WO2022245920A1 - Methods of evaluating brain injury in a pediatric subject - Google Patents
Methods of evaluating brain injury in a pediatric subject Download PDFInfo
- Publication number
- WO2022245920A1 WO2022245920A1 PCT/US2022/029798 US2022029798W WO2022245920A1 WO 2022245920 A1 WO2022245920 A1 WO 2022245920A1 US 2022029798 W US2022029798 W US 2022029798W WO 2022245920 A1 WO2022245920 A1 WO 2022245920A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- gfap
- uch
- sample
- antibody
- assay
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6893—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids related to diseases not provided for elsewhere
- G01N33/6896—Neurological disorders, e.g. Alzheimer's disease
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/90—Enzymes; Proenzymes
- G01N2333/914—Hydrolases (3)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
Definitions
- the present disclosure relates to methods of evaluating a pediatric subject for a head injury.
- the disclosure relates to methods of evaluating a pediatric subject for head injury by measuring glial fibrillary acid protein (GFAP) and/or ubiquitin carboxy-terminal hydrolase LI (UCH-L1) in a sample obtained from the subject.
- GFAP glial fibrillary acid protein
- UCH-L1 ubiquitin carboxy-terminal hydrolase LI
- TBI mild traumatic brain injuries
- GCS Glasgow Coma Score
- head CT is unrevealing for the vast majority of the time for mild TBI, is expensive, and exposes the patient to unnecessary' radiation.
- a negative head CT does not mean the patient has been cleared from having a concussion; rather it just means certain interventions, such as surgery, are not warranted.
- Clinicians and patients need objective, reliable information to accurately evaluate this condition to promote appropriate triage and recovery. To date, limited data have been available for the use of early biomarkers in the acute care setting to aid in patient evaluation and management.
- Mild TBI or concussion is hard to objectively detect and presents an everyday challenge in emergency care units globally. Concussion frequently causes no gross pathology, such as hemorrhage, and no abnormalities on conventional computed tomography scans of the brain, but rather rapid-onset neuronal dysfunction that resolves in a spontaneous manner over a few days to a few weeks. There is an unmet need for mild TBI victims to be evaluated for their TBI status on scene, in emergency rooms and clinics, in the hospital, in the sports area and in military activity (e.g., combat).
- provided herein are methods for evaluating a pediatric subject for a head injury.
- a method of evaluating a pediatric subject for a head injury comprises performing an assay on a sample which has been taken from the subject after an actual or suspected head injury to measure a level of ubiquitin carboxy-terminal hydrolase LI (UCH-L1), and/or a level of glial fibrillary acidic protein (GFAP) in the sample.
- the method comprises determining that the subject has sustained a traumatic brain injury (TBI) when the level of GFAP in the sample is greater than a reference level of GFAP.
- TBI traumatic brain injury
- the reference level of GFAP is at least about 30 pg/mL. In some embodiments, the reference level of GFAP is at least about 50 pg/mL. In some embodiments, the reference level of GFAP is at least about 65 pg/mL. In some embodiments, the reference level is about 1000 pg/mL. [0007] In some embodiments, the method comprises determining that the subject has sustained a TBI when the level of UCH-L1 in the sample is greater than a reference level of UCH-L1. In some embodiments, the reference level of UCH-L1 is at least about 55 pg/mL. In some embodiments, the reference level of UCH-L1 is about 300 pg/mL.
- the method comprises determining that the subject has sustained a TBI when the level of GFAP in the sample is greater than a reference level of GFAP and the level of UCH-L1 in the sample is greater than a reference level of UCH-L1.
- the reference level of GFAP is at least about 30 pg/mL and the reference level of UCH-L1 is about 360 pg/mL.
- the reference level of GFAP is about 65 pg/mL and the reference level of UCH-L1 is about 360 pg/mL.
- the sample is collected within about 48 hours after the actual or suspected head injury'. In other embodiments, the sample is collected within about 6 hours after the actual or suspected head injury. In other embodiments, the sample is collected within about 12 hours after the actual or suspected head injury. In other embodiments, the sample is collected within about 14 hours after the actual or suspected head injury. In other embodiments, the sample is collected within about 24 hours after the actual or suspected head injury. [0010] In some embodiments, the subject has received a Glasgow Coma Scale score before or after the assay is performed. In some embodiments, the subject is suspected as having a moderate to severe TBI based on the Glasgow Coma Scale score. In some embodiments, the reference level is correlated with subjects having moderate to severe TBI. In some embodiments, the subject is suspected as having mild TBI based on the Glasgow Coma Scale score. In some embodiments, the reference level is correlated with subjects having mild TBI.
- the reference level of GFAP is determined by an assay having a sensitivity of at least about 90% and a specificity of at least about 40%. In some embodiments, the reference level of GFAP is determined by an assay having a sensitivity of at least about 50% and a specificity of at least about 90%. In some embodiments, the reference level of GFAP is determined by an assay having a negative predictive value of at least about 70%. In some embodiments, the reference level of GFAP is determined by an assay having a negative predictive value of at least about 90%. In some embodiments, the reference level of GFAP is determined by an assay having a positive predictive value of at least about 50%. In some embodiments, the reference level of GFAP is determined by an assay having a positive predictive value of at least about 80%.
- the reference level of UCH-L1 is determined by an assay having a sensitivity of at least about 80% and a specificity of at least about 25%. In some embodiments, the reference level of UCH-L1 is determined by an assay having a sensitivity of at least about 30% and a specificity of at least about 90%. In some embodiments, the reference level of UCH-L1 is determined by an assay having a negative predictive value of at least about 65%. In some embodiments, the reference level of UCH-L1 is determined by an assay having a positive predictive value of at least about 40%. In some embodiments, the reference level of UCH-L1 is determined by an assay having a positive predictive value of at least about 80%.
- the reference level of GFAP and the reference level of UCH-L1 are determined by an assay having a sensitivity of at least 70% and a specificity of at least about 10%. In some embodiments, the reference level of GFAP and the reference level of UCH-L1 are determined by an assay having a sensitivity of at least about 65% and a specificity of at least about 25%. In some embodiments, the reference level of GFAP and the reference level of UCH-L1 are determined by an assay having a positive predictive value of at least about 35%. In some embodiments, the reference level of GFAP and the reference level of UCH-L1 are determined by an assay having a negative predictive value of at least about 40%.
- the reference level of GFAP and the reference level of UCH-L1 are determined by an assay having a negative predictive value of at least about 55%.
- the method further comprises treating the pediatric subject determined as having a TBI with a treatment for TBI and optionally, monitoring the pediatric subject after receiving said treatment.
- the method comprises performing an assay on a sample which has been taken from the subject after an actual or suspected head injury to measure a level of ubiquitin carboxy-terminal hydrolase LI (UCH-L1), and/or a level of glial fibrillary acidic protein (GFAP) in the sample.
- the method comprises determining that a head CT scan should be performed on the pediatric subject when the level of GFAP in the sample is greater than a reference level of GFAP.
- the reference level of GFAP is at least about 30 pg/mL.
- the reference level of GFAP is at least about 50 pg/mL. In some embodiments, the reference level of GFAP is at least about 65 pg/mL. In some embodiments, the reference level is about 1000 pg/mL.
- the method comprises determining that a head CT scan should be performed on the subject w'hen the level of UCH-L1 in the sample is greater than a reference level of UCH-L1.
- the reference level of UCH-L1 is at least about 55 pg/mL.
- the reference level of UCH-L1 is about 300 pg/mL.
- the method comprises determining that a head CT scan should be performed on the subject when the level of GFAP in the sample is greater than a reference level of GFAP and the level of UCH-L1 in the sample is greater than a reference level of UCH-L1.
- the reference level of GFAP is at least about 30 pg/mL and the reference level of UCH-L1 is about 360 pg/mL. In some embodiments, the reference level of GFAP is about 65 pg/mL and the reference level of UCH-L1 is about 360 pg/mL.
- the sample is collected within about 48 hours after the actual or suspected head injury. In other embodiments, the sample is collected within about 6 hours after the actual or suspected head injury. In other embodiments, the sample is collected within about 12 hours after the actual or suspected head injury. In other embodiments, the sample is collected within about 14 hours after the actual or suspected head injury . In other embodiments, the sample is collected within about 24 hours after the actual or suspected head injury. [0020] Any of the methods described herein may further comprise performing an assay on the samples to measure or detect a level of one or more other biomarkers that are not UCH- L1 or GFAP.
- one or more other biomarkers may be S100 ⁇ , neuron-specific enolase (NSE), lipoprotein 1, Tan, C-reactive protein (CRP), free brain -derived neurotrophic factor (BDMF), p-Tau, total BDNF, troponin I (Tnl), or a combination thereof.
- measuring the level of UCH-L1 comprises performing an immunoassay.
- measuring the level of UCH-L1 comprises contacting the sample, either simultaneously or sequentially, in any order with a capture antibody, which binds to an epitope on UCH-L1 or UCH-L1 fragment to form a capture antibody-UCH-Ll antigen complex, and a detection antibody which includes a detectable label and binds to an epitope on UCH-L1 that is not bound by the capture antibody, to form a UCH-L1 antigen-detection antibody complex, such that a capture antibody-UCH-Ll antigen-detection antibody complex is formed.
- the measuring further comprises measuring the amount or concentration of UCH-L1 in the sample based on the signal generated by the detectable label in the capture antibody-UCH-Ll antigen-detection antibody complex.
- measuring the level of GFAP comprises performing an immunoassay.
- measuring the level of GFAP comprises contacting the sample, either simultaneously or sequentially, in any order with a capture antibody, which binds to an epitope on GFAP or GFAP fragment to form a capture antibody-GFAP antigen complex, and a detection antibody which includes a detectable label and binds to an epitope on GFAP that is not bound by the capture antibody, to form a GFAP antigen-detection antibody complex, such that a capture antibody-GFAP antigen-detection antibody complex is formed.
- the measuring further comprises measuring the amount or concentration of UCH-L1 in the sample based on the signal generated by the detectable label in the capture antibody-UCH-Ll antigen-detection antibody complex.
- the sample is a whole blood sample, a serum sample, a cerebrospinal fluid sample, a plasma sample, a tissue sample, a saliva sample, an oropharyngeal sample, a. nasopharyngeal sample, a nasal mucus sample, or a. bodily fluid.
- the sample is obtained after the subject sustained a head injury caused by physical shaking, blunt impact by an external mechanical or other force that results in a closed or open head trauma, one or more falls, explosions or blasts or other types of blunt force trauma.
- the sample is obtained after the subject has ingested or been exposed to a chemical, toxin or combination of a chemical and toxin.
- the chemical or toxin is fire, mold, asbestos, a pesticide, an insecticide, an organic solvent, a paint, a glue, a gas, an organic metal, a drug of abuse or one or more combinations thereof.
- the sample is obtained from a pediatric subject that suffers from an autoimmune disease, a metabolic disorder, a brain tumor, hypoxia, a virus, meningitis, hydrocephalus or combinations thereof.
- the assay is an immunoassay or a clinical chemistry assay. In some embodiments, the assay is performed using single molecule detection, or a point-of- care device.
- FIG. 1 shows an ROC plot for GFAP levels in subjects ages 2-17.
- FIG. 2 shows an ROC plot for UCH-L1 levels in subjects ages 2-17.
- FIG. 3 shows a graph evaluating GFAP results by head computed tomography
- FIG. 4 shows a graph evaluating UCH-L1 results by CT status.
