nucleic acid sequence encoding a ZBTB18 transcription factor having an amino acid sequence that is at least 80%, 85%, 90%, 95%, or 97% identical to one of SEQ ID NOs:36, 38, 40, 42, 44, 46, 48, 50, 52 or 54. Suitable vectors are described in detail above, in relation to the mutant bHLH transcription factor expressing vectors.
  • the nucleic acid sequence is optionally a sequence that at least 80%, 85%, 90%, 95%, or 97% identical to one of SEQ ID NOs: 37, 39, 41, 43, 45, 47, 49, 51, 53 or 55.
  • Adeno ⁇ associated virus reduces cortical dendritic complexity in a TLR9 ⁇ dependent manner. bioRxiv, 2021.2009.2028.462148, doi:10.1101/2021.09.28.462148 (2021). 80 Johnston, S. et al. AAV ablates neurogenesis in the adult murine hippocampus. Elife 10, doi:10.7554/eLife.59291 (2021). 81 Heng, J. I., Viti, L., Pugh, K., Marshall, O. J. & Agostino, M. Understanding the impact of ZBTB18 missense variation on transcription factor function in neurodevelopment and disease. J Neurochem 161, 219 ⁇ 235, doi:10.1111/jnc.15572 (2022).
  • Receptor ⁇ type protein ⁇ tyrosine phosphatase zeta is a functional receptor for interleukin ⁇ 34. J Biol Chem 288, 21972 ⁇ 21986, doi:10.1074/jbc.M112.442731 (2013). 95 Munoz ⁇ Garcia, J. et al. The twin cytokines interleukin ⁇ 34 and CSF ⁇ 1: masterful conductors of macrophage homeostasis. Theranostics 11, 1568 ⁇ 1593, doi:10.7150/thno.50683 (2021). 96 Pollen, A. A. et al. Low ⁇ coverage single ⁇ cell mRNA sequencing reveals cellular heterogeneity and activated signaling pathways in developing cerebral cortex.
  • Rp58 and p27(kip1) coordinate cell cycle exit and neuronal migration within the embryonic mouse cerebral cortex.
  • 100 Luo, W. et al. Recurrent rewiring of the adult hippocampal mossy fiber system by a single transcriptional regulator, Id2.
  • EXAMPLE 7 Neuronal lineage conversion targeting motor cortex astrocytes delays motor symptom progression in an ALS mouse model
  • ALS Amyotrophic lateral sclerosis
  • Spinal cord motor neurons innervate skeletal, visceral and cardiac muscles, and their loss leads to muscle denervation and atrophy, which ultimately causes death due to respiratory muscle failure 1 .
  • the dying back hypothesis suggests that ALS pathology initiates in lower motor neurons in the spinal cord, which leads to progressive neurodegeneration of upper motor neurons in the deep layers of the motor cortex 2,3 .
  • TMS transcranial magnetic stimulation
  • hSOD1 G93A transgenic animals dendritic regression, spine loss and hyperexcitability are observed in the motor cortex before motor symptom onset 8 .
  • UMN death may initiate disease progression.
  • knockdown of mutant SOD1 in the motor cortex of SOD1 G93A rats prior to symptom onset delays disease progression, increases survival, and delays LMN and neuromuscular junction degeneration 9 .
  • AAV ⁇ mediated retrograde labelling of neocortical neurons in hSOD1 G93A transgenics also revealed upper MN degeneration and a loss of layer II/III apical dendrites at P60 10 .
  • the dying ⁇ forward model also proposed that pathology in the motor cortex may not only precede spinal cord disease, but also drive the disease forward. As a corollary to this model, it has been suggested that by preventing the death of upper motor neurons, disease progression could be stalled.
  • neurodegeneration in ALS is a non cell autonomous consequence of a pathogenic change in astrocytes 14,15 .
  • astrocytes provide nutrients and neuroprotective molecules to sustain neuronal health 16 .
  • astrocytes undergo a reactive transformation and begin to produce neurotoxic molecules that trigger neurodegeneration 17 .