- the present disclosure relates to methods that aid in the determination of or determining whether a pediatric subject that has sustained or is suspected of sustaining a head injury has sustained a traumatic brain injury (TBI), such as mild TB1 (mTBI), based on the levels of UCH-L1, GFAP, or a combination thereof.
- TBI traumatic brain injury
- mTBI mild TB1
- mTBI mild TB1
- these methods involve measuring levels of UCH-L1, GFAP, or a combination thereof, in one or more samples taken from the pediatric subject.
- the sample or samples may be taken from the subject at a time point within about 48 hours, e.g., within about 24 hours (e.g., from zero to about 25 hours), of the actual or suspected head injury.
- the measurement of levels of GFAP, UCH- L1 or GFAP and UCH-L1, fragments thereof, or combinations thereof, that are equal or greater than reference levels of GFAP, UCH-L1 or GFAP and UCH- provides an aid in the determination of or determining whether the pediatric subject has sustained a TBI, such as a mild TBI or moderate to severe TBI, and/or is in need of further medical evaluation of the suspected injury TBI (e.g., CT imaging and/or MRI).
- the pediatric subject is a human subject.
- each intervening number there between with the same degree of precision is explicitly contemplated.
- the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.
- affinity matured antibody is used herein to refer to an antibody with one or more alterations in one or more CDRs, which result in an improvement in the affinity (i.e., KD, ka or ka) of the antibody for a target antigen compared to a parent antibody, which does not possess the alteration(s).
- Exemplary affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen.
- a variety of procedures for producing affinity matured antibodies is known in the art, including the screening of a combinatory antibody library that has been prepared using bio-display. For example, Marks et al., BioTechnology, 10: 779-783 (1992) describes affinity' maturation by VH and VL domain shuffling. Random mutagenesis of CDR and/or framework residues is described by Barbas et al., Proc. Nat.
- Antibody and “antibodies” as used herein refers to monoclonal antibodies, monospecific antibodies (e.g., which can either be monoclonal, or may also be produced by other means than producing them from a common germ cell), multispecific antibodies, human antibodies, humanized antibodies (fully or partially humanized), animal antibodies such as, but not limited to, a bird (for example, a duck or a goose), a shark, a whale, and a mammal, including a non-primate (for example, a cow, a pig, a camel, a llama, a horse, a goat, a rabbit, a sheep, a hamster, a guinea pig, a cat, a dog, a rat, a mouse, etc.) or a non- human primate (for example, a monkey, a chimpanzee, etc.), recombinant antibodies, chimeric antibodies, single-chain Fvs (“scFv”),
- antibodies include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, namely, molecules that contain an analyte-binding site.
- Immunoglobulin molecules can be of any type (for example, IgG, IgE, IgM, IgD, IgA, and IgY), class (for example, IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2), or subclass.
- an antibody against an analyte is frequently referred to herein as being either an “anti-analyte antibody” or merely an “analyte antibody” (e.g., an anti-GFAP antibody, a GFAP antibody, an anti-UCH-Ll antibody, or a UCH-L1 antibody).
- Antibody fragment refers to a portion of an intact antibody comprising the antigen-binding site or variable region. The portion does not include the constant heavy chain domains (i.e., CH2, CH3, or CH4, depending on the antibody isotype) of the Fc region of the intact antibody. Examples of antibody fragments include, but are not limited to, Fab fragments.
- Fab' fragments Fab'-SH fragments, F(ab') 2 fragments, Fd fragments, Fv fragments, diabodies, single-chain Fv (scFv) molecules, single-chain polypeptides containing only one light chain variable domain, single-chain polypeptides containing the three CDRs of the light-chain variable domain, single-chain polypeptides containing only one heavy chain variable region, and single-chain polypeptides containing the three CDRs of the heavy chain variable region.
- AUC area under curve
- AUC under a ROC curve is a measure of accuracy.
- An AUC of 1 represents a perfect test, whereas an AUC of 0.5 represents an insignificant test.
- a preferred AUC may be at least approximately 0.700, at least approximately 0.750, at least approximately 0.800, at least approximately 0.850, at least approximately 0.900, at least approximately 0.910, at least approximately 0.920, at least approximately 0.930, at least approximately 0.940, at least approximately 0.950, at least approximately 0.960, at least approximately 0.970, at least approximately 0.980, at least approximately 0.990, or at least approximately 0.995.
- Bead and “particle” are used herein interchangeably and refer to a substantially spherical solid support.
- a bead or particle is a microparticle.
- Microparticles that can be used herein can be any type known in the art.
- the bead or particle can be a magnetic bead or magnetic particle.
- Magnetic beads/particles may be ferromagnetic, ferrimagnetic, paramagnetic, superparamagnetic or ferrofluidic.
- Exemplary ferromagnetic materials include Fe, Co, Ni, Gd, Dy, CrO 2 , MnAs, MnBi, EuO, and NiO/Fe.
- ferrimagnetic materials include NiFe 2 O 4 , CoFe 2 O 4 , Fe 3 O 4 (or FeO Fe 2 O 3 ).
- Beads can have a solid core portion that is magnetic and is surrounded by one or more non-magnetic layers. Alternately, the magnetic portion can be a layer around a non-magnetic core.
- the microparticles can be of any size that would work in the methods described herein, e.g., from about 0.75 to about 5 nm, or from about 1 to about 5 nm, or from about 1 to about 3 run.
- Binding protein is used herein to refer to a monomeric or multimeric protein that binds to and forms a complex with a binding partner, such as, for example, a polypeptide, an antigen, a chemical compound or other molecule, or a substrate of any kind.
- a binding protein specifically binds a binding partner.
- Binding proteins include antibodies, as w r ell as antigen-binding fragments thereof and other various forms and derivatives thereof as are known in the art and described herein below, and other molecules comprising one or more antigen-binding domains that bind to an antigen molecule or a particular site (epitope) on the antigen molecule.
- a binding protein includes, but is not limited to, an antibody a tetrameric immunoglobulin, an IgG molecule, an IgGl molecule, a monoclonal antibody, a chimeric antibody, a CDR-grafted antibody, a humanized antibody, an affinity matured antibody, and fragments of any such antibodies that retain the ability to bind to an antigen.
- Bispecific antibody is used herein to refer to a full-length antibody that is generated by quadroma technology (see Milstein etal., Nature, 305(5934): 537-540 (1983)), by chemical conjugation of two different monoclonal antibodies (see, Staerz et al., Nature, 314(6012): 628-631 (1985)), or by knob-into-hole or similar approaches, which introduce mutations in the Fc region (see Holliger et al., Proc. Natl. Acad. Sci. USA, 90(14): 6444-6448 (1993)), resulting in multiple different immunoglobulin species of which only one is the functional bispecific antibody.
- a bispecific antibody binds one antigen (or epitope) on one of its two binding arms (one pair of HC/LC), and binds a different antigen (or epitope) on its second arm (a different pair of HC/LC).
- a bispecific antibody has two distinct antigen-binding arms (in both specificity and CDR sequences), and is monovalent for each antigen to which it binds to.
- CDR is used herein to refer to the “complementarity determining region” within an antibody variable sequence. There are three CDRs in each of the variable regions of the heavy chain and the light chain. Proceeding from the N-terminus of a heavy or light chain, these regions are denoted “CDR1", “CDR2", and “CDR3”, for each of the variable regions.
- CDR set refers to a group of three CDRs that occur in a single variable region that binds the antigen. An antigen-binding site, therefore, may include six CDRs, comprising the CDR set from each of a heavy and a light chain variable region.
- a polypeptide comprising a single CDR may be referred to as a “molecular recognition unit.” Crystallographic analyses of antigen-antibody complexes have demonstrated that the amino acid residues of CDRs form extensive contact with bound antigen, wherein the most extensive antigen contact is with the heavy chain CDR3. Thus, the molecular recognition units may be primarily responsible for the specificity of an antigen- binding site. In general, the CDR residues are directly and most substantially involved in influencing antigen binding.
- Component refer generally to a capture antibody, a detection or conjugate a calibrator, a control, a sensitivity panel, a container, a buffer, a diluent, a salt, an enzyme, a co-factor for an enzyme, a detection reagent, a pretreatment reagent/solution, a substrate (e.g., as a solution), a stop solution, and the like that can be included in a kit for assay of a test sample, such as a patient urine, whole blood, serum or plasma sample, in accordance with the methods described herein and other methods known in the art. Some components can be in solution or lyophilized for reconstitution for use in an assay.
- Controls as used herein generally refers to a reagent whose purpose is to evaluate the performance of a measurement system in order to assure that it continues to produce results within permissible boundaries (e.g., boundaries ranging from measures appropriate for a research use assay on one end to analytic boundaries established by quality specifications for a commercial assay on the other end). To accomplish this, a control should be indicative of patient results and optionally should somehow assess the impact of error on the measurement (e.g., error due to reagent stability, calibrator variability, instrument variability, and the like).
- a “control subject” relates to a subject or subjects that have not sustained a traumatic brain injury (TBI).
- TBI traumatic brain injury
- a “heathy control” or “healthy control subject” relates to a subject or subjects that are considered to be healthy and have sustained no apparent TBI.
- CT scan refers to a computerized tomography (CT) scan.
- a CT scan combines a series of X-ray images taken from different angles and uses computer processing to create cross-sectional images, or slices, of the bones, blood vessels and soft tissues inside your body.
- the CT scan may use X-ray CT, positron emission tomography (PET), single-photon emission computed tomography (SPECT), computed axial tomography (CAT scan), or computer aided tomography.
- PET positron emission tomography
- SPECT single-photon emission computed tomography
- CAT scan computed axial tomography
- the CT scan may be a conventional CT scan or a spiral/helical CT scan.
- a conventional CT scan the scan is taken slice by slice and after each slice the scan stops and moves down to the next slice, e.g., from the top of the abdomen down to the pelvis.
- the conventional CT scan requires patients to hold their breath to avoid movement artefact.
- the spiral/helical CT scan is a continuous scan which is taken in a spiral fashion and is a much quicker process where the scanned images are contiguous.
- “Derivative” of an antibody as used herein may refer to an antibody having one or more modifications to its amino acid sequence when compared to a genuine or parent antibody and exhibit a modified domain structure.
- the derivative may still be able to adopt the typical domain configuration found in native antibodies, as well as an amino acid sequence, which is able to bind to targets (antigens) with specificity.
- Typical examples of antibody derivatives are antibodies coupled to other polypeptides, rearranged antibody domains, or fragments of antibodies.
- the derivative may also comprise at least one further compound, e.g., a protein domain, said protein domain being linked by covalent or non- covalent bonds. The linkage can be based on genetic fusion according to the methods known in the art.
- the additional domain present in the fusion protein comprising the antibody may preferably be linked by a flexible linker, advantageously a peptide linker, wherein said peptide linker comprises plural, hydrophilic, peptide-bonded amino acids of a length sufficient to span the distance between the C-terminal end of the further protein domain and the N-terminal end of the antibody or vice versa.
- the antibody may be linked to an effector molecule having a conformation suitable for biological activity or selective binding to a solid support, a biologically active substance (e.g., a cytokine or growth hormone), a chemical agent, a peptide, a protein, or a drug, for example.
- “Determined by an assay” is used herein to refer to the determination of a reference level by any appropriate assay.
- the determination of a reference level may, in some embodiments, be achieved by an assay of the same type as the assay that is to be applied to the sample from the subject (for example, by an immunoassay, clinical chemistry assay, a single molecule detection assay, protein immunoprecipitation, immunoelectrophoresis, chemical analysis, SDS-PAGE and Western blot analysis, or protein immunostaining, electrophoresis analysis, a protein assay, a competitive binding assay, a functional protein assay, or chromatography or spectrometry methods, such as high-performance liquid chromatography (HPLC) or liquid chromatography-mass spectrometry (LC/MS)).