  • Neuroinflammation is triggered initially by pro ⁇ inflammatory microglia, which secrete cytokines that activate A1 astrocytes 14,15,18 .
  • A2 astrocytes are activated by anti ⁇ inflammatory cytokines and in response, secrete neurotrophic factors to support neuronal survival 17,19 .
  • hiPSCs human induced pluripotent stem cells
  • astrocytes that spontaneously become reactive and induce complement component 3 (C3) gene expression even in the absence of a proinflammatory cue 20 .
  • C3 complement component 3
  • astrocytes induce neuronal cell death in an ALS animal model when transplanted into a healthy host brain 16 , highlighting the importance of these cells for therapeutic intervention.
  • TF proneural transcription factor
  • iNeurons induced neurons
  • Homozygous zsGreen mice were generated by breeding zsGreen (Jackson laboratory:B6.Cg ⁇ Gt(ROSA)26Sor tm6(CAG ⁇ ZsGreen1)Hze /J) males and females.
  • hSOD1 G93A Jackson laboratory: B6;Cg ⁇ Tg(SOD1 ⁇ G93A)1Gur/J) male and Female litter mice were maintained on C57Bl/6J genetic background. The models were bred and verified as described above in Example 6.
  • AAV Intracranial injections AAV5 ⁇ GFAP ⁇ iCre plasmid was gift from Dr. Faiz's lab.
  • AAV5 ⁇ GFAP ⁇ iCre and AAV5 ⁇ GFAP ⁇ Ascl1/SA6 ⁇ t2a ⁇ iCre were packaged by VectorBuilder Inc.
  • AAV5 ⁇ CAG ⁇ Flex ⁇ EGFP catalog # 51502 ⁇ AAV5 was purchased from Addgene.
  • mice were anaesthetized using isoflurane (2%, 1L/min; Fresenius Kabi, CP0406V2) and injected subcutaneously with an analgesic, either buprenorphine (0.1 mg/kg; Vetergesic, 02342510] or Tramadol ⁇ HCL (20 mg/kg; Chiron, RxN704598), along with baytril (2.5 mg/kg; Bayer, 02249243), and saline (0.5 ml, Braun, L8001).
  • a burr hole was drilled through the skull over the cortex and a stereotaxic instrument was used to identify bregma and lambda for injection at layer V region (AP: +2.15, L/M: ⁇ 1.7, DV: ⁇ 1.7).
  • Cre driver AAV with Cre dependent AAV were combined.
  • 4.8 x 10 9 GC in a 1 uL total volume of AAV5 ⁇ GFAP ⁇ iCre and AAV5 ⁇ CAG ⁇ Flex ⁇ EGFP or AAV5 ⁇ GFAP ⁇ Ascl1/SA6 ⁇ t2a ⁇ iCre with AAV5 ⁇ CAG ⁇ Flex ⁇ EGFP were injected into 16 weeks old hSOD1 G93A transgenic ALS mice. Mice were scarified after 21 dpi.
  • AAV5 ⁇ GFAP ⁇ iCre and AAV5 ⁇ GFAP ⁇ Ascl1/SA6 ⁇ t2a ⁇ iCre viral vectors were bilaterally injected into the motor cortex layer V region (AP: +2.15, L/M: ⁇ 1.7, DV: ⁇ 1.7) at a volume 1 ⁇ l over 10 min using 5 ⁇ l Hamilton syringe with 30 ⁇ gauge needle.
  • Surgeries were performed at week 16 C57Bl/6J mice and scarified after 21 dpi to count neuronal conversion rate.
  • the same injection protocols were performed into 16 weeks old zsGreen mice for control and 16 weeks old zsGreen/hSOD1 G93A transgenic ALS mice.
  • mice 19 weeks old zsGreen/hSOD1 G93A transgenic ALS mice were tested. All these mice were monitored for their disease progression by checking their body weight, NS, motor behavior test (Rotarod, grip strength, and gait analysis or catwalk) until the experimental endpoint. When mice were not able to right themselves within 30 sec after being placed on either side, they were sacrificed. [00424] Tissue Collection, Processing, and Sectioning. Mice were anesthetized with ketamine (75 mg/kg, Narketan, 0237499) and xylazine (10 mg/kg, Rompun, 02169592) prior to perfusion.
  • ketamine 75 mg/kg, Narketan, 0237499
  • xylazine 10 mg/kg, Rompun, 02169592
  • Intracardially perfusion was performed with approximately 20x of their blood volume using a peristaltic pump at a flow rate of 10 ml/min with ice cold saline (0.9% NaCl, Braun, L8001), followed by 4% paraformaldehyde (PFA, Electron Microscopy Sciences, 19208) in phosphate buffer saline (PBS, Wisent, 311 ⁇ 011 ⁇ CL) for approximately five minutes. Brains were collected and post ⁇ fixed overnight in 4% PFA in PBS, then transfer to a 20% sucrose for cryoprotection.
  • Body weight and Neuroscore (NS) was measured before intracranial injections and continued to measure their bodyweight every week until their end ⁇ point.
  • NS 1 started ALS phenotype. A symptomatic stage was when mice walk normally but their hindlimbs were collapsed or partially collapsed towards the midline. NS 2 was the onset of paresis. Animals can walk but their toes curl downwards while walking. At NS 3, mice can walk but they did not use their hindlimbs to make a forward motion. NS 4 was the humane end ⁇ point, when animals cannot right themselves in 10 sec. [00426] Motor Coordination Analysis. Motor coordination, strength, and balance were assessed in rotarod apparatus. Mice started train on the rotarod one week before recording the data. Mice were placed onto a cylinder and rotation started with 2rpm. Within 180 sec the rotation speed increased up to 18rpm over a min.
  • Grip Strength Grip strength meter (BiosebTM) was used to study neuromuscular function. Mice were held by the tail over a 100 x 80 mm at an angle of 20° grid holder. Once mice were firmly grasping the grid, they were pulled along the axis of the force sensor until they release the grid. Grip strength tests were done in three rounds of one trial with 5 min in home cages between the rounds. All grip strength tests were normalized to body weight.
  • Gait Analysis Gait abnormalities were assessed by analyzing the footprint pattern of mice as they walked along a 50 cm long and 10 cm wide runway. Forelimbs were painted with a red dye and hindlimbs were painted with a blue dye. Footprint patterns were analyzed for three step parameters: 1) stride length, to measure the average distance of forward movement between each stride; 2) sway distance, to measure the average distance between left and right hind footprints; 3) stance length, to measure the average distance from left or right front footprint to right or left hind footprint.
  • CatWalk XT ® In the current study the CatWalk ® (Noldus Information Technology, Wageningen, The Netherlands) version 11 was used for gait assessment.
  • the CatWalk® gait analysis system used to capture gait parameters uses illuminated footprints. Unlike painting paws of mouse, the ALS mouse is positioned at the beginning of the glass floor walkway and freely walk toward the home cage voluntarily. In most cases the maximum six runs are conducted and three runs which is a maximum speed variation of 60% were selected for analysis. The distance between successive placements of the same left and right paws are analyzed to capture gait parameters every week until mice are unable to continue the tests.
  • Adeno ⁇ associated virus (AAV) 5 carrying a glial fibrillary acid promoter (GFAP) was used to express Ascl1 SA6 in motor neuron astrocytes.
  • a (v2a) ⁇ iCre cassette was included so that transduced cells could be detected using a Rosa ⁇ zsGreen reporter.
  • the following two constructs were used in this study: a control AAV expressing iCre alone (AAV5 ⁇ GFAP ⁇ iCre, hereafter iCre) and the test vector expressing Ascl1 SA6 (AAV5 ⁇ GFAP ⁇ Ascl1 SA6 ⁇ t2a ⁇ iCre, hereafter Ascl1 SA6 ).
  • the two AAVs were injected into the motor cortex (AP: +2.15, L/M: ⁇ 1.7, DV: ⁇ 1.7) in four cohorts of mice each; male and female Rosa ⁇ zsGreen (control) and male and female hSOD1 G93A ;Rosa ⁇ zsGreen (ALS model) mice.