- HPLC high-performance liquid chromatography
- LC/MS liquid chromatography-mass spectrometry
- the determination of a reference level may, in some embodiments, be achieved by an assay of the same type and under the same assay conditions as the assay that is to be applied to the sample from the subject.
- this disclosure provides exemplary reference levels (e.g., calculated by comparing reference levels at different time points). It is well within the ordinary skill of one in the art to adapt the disclosure herein for other assays to obtain assay- specific reference levels for those other assays based on the description provided by this disclosure.
- a set of training samples comprising samples obtained from subjects known to have sustained an injury to the head (e.g., samples obtained from human subjects) known to have sustained a (i) mild TBI; and/or (ii) moderate, severe, or moderate to severe TBI and samples obtained from subjects (e.g., human subjects) known not to have sustained an injury to the head may be used to obtain assay-specific reference levels.
- a reference level “determined by an assay” and having a recited level of “sensitivity” and/or “specificity” is used herein to refer to a reference level which has been determined to provide a method of the recited sensitivity and/or specificity when said reference level is adopted in the methods of the disclosure. It is well within the ordinary skill of one in the art to determine the sensitivity' and specificity associated with a given reference level in the methods of the disclosure, for example by repeated statistical analysis of assay data using a plurality of different possible reference levels.
- a high sensitivity value helps one of skill rule out disease or condition (such as a traumatic brain injury, mild traumatic brain injury, moderate traumatic brain injury, severe traumatic brain injury- or moderate to severe traumatic brain injury), and a high specificity- value helps one of skill rule in disease or condition.
- skill rule out disease or condition such as a traumatic brain injury, mild traumatic brain injury, moderate traumatic brain injury, severe traumatic brain injury- or moderate to severe traumatic brain injury
- a high specificity- value helps one of skill rule in disease or condition.
- Whether one of skill desires to mle out or rule in disease depends on what the consequences are for the patient for each type of error. Accordingly, one cannot know or predict the precise balancing employed to derive a test cutoff without full disclosure of the underlying information on how the value was selected. The balancing of sensitivity against specificity and other factors will differ on a case-by-case basis. This is why it is sometimes preferable to provide alternate cutoff (e.g., reference) values so a physician or practitioner
- “Drugs of abuse” is used herein to refer to one or more additive substances (such as a drug) taken for non-medical reasons (such as for, example, recreational and/or mind- altering effects). Excessive overindulgence, use or dependence of such drugs of abuse is often referred to as “substance abuse”.
- drugs of abuse examples include alcohol, barbiturates, benzodiazepines, cannabis, cocaine, hallucinogens (such as ketamine, mescaline (peyote), PCP, psilocybin, DMT and/or LSD), methaqualone, opioids, amphetamines (including methamphetamines), anabolic steroids, inhalants (namely, substances which contain volatile substances that contain psychoactive properties such as, for example, nitrites, spray paints, cleaning fluids, markers, glues, etc.) and combinations thereof.
- hallucinogens such as ketamine, mescaline (peyote), PCP, psilocybin, DMT and/or LSD
- methaqualone opioids
- amphetamines including methamphetamines
- anabolic steroids inhalants
- “Dual-specific antibody” is used herein to refer to a full-length antibody that can bind two different antigens (or epitopes) in each of its two binding arms (a pair of HC/LC) (see PCT publication WO 02/02773). Accordingly, a dual-specific binding protein has two identical antigen binding arms, with identical specificity and identical CDR sequences, and is bivalent for each antigen to which it binds.
- “Dual variable domain” is used herein to refer to two or more antigen binding sites on a binding protein, which may be divalent (two antigen binding sites), tetravalent (four antigen binding sites), or multivalent binding proteins.
- DVDs may be monospecific, i.e., capable of binding one antigen (or one specific epitope), or multispecific, i.e., capable of binding two or more antigens (i.e., two or more epitopes of the same target antigen molecule or two or more epitopes of different target antigens).
- a preferred DVD binding protein comprises two heavy chain DVD polypeptides and two fight chain DVD polypeptides and is referred to as a “DVD immunoglobulin” or “DVD-Ig.” Such a DVD-Ig binding protein is thus tetrameric and reminiscent of an IgG molecule, but provides more antigen binding sites than an IgG molecule.
- each half of a tetrameric DVD-Ig molecule is reminiscent of one half of an IgG molecule and comprises a heavy chain DVD polypeptide and a fight chain DVD polypeptide, but unlike a pair of heavy and light chains of an IgG molecule that provides a single antigen binding domain, a pair of heavy and fight chains of a DVD-Ig provide two or more antigen binding sites.
- Each antigen binding site of a DVD-Ig binding protein may be derived from a donor ("parental") monoclonal antibody and thus comprises a heavy chain variable domain (VH) and a fight chain variable domain (VL) with a total of six CDRs involved in antigen binding per antigen binding site.
- a DVD-Ig binding protein that binds two different epitopes comprises an antigen binding site derived from a first parental monoclonal antibody and an antigen binding site of a second parental monoclonal antibody.
- a preferred example of such DVD-Ig molecules comprises a heavy chain that comprises the structural formula VDl-(Xl)n-VD2-C- (X2)n, wherein VD1 is a first heavy chain variable domain, VD2 is a second heavy chain variable domain, C is a heavy chain constant domain, XI is a linker with the proviso that it is not CHI , X2 is an Fc region, and n is 0 or 1, but preferably 1 ; and a light chain that comprises the structural formula VDl-(Xl)n-VD2-C-(X2)n, wherein VD1 is a first light chain variable domain, VD2 is a second fight chain variable domain, C is a fight chain constant domain, XI is a linker with the proviso that it is not CHI, and X2 does not comprise an Fc region; and n is 0 or 1, but preferably 1.
- Such a DVD-Ig may comprise two such heavy chains and two such fight chains, wherein each chain comprises variable domains linked in tandem without an intervening constant region between variable regions, wherein a heavy chain and a light chain associate to form tandem functional antigen binding sites, and a pair of heavy and light chains may associate with another pair of heavy and light chains to form a tetrameric binding protein with four functional antigen binding sites.
- a DVD-Ig molecule may comprise heavy and light chains that each comprise three variable domains (VD1, VD2, VD3) linked in tandem without an intervening constant region between variable domains, wherein a pair of heavy and light chains may associate to form three antigen binding sites, and wherein a pair of heavy and light chains may associate with another pair of heavy and light chains to form a tetrameric binding protein with six antigen binding sites.
- VD1, VD2, VD3 variable domains linked in tandem without an intervening constant region between variable domains
- a DVD-Ig binding protein not only binds the same target molecules bound by its parental monoclonal antibodies, but also possesses one or more desirable properties of one or more of its parental monoclonal antibodies.
- an additional property is an antibody parameter of one or more of the parental monoclonal antibodies.
- Antibody parameters that may be contributed to a DVD-Ig binding protein from one or more of its parental monoclonal antibodies include, but are not limited to, antigen specificity, antigen affinity, potency, biological function, epitope recognition, protein stability, protein solubility, production efficiency, immunogenicity, pharmacokinetics, bioavailability, tissue cross reactivity, and orthologous antigen binding.
- a DVD-Ig binding protein binds at least one epitope of UCH-L1, GFAP, or UCH- L1 and GFAP.
- Non-limiting examples of a DVD-Ig binding protein include (1) a DVD-Ig binding protein that binds one or more epitopes of UCH-L1, a DVD-Ig binding protein that binds an epitope of a human UCH-L1 and an epitope of UCH-L1 of another species (for example, mouse), and a DVD-Ig binding protein that binds an epitope of a human UCH-L1 and an epitope of another target molecule; (2) a DVD-lg binding protein that binds one or more epitopes of GFAP, a DVD-Ig binding protein that binds an epitope of a human GFAP and an epitope of GFAP of another species (for example, mouse), and a DVD-Ig binding protein that binds an epitope of a human GFAP and an
- “Dynamic range” as used herein refers to range over which an assay readout is proportional to the amount of target molecule or analyte in the sample being analyzed.
- “Epitope,” or “epitopes,” or “epitopes of interest” refer to a site(s) on any molecule that is recognized and can bind to a complementary site(s) on its specific binding partner. The molecule and specific binding partner are part of a specific binding pair.
- an epitope can be on a polypeptide, a protein, a hapten, a carbohydrate antigen (such as, but not limited to, glycolipids, glycoproteins or lipopolysaccharides), or a polysaccharide.
- a carbohydrate antigen such as, but not limited to, glycolipids, glycoproteins or lipopolysaccharides
- Its specific binding partner can be, but is not limited to, an antibody.
- “Fragment antigen-binding fragment” or ‘Tab fragment” as used herein refers to a fragment of an antibody that binds to antigens and that contains one antigen-binding site, one complete light chain, and part of one heavy chain.
- Fab is a monovalent fragment consisting of the VL, VH, CL and CHI domains.
- Fab is composed of one constant and one variable domain of each of the heavy and the light chain.
- the variable domain contains the paratope (the antigen-binding site), comprising a set of complementarity determining regions, at the amino terminal end of the monomer. Each arm of the Y thus binds an epitope on the antigen.
- Fab fragments can be generated such as has been described in the art, e.g., using the enzyme papain, which can be used to cleave an immunoglobulin monomer into two Fab fragments and an Fc fragment, or can be produced by recombinant means.
- F(ab') 2 fragment refers to antibodies generated by pepsin digestion of whole IgG antibodies to remove most of the Fc region while leaving intact some of the hinge region.
- F(ab') 2 fragments have two antigen-binding F(ab) portions linked together by disulfide bonds, and therefore are divalent with a molecular weight of about 110 kDa.
- Divalent antibody fragments are smaller than whole IgG molecules and enable a better penetration into tissue thus facilitating better antigen recognition in immunohistochemistry.
- the use of F(ab') 2 fragments also avoid unspecific binding to Fc receptor on live cells or to Protein A/G.
- F(ab') 2 fragments can both bind and precipitate antigens.
- Tramework (FR) or “Framework sequence” as used herein may mean the remaining sequences of a variable region minus the CDRs. Because the exact definition of a CDR sequence can be determined by different systems (for example, see above), the meaning of a framework sequence is subject to correspondingly different interpretations.
- the six CDRs also divide the framework regions on the light chain and the heavy chain into four sub-regions (FR1, FR2, FR3, and FR4) on each chain, in which CDR1 is positioned between FR1 and FR2, CDR2 between FR2 and FR3, and CDR3 between FR3 and FR4.
- a framework region represents foe combined FRs within foe variable region of a single, naturally occurring immunoglobulin chain.
- a FR represents one of foe four sub- regions
- FRs represents two or more of foe four sub-regions constituting a framework region.
- Human heavy chain and light chain FR sequences are known in foe art that can be used as heavy chain and light chain "acceptor” framework sequences (or simply, "acceptor” sequences) to humanize a non-human antibody using techniques known in foe art.
- human heavy chain and light chain acceptor sequences are selected from foe framework sequences listed in publicly available databases such as V-base (hypertext transfer protocol://vbase .mrc-cpe.cam.ac.uk/) or in foe international ImMunoGeneTics® (IMGT®) information system (hypertext transfer protocol://imgt.cines.fr/texts/IMGTrepertoire/LocusGenes/).
- “Functional antigen binding site” as used herein may mean a site on a binding protein (e.g., an antibody) that is capable of binding a target antigen.
- the antigen binding affinity of foe antigen binding site may not be as strong as foe parent binding protein, e.g., parent antibody, from which foe antigen binding site is derived, but foe ability to bind antigen must be measurable using any one of a variety of methods known for evaluating protein, e.g., antibody, binding to an antigen.
- foe antigen binding affinity of each of foe antigen binding sites of a multivalent protein, e.g., multivalent antibody, herein need not be quantitatively foe same.
- GFAP is used herein to describe glial fibrillary' acidic protein.
- GFAP is a protein that is encoded by foe GFAP gene in humans and by GFAP gene counterparts in other species and which can be produced (e.g., by recombinant means, in other species).
- GFAP status can mean either the level or amount of GFAP at a point in time (such as with a single measure of GFAP), foe level or amount of GFAP associated with monitoring (such as with a repeat test on a subject to identity an increase or decrease in GFAP amount), foe level or amount of GFAP associated with treatment for traumatic brain injury (whether a primary' brain injury and/or a secondary- brain injury) or combinations thereof.
- Glasgow Coma Scale or “GCS” as used herein refers to a 15-point scale for estimating and categorizing the outcomes of brain injury on the basis of overall social capability' or dependence on others. The test measures the motor response, verbal response and eye opening response with these values: I. Motor Response (6 - Obeys commands folly;
- the final score is determined by adding the values of I+II+IU.
- the final score can be categorized into four possible levels for survival, with a lower number indicating a more severe injury and a poorer prognosis: Mild (13-15); Moderate Disability (9-12) (Loss of consciousness greater than 30 minutes; Physical or cognitive impairments which may or may resolve: and Benefit from Rehabilitation); Severe Disability (3-8) (Coma: unconscious state. No meaningful response, no voluntary activities); and Vegetative State (Less Than 3) (Sleep wake cycles; Arousal, but no interaction with environment; No localized response to pain).
- Moderate brain injury is defined as a brain injury resulting in a loss of consciousness from 20 minutes to 6 hours and a Glasgow Coma Scale of 9 to 12.
- Severe brain injury is defined as a brain injury resulting in a loss of consciousness of greater than 6 hours and a Glasgow Coma Scale of 3 to 8.
- “Glasgow Outcome Scale” refers to a global scale for functional outcome that rates patient status into one of five categories: Dead, Vegetative State, Severe Disability, Moderate Disability' or Good Recovery.
- “Extended Glasgow Outcome Scale” or “GOSE” as used interchangeably herein provides more detailed categorization into eight categories by subdividing the categories of severe disability, moderate disability and good recovery into a lower and upper category as shown in Table 1.
- Humanized antibody is used herein to describe an antibody that comprises heavy and light chain variable region sequences from a non-human species (e.g., a mouse) but in which at least a portion of the VH and/or VL sequence has been altered to be more “human- like,” i.e., more similar to human germline variable sequences.
- a “humanized antibody” is an antibody or a variant, derivative, analog, or fragment thereof, which immunospecifically binds to an antigen of interest and which comprises a framework (FR) region having substantially the amino acid sequence of a human antibody and a complementary determining region (CDR) having substantially the amino acid sequence of a non-human antibod)'.
- FR framework
- CDR complementary determining region
- the term "substantially" in the context of a CDR refers to a CDR having an amino acid sequence at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99% identical to the amino acid sequence of a non-human antibod)' CDR
- a humanized antibody comprises substantially all of at least one, and typically two, variable domains (Fab, Fab*, F(ab') 2 , FabC, Fv) in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin (i.e., donor antibody) and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence.
- a humanized antibody also comprises at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- a humanized antibody contains the light chain as well as at least the variable domain of a heavy chain.
- the antibody also may include the CHI, hinge, CH2, CH3, and CH4 regions of the heavy chain.
- a humanized antibody only contains a humanized light chain.
- a humanized antibody only contains a humanized heavy chain.
- a humanized antibody only contains a humanized variable domain of a light chain and/or humanized heavy chain.
- a humanized antibody can be selected from any class of immunoglobulins, including IgM, IgG, IgD, IgA, and IgE, and any isotype, including without limitation IgGl, IgG2, IgG3, and IgG4.
- a humanized antibody may comprise sequences from more than one class or isotype, and particular constant domains may be selected to optimize desired effector functions using techniques well-known in the art.
- the framework regions and CDRs of a humanized antibody need not correspond precisely to the parental sequences, e.g., the donor antibody CDR or the consensus framework may be mutagenized by substitution, insertion, and/or deletion of at least one amino acid residue so that the CDR or framework residue at that site does not correspond to either the donor antibody or the consensus framework. In a preferred embodiment, such mutations, however, will not be extensive. Usually, at least 80%, preferably at least 85%, more preferably at least 90%, and most preferably at least 95% of the humanized antibody residues will correspond to those of the parental FR and CDR sequences.
- the term "consensus framework" refers to the framework region in the consensus immunoglobulin sequence.
- the term "consensus immunoglobulin sequence” refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related immunoglobulin sequences (see, e.g., Winnaker, From Genes to Clones (Veriagsgesellschaft, Weinheim, 1987)).
- a "consensus immunoglobulin sequence” may thus comprise a "consensus framework region(s)” and/or a "consensus CDR(s)".
- each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
- ‘Identical” or “identity,” as used herein in the context of two or more polypeptide or polynucleotide sequences, can mean that the sequences have a specified percentage of residues that are the same over a specified region. The percentage can be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity. In cases where the two sequences are of different lengths or the alignment produces one or more staggered ends and the specified region of comparison includes only a single sequence, the residues of the single sequence are included in the denominator but not the numerator of the calculation.
- Imaging procedure refers to a medical test that allows the inside of a body to be seen in order to diagnose, treat, and monitor health conditions.
- An imaging procedure can be a non-invasive procedure that allows diagnosis of diseases and injuries without being intrusive. Examples of imaging procedures include MRI, CT scan, X-rays, positron emission tomography (PET) scan, single-photon emission computed tomography (SPECT), and diffusion tensor imaging (DTI) scan.
- Traumy to the head or “head injury” as used interchangeably herein, refers to any trauma to the scalp, skull, or brain. Such injuries may include only a minor bump on the head or may be a serious brain injury.
- Such injuries include primary injuries to the brain and/or secondary- injuries to the brain.
- Primary brain injuries occur dining the initial insult and result from displacement of the physical structures of the brain. More specifically, a primary brain injury is the physical damage to parenchyma (tissue, vessels) that occurs during the traumatic event, resulting in shearing and compression of the surrounding brain tissue.
- Secondary brain injuries occur subsequent to the primary- injury- and may involve an array of cellular processes. More specifically, a secondary brain injury refers to the changes that evolve over a period of time (from hours to days) after the primary brain injury. It includes an entire cascade of cellular, chemical, tissue, or blood vessel changes in the brain that contribute to further destruction of brain tissue.
- An injury to the head can be either closed or open (penetrating).
- a closed head injury refers to a trauma to the scalp, skull or brain where there is no penetration of the skull by a striking object.
- An open head injury refers a trauma to the scalp, skull or brain where there is penetration of the skull by a striking object.
- An injury to the head may be caused by physical shaking of a person, by blunt impact by an external mechanical or other force that results in a closed or open head trauma (e.g., vehicle accident such as with an automobile, plane, train, etc.; blow to the head such as with a baseball bat, or from a firearm), a cerebral vascular accident (e.g., stroke), one or more falls (e.g., as in sports or other activities), explosions or blasts (collectively, “blast injuries”) and by other types of blunt force trauma.
- a closed or open head trauma e.g., vehicle accident such as with an automobile, plane, train, etc.; blow to the head such as with a baseball bat, or from a firearm
- a cerebral vascular accident e.g., stroke
- one or more falls e.g., as in sports or other activities
- explosions or blasts collectively, “blast injuries”
- an injury to the head may be caused by the ingestion and/or exposure to a chemical, toxin or a combination of
- Examples of such chemicals and/or toxins include fires, molds, asbestos, pesticides and insecticides, organic solvents, paints, glues, gases (such as carbon monoxide, hydrogen sulfide, and cyanide), organic metals (such as methyl mercury, tetraethyl lead and organic tin) and/or one or more drugs of abuse.
- an injury to the head may be caused as a result of a subject suffering from an autoimmune disease, a metabolic disorder, a brain tumor, one or more viruses (e.g., SARS-CoV-2), meningitis, hydrocephalus, hypoxia or any combinations thereof. In some cases, it is not possible to be certain whether any such event or injury has occurred or taken place.
- the closed head injury does not include and specifically excludes a cerebral vascular accident, such as stroke.
- isolated polynucleotide as used herein may mean a polynucleotide (e.g., of genomic, cDNA, or synthetic origin, or a combination thereof) that, by virtue of its origin, the isolated polynucleotide is not associated with all or a portion of a polynucleotide with which the “isolated polynucleotide” is found in nature; is operably linked to a polynucleotide that it is not linked to in nature; or does not occur in nature as part of a larger sequence.
- a polynucleotide e.g., of genomic, cDNA, or synthetic origin, or a combination thereof
- Label and “detectable label” as used herein refer to a moiety attached to an antibody or an analyte to render the reaction between the antibody and the analyte detectable, and the antibody or analyte so labeled is referred to as “detectably labeled.”
- a label can produce a signal that is detectable by visual or instrumental means.
- Various labels include signal-producing substances, such as chromagens, fluorescent compounds, chemiluminescent compounds, radioactive compounds, and the like.
- Representative examples of labels include moieties that produce light, e.g., acridinium compounds, and moieties that produce fluorescence, e.g., fluorescein. Other labels are described herein.
- the moiety itself, may not be detectable but may become detectable upon reaction with yet another moiety'. Use of the term “detectably labeled” is intended to encompass such labeling.
- the detectable label can be a radioactive label (such as 3H, 14C, 32P, 33P, 35S, 90Y, 99Tc, 1111n 1251, 1311, 177Lu, 166Ho, and 153Sm), an enzymatic label (such as horseradish peroxidase, alkaline peroxidase, glucose 6-phosphate dehydrogenase, and the like), a chemiluminescent label (such as acridinium esters, thioesters, or sulfonamides; luminol, isoluminol, phenanthridinium esters, and the like), a fluorescent label (such as fluorescein (e.g., 5-fluorescein, 6-carboxyfluorescein, 3’6-carboxyfhiorescein, 5(6)-carboxyfluorescein, 6-hexachloro-fluorescein, 6-
- a radioactive label such as 3H, 14C, 32P, 33P,
- An acridinium compound can be used as a detectable label in a homogeneous chemiluminescent assay (see, e.g., Adamczyk et al., Bioorg. Med. Chem. Lett. 16: 1324-1328 (2006); Adamczyk et al., Bioorg. Med. Chem. Lett. 4: 2313-2317 (2004); Adamczyk et al., Biorg. Med. Chem. Lett. 14: 3917-3921 (2004); and Adamczyk et al., Org. Lett. 5: 3779-3782 (2003)).
- the acridinium compound is an acridinium-9-carboxamide.
- Methods for preparing acridinium 9-carboxamides are described in Mattingly, J. Biolumin.
- an acridinium compound is an acridinium-9-carboxylate aryl ester.
- An example of an acridinium-9-carboxylate aryl ester of formula II is 10-methyl-9- (phenoxycarbonyl)acridinium fluorosulfonate (available from Cayman Chemical, Ann Arbor, MI).
- Methods for preparing acridinium 9-carboxylate aryl esters are described in McCapra et al., Photochem. Photobiol. 4: 1111-21 (1965); Razavi etal., Luminescence 15: 245-249 (2000); Razavi et al., Luminescence 15: 239-244 (2000); and U.S. Patent No.