  • ALS is a wasting disease
  • weekly measures of body weight and motor behaviour were used to assess the impact of expressing Ascl1 SA6 , a neurogenic TF, in motor cortex astrocytes. Baseline measurements were made at 15 ⁇ weeks of age for each test in the four animal cohorts, one week prior to AAV injection at 16 ⁇ weeks of age, with 28 weeks set as the experimental endpoint.
  • NS Neuroscore
  • mice retained motor function longer than females, as they typically remained at NS 1 for 37 days while female hSOD1 G93A mice stayed at NS 1 for 28 days.
  • animals of both sexes deteriorated rapidly, with male and female mice spending only 5 days at NS 2 and less than 5 days at NS 3, before proceeding to NS 4 and humane sacrifice 22 .
  • two male mice survived and stayed at NS 0 until the 28 ⁇ week experimental endpoint ( Figure 50A) and one female mouse stayed at NS 1 until 26 weeks ( Figure 50B).
  • Ascl1 SA6 improves survival times for male hSOD1 G93A mice when expressed in motor cortex astrocytes at 16 weeks of age.
  • hSOD1 G93A mice lost motor capacity over time, and showed an age ⁇ dependent decrease in latency to fall compared to control mice.
  • Catwalk is a gait analysis system that can be used to assess a larger number of gait abnormalities in an automated manner.
  • EXAMPLE 8 Ascl1 ⁇ SA7 repression of Sox9 expression in transduced cortical cells
  • the cortex of Rosa ⁇ zsGreen mice were transduced with AAV8 ⁇ GFAPshort ⁇ iCre, AAV8 ⁇ GFAPshort ⁇ Ascl1 ⁇ t2a ⁇ iCre, AAV8 ⁇ GFAPshort ⁇ Ascl1 ⁇ SA6 ⁇ t2a ⁇ iCre and AAV8 ⁇ GFAPshort ⁇ Ascl1 ⁇ SA7 ⁇ t2a ⁇ iCre, where the packaged AAVs were injected using stereotactic surgery into the cerebral cortex of Rosa ⁇ zsGreen mice, as described in the Examples above. At 21 days post ⁇ transduction, the mice were sacrificed and cortical tissue analyzed, as also described above.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • Veterinary Medicine (AREA)
  • Neurosurgery (AREA)
  • Neurology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Wood Science & Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Plant Pathology (AREA)
  • Virology (AREA)
  • Toxicology (AREA)
  • Hospice & Palliative Care (AREA)
  • Psychiatry (AREA)
  • Microbiology (AREA)
  • Physics & Mathematics (AREA)
  • Immunology (AREA)
  • Marine Sciences & Fisheries (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/CA2022/050923 2021-06-09 2022-06-09 Method and compositions for neuronal reprogramming Ceased WO2022256933A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
KR1020247000754A KR20240032021A (ko) 2021-06-09 2022-06-09 신경 재프로그래밍을 위한 방법 및 조성물
CA3222129A CA3222129A1 (en) 2021-06-09 2022-06-09 Method and compositions for neuronal reprogramming
JP2023575711A JP2024521401A (ja) 2021-06-09 2022-06-09 神経細胞リプログラミングのための方法及び組成物
IL309190A IL309190A (en) 2021-06-09 2022-06-09 Method and compositions for neuronal reprogramming
AU2022288230A AU2022288230A1 (en) 2021-06-09 2022-06-09 Method and compositions for neuronal reprogramming
CN202280051836.7A CN117881692A (zh) 2021-06-09 2022-06-09 用于神经元重编程的方法和组合物
BR112023025888A BR112023025888A2 (pt) 2021-06-09 2022-06-09 Método e composições para reprogramação neuronal
US18/568,747 US20250282837A1 (en) 2021-06-09 2022-06-09 Method and compositions for neuronal reprogramming
MX2023014769A MX2023014769A (es) 2021-06-09 2022-06-09 Metodo y composiciones para la reprogramacion neuronal.
EP22819038.5A EP4352085A4 (en) 2021-06-09 2022-06-09 METHOD AND COMPOSITIONS FOR NEURAL REPROGRAMMING