- acridinium-9-carboxylate aryl esters are efficient chemiluminescent indicators for hydrogen peroxide produced in the oxidation of an analyte by at least one oxidase in terms of the intensity of the signal and/or the rapidity of the signal.
- the course of the chemiluminescent emission for the acridinium-9-carboxylate aryl ester is completed rapidly, i.e., in under 1 second, while the acridinium-9-carboxamide chemiluminescent emission extends over 2 seconds.
- Acridinium-9-carboxylate aryl ester loses its chemiluminescent properties in the presence of protein. Therefore, its use requires the absence of protein during signal generation and detection.
- Methods for separating or removing proteins in the sample include, but are not limited to, ultrafiltration, extraction, precipitation, dialysis, chromatography, and/or digestion (see, e.g.. Wells, High Throughput Bioanalytical Sample Preparation. Methods and Automation Strategies, Elsevier (2003)).
- the amount of protein removed or separated from the test sample can be about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95%.
- Acridinium-9-carboxylate aryl ester and its use are set forth in U.S. Patent App. No. 11/697,835, filed April 9, 2007.
- Acridinium-9-carboxylate aryl esters can be dissolved in any suitable solvent, such as degassed anhydrous N,N-dimethylformamide (DMF) or aqueous sodium cholate.
- Linking sequence refers to a natural or artificial polypeptide sequence that is connected to one or more polypeptide sequences of interest (e.g., foil-length, fragments, etc.).
- the term “connected” refers to the joining of the linking sequence to the polypeptide sequence of interest.
- Such polypeptide sequences are preferably joined by one or more peptide bonds.
- Linking sequences can have a length of from about 4 to about 50 amino acids. Preferably, the length of the linking sequence is from about 6 to about 30 amino acids.
- Natural linking sequences can be modified by amino acid substitutions, additions, or deletions to create artificial linking sequences. Linking sequences can be used for many purposes, including in recombinant Fabs.
- Exemplary linking sequences include, but are not limited to: (i) Histidine (His) tags, such as a 6X His tag, which has an amino acid sequence of HHHHHH (SEQ ID NO: 3), are usefol as linking sequences to facilitate the isolation and purification of polypeptides and antibodies of interest; (ii) Enterokinase cleavage sites, like His tags, are used in the isolation and purification of proteins and antibodies of interest. Often, enterokinase cleavage sites are used together with His tags in the isolation and purification of proteins and antibodies of interest. Various enterokinase cleavage sites are known in the art.
- enterokinase cleavage sites include, but are not limited to, the amino acid sequence of DDDDK (SEQ ID NO: 4) and derivatives thereof (e.g., ADDDDK (SEQ ID NO: 5), etc.); (iii) Miscellaneous sequences can be used to link or connect the light and/or heavy chain variable regions of single chain variable region fragments. Examples of other linking sequences can be found in Bird et al., Science 242: 423-426 (1988); Huston et al., PNAS USA 85: 5879-5883 (1988); and McCafferty et al., Nature 348: 552-554 (1990).
- Linking sequences also can be modified for additional functions, such as attachment of drugs or attachment to solid supports.
- the monoclonal antibody for example, can contain a linking sequence, such as a His tag, an enterokinase cleavage site, or both.
- “Monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigen (e.g., although cross-reactivity or shared reactivity may occur). Furthermore, in contrast to polyclonal antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
- the monoclonal antibodies herein specifically include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological.
- Magnetic resonance imaging refers to a medical imaging technique used in radiology to form pictures of the anatomy and the physiological processes of the body in both health and disease (e.g., referred to herein interchangeably as “an MRI”, “an MRI procedure” or “an MRI scan”).
- MRI is a form of medical imaging that measures the response of the atomic nuclei of body tissues to high- frequency radio waves when placed in a strong magnetic field, and that produces images of the internal organs.
- MRI scanners which is based on the science of nuclear magnetic resonance (NMR), use strong magnetic fields, radio waves, and field gradients to generate images of the inside of the body.
- NMR nuclear magnetic resonance
- Multivalent binding protein is used herein to refer to a binding protein comprising two or more antigen binding sites (also referred to herein as "antigen binding domains").
- a multivalent binding protein is preferably engineered to have three or more antigen binding sites, and is generally not a naturally occurring antibody.
- multispecific binding protein refers to a binding protein that can bind two or more related or unrelated targets, including a binding protein capable of binding two or more different epitopes of the same target molecule.
- “Negative predictive value” or “NPV” as used interchangeably herein refers to the probability that a subject has a negative outcome given that they have a negative test result.
- the phrase “odds ratio” refers to a number or value that is used to compare the relative odds of the occurrence of an outcome of interest (e.g., disease, disorder or injury (e.g., such as a traumatic brain injury)), given exposure to a variable of interest (e.g., health characteristic, event (such as, for example sustaining an injury or aspect of medical history.
- An odds ratio can also be used to determine whether a particular exposure is a risk factor for a particular outcome, and to compare the magnitude of various risk factors for that outcome.
- “Pediatric subject” refers to a subject less than 18 years of age (i.e., not 18 years of age or older).
- a pediatric subject may be less than about 18 years old, or about 17 years old, about 16 years old, about 15 years old, about 14 years old, about 13 years old, about 12 years old, about 11 years old, about 10 years old, about 9 years old, about 8 years old, about 7 years old, about 6 years old, about 5 years old, about 4 years old, about 3 years old, about 2 years old, about 1 year old, or less than about 1 year old.
- the pediatric subject may be less than about 1 year old to about less than 18 years old.
- the pediatric subject may be less than about 1 year old to about 17 years old.
- a pediatric subject may be anywhere from about one day, about two days, about three days, about four days, about five days, about six days, about one week, about two weeks, about three weeks, about one month, about two months, about three months, about four months, about five months, about six months, about seven months, about eight months, about nine months, about ten months, or about eleven months, in total, less than: about 18 years old, or about 17 years old, or about 16 years old, or about 15 years old, or about 14 years old, or about 13 years old, or about 12 years old, or about 11 years old, or about 10 years old, or about 9 years old, or about 8 years old, or about 7 years old, or about 6 years old, or about 5 years old, or about 4 years old, or about 3 years old, or about 2 years old, or about 1 year old, or less than about 1 year old.
- Point-of-care device refers to a device used to provide medical diagnostic testing at or near the point-of-care (namely, outside of a laboratory), at the time and place of patient care (such as in a hospital, physician’s office, urgent or other medical care facility, a patient’s home, a nursing home and/or a long-term care and/or hospice facility).
- point-of-care devices include those produced by Abbott Laboratories (Abbott Park, IL) (e.g., i-STAT and i-STAT Alinity, Universal Biosensors (Rowville, Australia) (see U.S. Patent Publication No. 2006/0134713), Axis-Shield PoC AS (Oslo, Norway) and Clinical Lab Products (Los Angeles, USA).
- PSV Positive predictive value
- “Quality control reagents” in the context of immunoassays and kits described herein, include, but are not limited to, calibrators, controls, and sensitivity panels.
- a “calibrator” or “standard” typically is used (e.g., one or more, such as a plurality) in order to establish calibration (standard) curves for interpolation of the concentration of an analyte, such as an antibody or an analyte.
- a single calibrator which is near a reference level or control level (e.g., “low”, “medium”, or “high” levels), can be used.
- Multiple calibrators i.e., more than one calibrator or a varying amount of calibrators) can be used in conjunction to comprise a “sensitivity panel.”
- a “receiver operating characteristic” curve or “ROC” curve refers to a graphical plot that illustrates the performance of a binary classifier system as its discrimination threshold is varied.
- the ROC curve demonstrates the tradeoff between sensitivity and specificity (any increase in sensitivity will be accompanied by a decrease in specificity); the closer the curve follows the left-hand border and then the top border of the ROC space, the more accurate the test; the closer the curve comes to the 45-degree diagonal of the ROC space, the less accurate the test; the slope of the tangent line at a cutoff point gives the likelihood ratio (LR) for that value of the test; and the area under the curve is a measure of test accuracy.
- “Recombinant antibody” and “recombinant antibodies” refer to antibodies prepared by one or more steps, including cloning nucleic acid sequences encoding all or a part of one or more monoclonal antibodies into an appropriate expression vector by recombinant techniques and subsequently expressing the antibody in an appropriate host cell.
- the terms include, but are not limited to, recombinantly produced monoclonal antibodies, chimeric antibodies, humanized antibodies (fidly or partially humanized), multi-specific or multi- valent structures formed from antibody fragments, bifunctional antibodies, heteroconjugate Abs, DVD-Ig®s, and other antibodies as described in (i) herein.
- bifunctional antibody refers to an antibody that comprises a first arm having a specificity' for one antigenic site and a second arm having a specificity for a different antigenic site, i.e., the bifunctional antibodies have a dual specificity.
- Reference level refers to an assay cutoff value that is used to assess diagnostic, prognostic, or therapeutic efficacy and that has been linked or is associated herein with various clinical parameters (e.g., presence of disease, stage of disease, severity of disease, progression, non-progression, or improvement of disease, etc.).
- cutoff refers to a limit (e.g., such as a number) above which there is a certain or specific clinical outcome and below which there is a different certain or specific clinical outcome.
- reference levels may vary depending on the nature of the immunoassay (e.g., antibodies employed, reaction conditions, sample purity, etc.) and that assays can be compared and standardized. It further is well within the ordinary skill of one in the art to adapt the disclosure herein for other immunoassays to obtain immunoassay-specific reference levels for those other immunoassays based on the description provided by this disclosure. Whereas the precise value of the reference level may vary between assays, the findings as described herein should be generally applicable and capable of being extrapolated to other assays.
- the reference level is described as being determined by any assay having a certain specificity and sensitivity.
- “Risk assessment,” “risk classification,” “risk identification,” or ‘‘risk stratification” of subjects (e.g., patients) as used herein refers to the evaluation of factors including biomarkers, to predict the risk of occurrence of future events including disease onset or disease progression, so that treatment decisions regarding the subject may be made on a more informed basis.
- sample may be used interchangeable and may be a sample of blood, such as whole blood (including for example, capillary blood, venous blood, dried blood spot, etc.), tissue, urine, serum, plasma, amniotic fluid, lower respiratory specimens such as, but not limited to, sputum, endotracheal aspirate or bronchoalveolar lavage, nasal mucus, cerebrospinal fluid, placental cells or tissue, endothelial cells, leukocytes, or monocytes.
- blood such as whole blood (including for example, capillary blood, venous blood, dried blood spot, etc.), tissue, urine, serum, plasma, amniotic fluid, lower respiratory specimens such as, but not limited to, sputum, endotracheal aspirate or bronchoalveolar lavage, nasal mucus, cerebrospinal fluid, placental cells or tissue, endothelial cells, leukocytes, or monocytes.
- the sample can be used directly as obtained from a patient or can be pre-treated, such as by filtration, distillation, extraction, concentration, centrifugation, inactivation of interfering components, addition of reagents, and the like, to modify the character of the sample in some manner as discussed herein or otherwise as is known in the art.
- cell types, tissue, or bodily fluid may be utilized to obtain a sample.
- Such cell types, tissues, and fluid may include sections of tissues such as biopsy and autopsy samples, oropharyngeal specimens, nasopharyngeal specimens, nasal mucus specimens, frozen sections taken for histologic purposes, blood (such as whole blood, dried blood spots, etc.), plasma, serum, red blood cells, platelets, an anal sample (such as an anal swab specimen), interstitial fluid, cerebrospinal fluid, etc.