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202163208627P 2021-06-09 2021-06-09
US63/208,627 2021-06-09

Publications (1)

Publication Number Publication Date
WO2022256933A1 true WO2022256933A1 (en) 2022-12-15

Family

ID=84424544

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/CA2022/050923 Ceased WO2022256933A1 (en) 2021-06-09 2022-06-09 Method and compositions for neuronal reprogramming

Country Status (11)

Country Link
US (1) US20250282837A1 (enExample)
EP (1) EP4352085A4 (enExample)
JP (1) JP2024521401A (enExample)
KR (1) KR20240032021A (enExample)
CN (1) CN117881692A (enExample)
AU (1) AU2022288230A1 (enExample)
BR (1) BR112023025888A2 (enExample)
CA (1) CA3222129A1 (enExample)
IL (1) IL309190A (enExample)
MX (1) MX2023014769A (enExample)
WO (1) WO2022256933A1 (enExample)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115670390A (zh) * 2022-12-30 2023-02-03 广东工业大学 一种帕金森病轴向症状严重程度表征方法

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20220084391A (ko) * 2019-10-21 2022-06-21 에꼴 뽈리떼끄닉 뻬데랄 드 로잔느 (으뻬에프엘) 분기 형태들 합성

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2014037527A1 (en) * 2012-09-07 2014-03-13 Cambridge Enterprise Limited Maturation of mammalian cells by modulation of protein phosphorylation

Non-Patent Citations (6)

* Cited by examiner, † Cited by third party
Title
BRENNER ET AL.: "GFAP Promoter Directs Astrocyte-specific Expression in Transgenic Mice", THE JOURNAL OF NEUROSCIENCE, vol. 14, no. 3, 1 March 1994 (1994-03-01), pages 1030 - 1037, XP009115202, [retrieved on 20220803], DOI: 10.1523/JNEUROSCI.14-03-01030.1994 *
DENNIS DANIEL J., HAN SISU, SCHUURMANS CAROL: "bHLH transcription factors in neural development, disease, and reprogramming", BRAIN RESEARCH, ELSEVIER, AMSTERDAM, NL, vol. 1705, 1 February 2019 (2019-02-01), NL , pages 48 - 65, XP093015127, ISSN: 0006-8993, DOI: 10.1016/j.brainres.2018.03.013 *
DENNIS ET AL.: "Neurog2 and Ascll together regulate a postmitotic", PNAS, vol. 114, no. 25, 5 June 2017 (2017-06-05), pages E4934 - E4943, XP055911296, [retrieved on 20220711], DOI: 10.1073/pnas.1701495114 *
HARDWICK LAURA J.A., DAVIES JOHN D., PHILPOTT ANNA: "Multi-site phosphorylation controls the neurogenic and myogenic activity of E47", BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS, ELSEVIER, AMSTERDAM NL, vol. 511, no. 1, 1 March 2019 (2019-03-01), Amsterdam NL , pages 111 - 116, XP093015108, ISSN: 0006-291X, DOI: 10.1016/j.bbrc.2019.02.045 *
HARDWICK LAURA J.A., PHILPOTT ANNA: "Interaction between opposing modes of phospho-regulation of the proneural proteins Ascl1 and Ngn2", WELLCOME OPEN RESEARCH, vol. 3, no. 129, 1 January 2018 (2018-01-01), pages 1 - 11, XP093015117, DOI: 10.12688/wellcomeopenres.14848.1 *
See also references of EP4352085A4 *

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115670390A (zh) * 2022-12-30 2023-02-03 广东工业大学 一种帕金森病轴向症状严重程度表征方法
CN115670390B (zh) * 2022-12-30 2023-04-07 广东工业大学 一种帕金森病轴向症状严重程度表征方法

Also Published As

Publication number Publication date
IL309190A (en) 2024-02-01
AU2022288230A1 (en) 2023-12-21
MX2023014769A (es) 2024-01-30
EP4352085A4 (en) 2025-07-23
KR20240032021A (ko) 2024-03-08
CN117881692A (zh) 2024-04-12
US20250282837A1 (en) 2025-09-11
JP2024521401A (ja) 2024-05-31
EP4352085A1 (en) 2024-04-17
CA3222129A1 (en) 2022-12-15
BR112023025888A2 (pt) 2024-02-27