- Cell types and tissues may also include lymph fluid, cerebrospinal fluid, or any fluid collected by aspiration.
- a tissue or cell type may be provided by removing a sample of cells from a human and a non-human animal, but can also be accomplished by using previously isolated cells (e.g., isolated by another person, at another time, and/or for another purpose). Archival tissues, such as those having treatment or outcome history, may also be used. Protein or nucleotide isolation and/or purification may not be necessary.
- the sample is a whole blood sample.
- the sample is a capillary blood sample.
- the sample is a dried blood spot.
- the sample is a serum sample.
- the sample is a plasma sample.
- the sample is an oropharyngeal specimen.
- the sample is a nasopharyngeal specimen. In other embodiments, the sample is sputum. In other embodiments, the sample is endotracheal aspirate. In still yet other embodiments, the sample is bronchoalveolar lavage. In still yet other aspects, the sample is nasal mucus.
- “Sensitivity” refers to the proportion of subjects for whom the outcome is positive that are correctly identified as positive (e.g., correctly identifying those subjects with a disease or medical condition for which they are being tested). For example, this might include correctly identifying subjects as having a TBI from those who do not have a TBI, correctly identifying subjects having a moderate, severe, or moderate to severe TBI from those having a mild TBI, correctly identifying subjects as having a mild TBI from those having a moderate, severe, or moderate to severe TBI, correctly identifying subjects as having a moderate, severe, or moderate to severe TBI from those having no TBI or correctly identifying subjects as having a mild TBI from those having no TBI, etc.).
- Specificity of an assay as used herein refers to the proportion of subjects for whom the outcome is negative that are correctly identified as negative (e.g., correctly identifying those subjects who do not have a disease or medical condition for which they are being tested). For example, this might include correctly identifying subjects having an TBI from those who do not have a TBI, correctly identifying subjects not having a moderate, severe, or moderate to severe TBI from those having a mild TBI, correctly identifying subjects as not having a mild TBI from those having a moderate, severe, or moderate to severe TBI or correctly identifying subjects as not having any TBI, or correctly identifying subjects as having a mild TBI from those having no TBI, etc.
- Series of calibrating compositions refers to a plurality of compositions comprising a known concentration of (1) UCH-L1, wherein each of the compositions differs from the other compositions in the series by the concentration of UCH-L1; and/or (2) GFAP, wherein each composition differs from the other compositions in the series by the concentration of GFAP.
- single molecule detection refers to the detection and/or measurement of a single molecule of an analyte in a test sample at very low levels of concentration (such as pg/mL or femtogram/mL levels).
- concentration such as pg/mL or femtogram/mL levels.
- single molecule analyzers or devices include nanopore and nanowell devices. Examples of nanopore devices are described in International Patent Pubheation No. WO 2016/161402, which is hereby incorporated by reference in its entirety. Examples of nanowell device are described in International Patent Pubheation No. WO 2016/161400, which is hereby incorporated by reference in its entirety.
- Solid phase or “solid support” as used interchangeably herein, refers to any material that can be used to attach and/or attract and immobilize (1) one or more capture agents or capture specific binding partners, or (2) one or more detection agents or detection specific binding partners.
- the solid phase can be chosen for its intrinsic ability to attract and immobilize a capture agent.
- the solid phase can have affixed thereto a linking agent that has the ability to attract and immobilize the (1) capture agent or capture specific binding partner, or (2) detection agent or detection specific binding partner.
- the linking agent can include a charged substance that is oppositely charged with respect to the capture agent (e.g., capture specific binding partner) or detection agent (e.g., detection specific binding partner) itself or to a charged substance conjugated to the (1) capture agent or capture specific binding partner or (2) detection agent or detection specific binding partner.
- the linking agent can be any binding partner (preferably specific) that is immobilized on (attached to) the solid phase and that has the ability to immobilize the (1) capture agent or capture specific binding partner, or (2) detection agent or detection specific binding partner through a binding reaction.
- the linking agent enables the indirect binding of the capture agent to a solid phase material before the performance of the assay or during the performance of the assay.
- the solid phase can be plastic, derivatized plastic, magnetic, or non-magnetic metal, glass or silicon, including, for example, a test tube, microtiter well, sheet, bead, microparticle, chip, and other configurations known to those of ordinary skill in the art.
- “Specific binding” or “specifically binding” as used herein may refer to the interaction of an antibody, a protein, or a peptide with a second chemical species, wherein the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally. If an antibody is specific for epitope “A”, the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled “A’' and the antibody, will reduce the amount of labeled A bound to the antibody.
- a particular structure e.g., an antigenic determinant or epitope
- Specific binding partner is a member of a specific binding pair.
- a specific binding pair comprises two different molecules, which specifically bind to each other through chemical or physical means. Therefore, in addition to antigen and antibody specific binding pairs of common immunoassays, other specific binding pairs can include biotin and avidin (or streptavidin), carbohydrates and lectins, complementary nucleotide sequences, effector and receptor molecules, cofactors and enzymes, enzymes and enzyme inhibitors, and the like.
- specific binding pairs can include members that are analogs of the original specific binding members, for example, an analyte-analog.
- Immunoreactive specific binding members include antigens, antigen fragments, and antibodies, including monoclonal and polyclonal antibodies as well as complexes and fragments thereof, whether isolated or recombinantly produced.
- Statistically significant refers to the likelihood that a relationship between two or more variables is caused by something other than random chance.
- Statistical hypothesis testing is used to determine whether the result of a data set is statistically significant. In statistical hypothesis testing, a statistical significant result is attained whenever the observed p ’-value of a test statistic is less than the significance level defined of the study. The p-value is the probability of obtaining results at least as extreme as those observed, given that the null hypothesis is true. Examples of statistical hypothesis analysis include Wilcoxon signed-rank test, t-test, Chi-Square or Fisher’s exact test. “Significant” as used herein refers to a change that has not been determined to be statistically significant (e.g., it may not have been subject to statistical hypothesis testing).
- a mammal e.g., cow, pig, camel, llama, horse, goat, rabbit, sheep, hamsters, guinea pig, cat, dog, rat, and mouse
- a non-human primate for example, a monkey, such as a cynomolgous or rhesus monkey, chimpanzee, etc.
- the subject may be a human or a non-human.
- the subject is a human.
- the subject is a human that may be undergoing other forms of treatment.
- the subject is a human-helper subject - e.g., a horse, dog, or other species that assists humans in carrying out their daily tasks (e.g., companion animal) or occupation (e.g., service animal).
- the subject is a human subject.
- the subject is a pediatric subject, e.g., a human pediatric subject.
- the subject is an adult subject, e.g., a human adult subject.
- Treatment are each used interchangeably herein to describe reversing, alleviating, or inhibiting the progress of a disease and/or injury, or one or more symptoms of such disease, to which such term applies.
- the term also refers to preventing a disease, and includes preventing the onset of a disease, or preventing the symptoms associated with a disease.
- a treatment may be either performed in an acute or chronic way.
- the term also refers to reducing the severity of a disease or symptoms associated with such disease prior to affliction with the disease.
- Such prevention or reduction of the severity of a disease prior to affliction refers to administration of a pharmaceutical composition to a subject that is not at the time of administration afflicted with the disease. "Preventing” also refers to preventing the recurrence of a disease or of one or more symptoms associated with such disease. "Treatment” and “therapeutically,” refer to the act of treating, as “treating” is defined above.
- TBI Traumatic Brain Injury
- TBI is most often an acute event similar to other injuries. TBI can be classified as “mild,” “moderate,” “moderate to severe”, or “severe”.
- the causes of TBI are diverse.
- the causes of TBI can be physical, such as, by shaking by a person, a car accident, injuries from firearms, cerebral vascular accidents (e.g., strokes), fells, explosions orblasts and other types of blunt force trauma.
- TBI TBI can occur in subjects suffering from an autoimmune disease, a metabolic disorder, a brain tumor, hypoxia, one or more viruses, meningitis, hydrocephalus or combinations thereof. Young adults and the elderly are the age groups at highest risk for TBI.
- traumatic brain injury or TBI does not include and specifically excludes cerebral vascular accidents such as strokes.
- Mild TBI refers to a brain injury where loss of consciousness is brief and usually a few seconds or minutes and/or confusion and disorientation is shorter than 1 hour. Mild TBI is also referred to as a concussion, minor head trauma, minor TBI, minor brain injury, and minor head injury. While MRI and CT scans may be normal, the individual with mild TBI may have cognitive problems such as headache, difficulty thinking, memory problems, attention deficits, mood swings and frustration.
- Mild TBI is the most prevalent TBI and is often missed at time of initial injury. Typically, a subject has a Glasgow Coma scale number of between 13-15 (such as 13-15 or 14-15). Fifteen percent (15%) of people with mild TBI have symptoms that last 3 months or more. Mild TBI is defined as the result of the forceful motion of the head or impact causing a brief change in mental status (confusion, disorientation or loss of memory) or loss of consciousness for less than 30 minutes. Common symptoms of mild TBI include fatigue, headaches, visual disturbances, memory' loss, poor attention/concentration, sleep disturbances, dizziness/loss of balance, irritability-emotional disturbances, feelings of depression, and seizures. Other symptoms associated with mild TBI include nausea, loss of smell, sensitivity to light and sounds, mood changes, getting lost or confused, and/or slowness in thinking.
- Mode TBI refers to a brain injury where loss of consciousness and/or confusion and disorientation is between 1 and 24 hours and the subject has a Glasgow Coma scale number of between 9-12. The individual with moderate TBI have abnormal brain imaging results.
- “Severe TBI” as used herein refers to a brain injury- where loss of consciousness is more than 24 hours and memory loss after the injury or penetrating skull injury longer than 24 hours and the subject has a Glasgow Coma scale number between 3-8. The deficits range from impairment of higher level cognitive functions to comatose states. Survivors may have limited function of arms or legs, abnormal speech or language, loss of thinking ability or emotional problems. Individuals with severe injuries can be left in long-term unresponsive states. For many people with severe TBI, long-term rehabilitation is often necessary' to maximize function and independence.
- Common symptoms of moderate to severe TBI include cognitive deficits including difficulties with attention, concentration, distractibility, memory, speed of processing, confusion, perseveration, impulsiveness, language processing, and/or “executive functions”, not understanding the spoken word (receptive aphasia), difficulty speaking and being understood (expressive aphasia), slurred speech, speaking very' fast or very slow, problems reading, problems writing, difficulties with interpretation of touch, temperature, movement, limb position and fine discrimination, the integration or patterning of sensory impressions into psychologically meaningful data, partial or total loss of vision, weakness of eye muscles and double vision (diplopia), blurred vision, problems judging distance, involuntary eye movements (nystagmus), intolerance of light (photophobia), hearing, such as decrease or loss of hearing, ringing in the ears (tinnitus), increased sensitivity to sounds, loss or diminished sense of smell (anosmia), loss or diminished sense of taste, the convulsions associated with epilepsy that can be several types and can
- UCH-L1 status can mean either the level or amount of UCH-L1 at a point in time (such as with a single measure of UCH-L1), the level or amount of UCH-L1 associated with monitoring (such as with a repeat test on a subject to identify an increase or decrease in UCH-L1 amount), the level or amount of UCH-L1 associated with treatment for traumatic brain injury (whether a primary brain injury and/or a secondary brain injury) or combinations thereof.
- Variant is used herein to describe a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity.
- biological activity include the ability to be bound by a specific antibody or to promote an immune response.
- Variant is also used herein to describe a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity.
- a conservative substitution of an amino acid i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree, and distribution of charged regions) is recognized in the art as typically involving a minor change.
- hydropathic index of amino acids As understood in the art. Kyte et al., J. Mol. Biol 157: 105-132 (1982).
- the hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes can be substituted and still retain protein function. In one aspect, amino acids having hydropathic indexes of ⁇ 2 are substituted.
- the hydrophilicity of amino acids can also be used to reveal substitutions that would result in proteins retaining biological function.
- hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide, a useful measure that has been reported to correlate well with antigenicity and immunogenicity.
- U.S. Patent No. 4,554,101 incorporated fully herein by reference.
- Substitution of amino acids having similar hydrophilicity values can result in peptides retaining biological activity, for example immunogenicity, as is understood in the art. Substitutions may be performed with amino acids having hydrophilicity values within ⁇ 2 of each other. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid.
- “Variant” also can be used to refer to an antigenically reactive fragment of an anti-analyte (such as GFAP, UCH-L1 or GFAP and UCH-L1) antibody that differs from the corresponding fragment of anti-analyte (such as GFAP, UCH-L1 or GFAP and UCH-L1) antibody in amino acid sequence but is still antigenically reactive and can compete with the corresponding fragment of anti-analyte (such as GFAP, UCH-L1 or GFAP and UCH-L1) antibody for binding with the analyte (such as GFAP, UCH-L1 or GFAP and UCH-L1). “Variant” also can be used to describe a polypeptide or a fragment thereof that
- Vector is used herein to describe a nucleic acid molecule that can transport another nucleic acid to which it has been linked.
- plasmid refers to a circular double-stranded DNA loop into which additional DNA segments may be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors can replicate autonomously in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors” (or simply, "expression vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. “Plasmid” and “vector” may be used interchangeably as the plasmid is the most commonly used form of vector.
- RNA versions of vectors may also find use in the context of the present disclosure.
- YJ refers to Youden's J statistic (also called Youden's index) and is a single statistic that captures the performance of a dichotomous diagnostic test. YJ is represented by the below formulas:
- the present disclosure relates, among other methods, to a method of evaluating a pediatric subject for head injury.
- the method can aid in determining whether a pediatric subject with an actual or suspected head injury has sustained a traumatic brain injury' (TBI), such as mild TBI.
- TBI traumatic brain injury'
- “determining whether the subject has sustained a TBI” refers to the fact that the aforementioned method can be used, e.g., with other information (e.g., clinical assessment data), to determine that the subject is more likely than not to have sustained a TBI, such as mild TBI, and/or more likely than not to have a positive or negative finding on a head imaging procedure, such as a positive or negative MRI head result or a positive or negative CT scan result.
- such a method can comprise the steps of: performing an assay on a sample obtained from the pediatric subject, such as from a sample obtained within about 48 hours (within about 0 minutes, about 30 minutes, about 60 minutes, about 90 minutes, about 120 minutes, about 3 hours, about 4 hours, about 5 hours, about 6 hours, 7 hours, about 8 hours, about 9 hours, about 10 hours, about 11 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, about 25 hours, about 26 hours, about 27 hours, about 28 hours, about 29 hours, about 30 hours, about 31 hours, about 32 hours, about 33 hours, about 34 hours, about 35 hours, about 36 hours, about 37 hours, about 38 hours, about 39 hours, about 40 hours, about 41 hours, about 42 hours, about 43 hours, about 44 hours, about 45 hours, about 46 hours, about 47 hours, or about 48 hours after the actual or suspected head injury to measure or
- the sample can be a biological sample, such as a human (e.g., pediatric) sample.
- the reference level of GFAP and/or the reference level of UCH-L1 correlate with subjects (e.g., pediatric subjects) having TBI and distinguish subjects with no TBI.
- the reference level of GFAP and/or the reference level of UCH-L1 correlate with subjects (e.g., pediatric subjects) having mild TBI and distinguish subjects with no mild TBI.
- the pediatric subject is determined to have sustained a traumatic brain injury when the level of GFAP in the sample is equal to or greater than a reference level of GFAP.
- the reference level of GFAP is at least about 30 pg/mL. In some embodiments, the reference level of GFAP between about 30 pg/mL and about 1000 pg/mL.
- the reference level of GFAP is about 30 pg/mL, about 35 pg/mL, about 40 pg/mL, about 45 pg/mL, about 50 pg/mL, about 55 pg/mL, about 60 pg/mL, about 65 pg/mL, bout 70 pg/mL, about 75 pg/mL, about 80 pg/mL, about 90 pg/mL, about 95 pg/mL, or about 100 pg/mL. In some embodiments, the reference level of GFAP is between about 100 pg/mL and about 1000 pg/mL.
- the reference level of GFAP may be at least about 100 pg/mL, at least about 150 pg/mL, at least about 200 pg/mL, at least about 250 pg/mL, at least about 300 pg/mL, at least about 350 pg/mL, at least about 400 pg/mL, at least about 450 pg/mL, at least about 500 pg/mL, at least about 550 pg/mL, at least about 600 pg/mL, at least about 650 pg/mL, at least about 700 pg/mL, at least about 750 pg/mL, at least about 800 pg/mL, at least about 850 pg/mL, at least about 900 pg/mL, at least about 950 pg/mL, or about 1000 pg/mL.
- a pediatric subject is determined to have sustained a traumatic brain injury' when the level of GFAP in the sample is equal to or greater than a reference level of GFAP of at least about 30 pg/mL.
- the pediatric subject may be determined to have sustained a traumatic brain injury when the level of GFAP in the sample is equal to or greater than 30 pg/mL.
- the pediatric subject may be determined to have sustained a traumatic brain injury when the level of GFAP in the sample is equal to or greater than about 50 pg/mL.
- the pediatric subject may be determined to have sustained a traumatic brain injury when the level of GFAP in the sample is equal to or greater than about 65 pg/mL.
- the pediatric subject may be determined to have sustained a traumatic brain injury when the level of GFAP in the sample is equal to or greater than about lOOOpg/mL.
- the pediatric subject is determined to have sustained a traumatic brain injury' when the level of UCH-L1 in the sample is equal to or greater than a reference level for UCH-L1 .
- the reference level is at least about 55 pg/mL.
- the reference level of UCH-L1 is between about 55 pg/mL and about 1000 pg/mL.
- the reference level of UCH-L1 is about 55 pg/mL, about 60 pg/mL, about 65 pg/mL, about 70 pg/mL, about 75 pg/mL, about 80 pg/mL, about 85 pg/mL, about 90 pg/mL, about 95 pg/mL, or about 100 pg/mL. In some embodiments, the reference level of UCH-L1 is about 100 pg/mL to about 1000 pg/mL.
- the reference level of UCH-L1 is about 100 pg/mL, about 120 pg/mL, about 140 pg/mL, about 160 pg/mL, about 180 pg/mL, about 200 pg/mL, about 220 pg/mL, about 240 pg/mL, about 260 pg/mL, about 280 pg/mL, about 300 pg/mL, about 320 pg/mL, about 340 pg/mL, about 360 pg/mL, about 380 pg/mL, about 400 pg/mL, about 450 pg/mL, about 500 pg/mL, about 550 pg/mL, about 600 pg/mL, about 650 pg/mL, about 700 pg/mL, about 750 pg/mL, about 800 pg/mL, about 850 pg/mL, about 900
- the pediatric subject is determined to have sustained a traumatic brain injury when the level of UCH-L1 in the sample is greater than a reference level of UCH-L1 of at least about 55 pg/mL.
- the pediatric subject may be determined to have sustained a traumatic brain injury when the level of UCH-L1 in the sample is equal to or greater than 55 pg/mL.
- the pediatric subject may be determined to have sustained a traumatic brain injury when the level of UCH-L1 in the sample is equal to or greater than 300 pg/mL.
- the pediatric subject may be determined to have sustained a traumatic brain injury when the level of UCH-L1 in the sample is equal to or greater than 360 pg/mL.
- the pediatric subject is determined to have sustained a traumatic brain injury when the level of GFAP in the sample is greater than a reference level of GFAP and the level of UCH-L1 in the sample is greater than a reference level of UCH-L1.
- the reference level of UCH-L1 is at least about 30 pg/mL and the reference level of UCH-L1 is about 360 pg/mL.
- the pediatric subject may be determined to have sustained atraumatic brain injury- when the level of GFAP in the sample to is equal to or greater than 30 pg/mL and the level of UCH-L1 in the sample is equal to or greater than 360 pg/mL.
- the reference level of GFAP is about 65 pg/mL and the reference level of UCH-L1 is about 360 pg/mL.
- the pediatric subject may be determined to have sustained a traumatic brain injury when the level of GFAP in the sample to is equal to or greater than 65 pg/mL and the level of UCH-L1 in the sample is equal to or greater than 360 pg/mL.
- a method of evaluating whether to perform a head CT scan on a pediatric subject can comprise the steps of: performing an assay on a sample obtained from the pediatric subject, such as within about 48 hours (e.g., from zero to about 48 hours); and (a) determining a head CT scan should be performed on the pediatric subject when the (i) level of GFAP in the sample is equal to or greater than a reference level ofGFAP, (ii) level of UCH-L1 in the sample is equal to or greater than a reference level of UCH-L1, or (iii) level ofGFAP in the sample is equal to or greater than a reference level of GFAP and the level of UCH-L1 in the sample is equal to or greater than a reference level of UCH-L1.
- the method further comprises providing the head imaging procedure (e.g. the head CT scan).
- the method comprises determining that the subject has not sustained a TBI when the level of GFAP in the sample is lower than a reference level of GFAP, and/or the level of UCH-L1 in the sample is lower than a reference level of UCH-L1.
- the sample can be a biological sample, such as a human sample. Conversely, a low level of one or more GFAP and UCH-L1 biomarkers can predict whether the scan is likely to be negative, as described herein.
- a head CT scan should be performed when the level of GFAP in the sample is equal to or greater than a reference level of GFAP.
- the reference level of GFAP is at least about 30 pg/mL. In some embodiments, the reference level of GFAP between about 30 pg/mL and about 1 OOOpg/mL.
- the reference level of GFAP is about 30 pg/mL, about 35 pg/mL, about 40 pg/mL, about 45 pg/mL, about 50 pg/mL, about 55 pg/mL, about 60 pg/mL, about 65 pg/mL, bout 70 pg/mL, about 75 pg/mL, about 80 pg/mL, about 90 pg/mL, about 95 pg/mL, or about 100 pg/mL. In some embodiments, the reference level of GFAP is between about 100 pg/mL and about 1000 pg/mL.
- the reference level of GFAP may be at least about 100 pg/mL, at least about 150 pg/mL, at least about 200 pg/mL, at least about 250 pg/mL, at least about 300 pg/mL, at least about 350 pg/mL, at least about 400 pg/mL, at least about 450 pg/mL, at least about 500 pg/mL, at least about 550 pg/mL, at least about 600 pg/mL, at least about 650 pg/mL, at least about 700 pg/mL, at least about 750 pg/mL, at least about 800 pg/mL, at least about 850 pg/mL, at least about 900 pg/mL, at least about 950 pg/mL, or about 1000 pg/mL.
- a head CT scan should be performed when the level of GFAP in the sample is equal to or greater than a reference level of GFAP of at least about 30 pg/mL. For example, it may be determined that a head CT scan should be performed when the level of GFAP in the sample is equal to or greater than 30 pg/mL. As another example, it may be determined that a head CT scan should be performed when the level of GFAP in the sample is equal to or greater than about 50 pg/mL. In some embodiments, it is determined that a head CT scan should be performed when the level of GFAP in the sample is equal to or greater than about 65 pg/mL. In some embodiments, it is determined that a head CT scan should be performed when the level of GFAP in the sample is equal to or greater than about 1000 pg/mL.