Similar Documents

Publication Publication Date Title
Furman et al. Blockade of astrocytic calcineurin/NFAT signaling helps to normalize hippocampal synaptic function and plasticity in a rat model of traumatic brain injury
Zeitler et al. Allele-selective transcriptional repression of mutant HTT for the treatment of Huntington’s disease
Fagoe et al. Overexpression of ATF3 or the combination of ATF3, c-Jun, STAT3 and Smad1 promotes regeneration of the central axon branch of sensory neurons but without synergistic effects
Cui et al. Designer self-assemble peptides maximize the therapeutic benefits of neural stem cell transplantation for Alzheimer’s disease via enhancing neuron differentiation and paracrine action
Bouvier et al. The multifaceted neurotoxicity of astrocytes in ageing and age-related neurodegenerative diseases: a translational perspective
Pourabdolhossein et al. Nogo receptor inhibition enhances functional recovery following lysolecithin-induced demyelination in mouse optic chiasm
Jeong et al. Extracellular Vesicles Released from Neprilysin Gene‐Modified Human Umbilical Cord‐Derived Mesenchymal Stem Cell Enhance Therapeutic Effects in an Alzheimer’s Disease Animal Model
Ghazale et al. Ascl1 phospho-site mutations enhance neuronal conversion of adult cortical astrocytes in vivo
Lin et al. The cell neural adhesion molecule contactin-2 (TAG-1) is beneficial for functional recovery after spinal cord injury in adult zebrafish
JP2010531638A (ja) 標的化された細胞死
JP7261352B2 (ja) アミロイドベータ蓄積及び/又は凝集抑制組成物及び抑制方法
Gupta et al. Human stem cell‐derived astrocytes and their application to studying N rf2‐mediated neuroprotective pathways and therapeutics in neurodegeneration
Melone et al. Huntington's disease: new frontiers for molecular and cell therapy
WO2022256933A1 (en) Method and compositions for neuronal reprogramming
Hei et al. Adenovirus vector-mediated ex vivo gene transfer of brain-derived neurotrophic factor (BDNF) tohuman umbilical cord blood-derived mesenchymal stem cells (UCB-MSCs) promotescrush-injured rat sciatic nerve regeneration
KR20210113606A (ko) 신경 질환을 검출, 예방, 회복 및 치료하는 방법
Guy et al. Human muscle progenitor cells overexpressing neurotrophic factors improve neuronal regeneration in a sciatic nerve injury mouse model
S. Choi et al. Neurorestorative role of stem cells in Alzheimer’s disease: astrocyte involvement
Rando et al. Intramuscular transplantation of bone marrow cells prolongs the lifespan of SOD1G93A mice and modulates expression of prognosis biomarkers of the disease
Knorr et al. The cytokine receptor CRLF3 is a human neuroprotective EV-3 (Epo) receptor
KR20220024104A (ko) 파킨슨병을 위한 자가 세포 대체 요법
Heredia et al. Motor improvement of skilled forelimb use induced by treatment with growth hormone and rehabilitation is dependent on the onset of the treatment after cortical ablation
US20220305027A1 (en) Methods of controlling and improving brain health
Tsai Therapy development for spinal muscular atrophy in SMN independent targets
Park Developing a Direct Neuronal Reprogramming Strategy to Improve Motor Function in Amyotrophic Lateral Sclerosis

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22819038

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 806275

Country of ref document: NZ

Ref document number: 2022288230

Country of ref document: AU

Ref document number: AU2022288230

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 309190

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2023575711

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: MX/A/2023/014769

Country of ref document: MX

Ref document number: 3222129

Country of ref document: CA

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023025888

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2022288230

Country of ref document: AU

Date of ref document: 20220609

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202427001210

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 20247000754

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2022819038

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022819038

Country of ref document: EP

Effective date: 20240109

WWE Wipo information: entry into national phase

Ref document number: 202280051836.7

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 112023025888

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20231208

WWP Wipo information: published in national office

Ref document number: 18568747

Country of ref document: US