- a head CT scan should be performed when the level of UCH-L1 in the sample is equal to or greater than a reference level for UCH-L 1.
- the reference level is at least about 55 pg/mL.
- the reference level of UCH-L1 is between about 55 pg/mL and about 1000 pg/mL.
- the reference level of UCH-L1 is about 55 pg/mL, about 60 pg/mL, about 65 pg/mL, about 70 pg/mL, about 75 pg/mL, about 80 pg/mL, about 85 pg/mL, about 90 pg/mL, about 95 pg/mL, or about 100 pg/mL. In some embodiments, the reference level of UCH-L1 is about 100 pg/mL to about 1000 pg/mL.
- the reference level of UCH-L1 is about 100 pg/mL, about 120 pg/mL, about 140 pg/mL, about 160 pg/mL, about 180 pg/mL, about 200 pg/mL, about 220 pg/mL, about 240 pg/mL, about 260 pg/mL, about 280 pg/mL, about 300 pg/mL, about 320 pg/mL, about 340 pg/mL, about 360 pg/mL, about 380 pg/mL, about 400 pg/mL, about 450 pg/mL, about 500 pg/mL, about 550 pg/mL, about 600 pg/mL, about 650 pg/mL, about 700 pg/mL, about 750 pg/mL, about 800 pg/mL, about 850 pg/mL, about 900
- a head CT scan should be performed w'hen the level of UCH-L 1 in the sample is greater than a reference level of UCH-L 1 of at least about 55 pg/mL. For example, it may be determined that a head CT scan should be performed when the level of UCH-L 1 in the sample is equal to or greater than 55 pg/mL. As another example, it may be determined that a head CT scan should be performed when the level of UCH-L1 in the sample is equal to or greater than 300 pg/mL. As another example, it may be determined that a head CT scan should be performed when the level of UCH-L 1 in the sample is equal to or greater than 360 pg/mL.
- the reference level of GFAP is about 65 pg/mL and the reference level of UCH-L 1 is about 360 pg/mL.
- a head CT scan should be performed when the level of GFAP in the sample to is equal to or greater than 65 pg/mL and the level of UCH-L1 in the sample is equal to or greater than 360 pg/mL.
- the method can include obtaining a sample within about 48 hours, such as within about 24 hours (e.g., from zero to about 25 hours), of an actual or suspected injury to the head from the pediatric subject and contacting the sample with an antibody for GFAP or an antibody for UCH-L1 to allow formation of a complex of the antibody and GFAP or the antibody and UCH-L1.
- the method also includes detecting the resulting antibody-GFAP complex or antibody-UCH-Ll complex.
- a sample is taken from the human (e.g., pediatric human) subject within about 48 hours of an actual or suspected injury to the head, such as within about 0 to about 4 hours, within about 0 to about 8 hours, within about 0 to about 12 hours, within about 0 to about 16 hours, within about 0 to about 20 hours, within about 0 to about 24 hours, and within about 0 to about 48 hours.
- a sample is taken from the human (e.g., pediatric human) subject within about within about 4 hours to about 8 hours, within about 8 hours to about 12 hours, within about 12 hours to about 16 hours, within about 16 horns to about 20 hours, within about 20 hours to about 24 hours, and within about 24 hours to about 48 hours.
- the sample can be taken from the human (e.g., pediatric human) subject within about 0 minutes, about 30 minutes, about 60 minutes, about 90 minutes, about 120 minutes, about 3 horns, about 4 horns, about 5 horns, about 6 hours, 7 hours, about 8 hours, about 9 hours, about 10 hours, about 11 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 horns, about 25 hours, about 26 hours, about 27 hours, about 28 hours, about 29 hours, about 30 hours, about 31 hours, about 32 hours, about 33 hours, about 34 hours, about 35 hours, about 36 hours, about 37 hours, about 38 hours, about 39 hours, about 40 hours, about 41 hours, about 42 hours, about 43 hours, about 44 hours, about 45 hours, about 46 hours, about 47 hours, or about 48 hours after the actual or suspected injur ⁇ '.
- human e.g., pediatric human
- the onset of the presence of GFAP, UCH-L1 or GFAP and UCH-L1 appears within about 0 minutes, about 30 minutes, about 60 minutes, about 90 minutes, about 120 minutes, about 3 hours, about 4 hours, about 5 hours, about 6 hours, 7 hours, about 8 hours, about 9 hours, about 10 hours, about 11 hours, about 12 hours, about 13 hours, about 14 hours, about 15 hours, about 16 hours, about 17 hours, about 18 hours, about 19 hours, about 20 hours, about 21 hours, about 22 hours, about 23 hours, about 24 hours, about 25 hours, about 26 hours, about 27 hours, about 28 hours, about 29 hours, about 30 hours, about 31 hours, about 32 hours, about 33 hours, about 34 hours, about 35 hours, about 36 hours, about 37 hours, about 38 hours, about 39 hours, about 40 hours, about 41 hours, about 42 hours, about 43 hours, about 44 hours, about 45 hours, about 46 hours, about 47 hours, or about 48 hours after the injury to the head.
- the subject may have received a Glasgow Coma Scale score before or after the level of the GFAP, UCH-L1 or GFAP and UCH-L1 is determined at one or more time points.
- the subject may be suspected of having a mild traumatic brain injury based on the Glasgow Coma Scale score.
- the pediatric subject may be suspected of having a mild traumatic brain injury based on an abnormal head CT.
- the pediatric subject has received a CT scan before or after the assay is performed.
- the subject has a normal head CT.
- the reference level of GFAP, UCH-L1 or GFAP and UCH- L1 is correlated with pediatric subjects having a moderate to severe traumatic brain injury. In some embodiments, the reference level of GFAP, UCH-L1 or GFAP and UCH-L1 is correlated with a Glasgow Coma Scale score of 3-12. In some embodiments, the pediatric subject is suspected as having mild traumatic brain injury based on the Glasgow Coma Scale score. In some embodiments, the reference level of GFAP, UCH-L1 or GFAP and UCH-L1 is correlated with subjects having mild traumatic brain injury. In some embodiments, the reference level of GFAP, UCH-L1 or GFAP and UCH-L1 is correlated with a Glasgow Coma Scale score of 13-15.
- a reference level of GFAP, UCH-L1 or GFAP and UCH-L1 can also be employed as a benchmark against which to assess results obtained upon assaying a test sample for GFAP, UCH-L1 or GFAP and UCH-L1.
- the reference level of GFAP, UCH-L1 or GFAP and UCH-L1 are obtained by running a particular assay a sufficient number of times and under appropriate conditions such that a linkage or association of analyte presence, amount or concentration with a particular stage or endpoint of TBI or with particular indicia can be made.
- the reference level of GFAP, UCH-L1 or GFAP and UCH-L1 is obtained with assays of reference subjects (or populations of subjects).
- the GFAP, UCH-L1 or GFAP and UCH-L1 measured can include fragments thereof, degradation products thereof, and/or enzymatic cleavage products thereof.
- the reference level may be correlated with control subjects that have not sustained a head injury.
- the reference level of GFAP, UCH-L1 or GFAP and UCH- L1 is determined by an assay having a sensitivity (for GFAP, UCH-L1 or GFAP and UCH- Ll) of between at least about 30% to about 100% and a specificity of between at least about 30% to about 100%.
- the sensitivity is between at least about 30% to about 100%, between at least about 30% to about 99%, between at least about 30% to about 97%, between at least about 30% to about 95%, between at least about 30% to about 90%, between at least about 30% to about 85%, between at least about 30% to about 80%, between at least about 30% to about 75%, between at least about 35% to about 100%, between at least about 35% to about 99%, between at least about 35% to about 97%, between at least about 35% to about 95%, between at least about 35% to about 90%, between at least about 35% to about 85%, between at least about 35% to about 80%, between at least about 35% to about 75%, between at least about 70% to about 100%, between at least about 70% to about 99%, between at least about 70% to about 97%, between at least about 70% to about 95%, between at least about 70% to about 90%, between at least about 70% to about 85%, between at least about 70% to about 80%, between at least about 70% to about 75%, between at least about at least about 70%
- the sensitivity is at least about 70.0%, at least about 75.0%, at least about 80.0%, at least about 81.0%, at least about 85.0%, at least about 87.5%, at least about 90.0%, at least about 95.0%, at least about 99.0%, at least about 99.1%, at least about 99.2%, at least about 99.3%, at least about 99.4%, at least about 99.5%, at least about 99.6%, at least about 99.7%, at least about 99.8%, at least about 99.9%, or at least about 100.0%.
- the specificity (for GFAP, UCH-L1 or GFAP and UCH-L1) is between at least about 10% to about 100%, between at least about 15% to about 99%, between at least about 20% to about 95%, between at least about 25% to about 90%, between at least about 30% to about 85%, between at least about 30% to about 80%, between at least about 30% to about 75%, between at least about 30% to about 70%, between at least about 30% to about 60%, between at least about 30% to about 50%, between at least about 30% to about 40%, between at least about 30% to about 35%, between at least about 40% to about 100%, between at least about 40% to about 99%, between at least about 40% to about 95%, between at least about 40% to about 90%, between at least about 40% to about 85%, between at least about 40% to about 80%, between at least about 40% to about 75%, between at least about 40% to about 70%, between at least about 40% to about 60%, between at least about 40% to about 50%, between at least about 50% to about 100%, between at least about at least about 50% to about 100%
- the specificity is at least about 30.0%, at least about 31.0%, at least about 32.0%, at least about 33.0%, at least about 34.0%, at least about 35.0%, at least about 36.0%, at least about 37.0%, at least about 38.0%, at least about 39.0%, at least about 40.0%, at least about 45.0%, at least about 50.0%, at least about 55.0%, at least about 60.0%, at least about 65.0%, at least about 70.0%, at least about 75.0%, at least about 80.0%, at least about 81.0%, at least about 82.0%, at least about 83.0%, at least about 84.0%, at least about 85.0%, at least about 90.0%, at least about 91.0%, at least about 92.0%, at least about 93.0%, at least about 94.0%, at least about 95.0%, at least about 96.0%, at least about 97.0%, at least about 98.0%, at least about 99
- the sensitivity is at least about 99% and the specificity is at least about 75%, the sensitivity is at least about 99% and the specificity' is at least about 99%, or the sensitivity is at least about 100% and the specificity is at least about 100%.
- the reference level of GFAP is determined by an assay having a sensitivity of at least about 90% and a specificity of at least about 40%.
- the reference level of GFAP may be determined by an assay having a sensitivity of about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% and a sensitivity of at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
- the reference level of GFAP is determined by an assay having a sensitivity of at least about 50% and a specificity of at least about 90%.
- the reference level of GFAP may be determined by an assay having a sensitivity of at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100% and a specificity of at least about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100%.
- the reference level of GFAP is determined by an assayhaving a negative predictive value of at least about 70%.
- the reference level of GFAP may be determined by an assay having a negative predictive value of at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100%.
- the reference level of GFAP is determined by an assay having a negative predictive value of at least about 90%.
- the reference level of GFAP is determined by an assay having a positive predictive value of at least about 50%.
- the reference level of GFAP may be determined by an assay having a positive predictive value of at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100%.
- the reference level of GFAP is determined by an assay having a positive predictive value of at least about 80%.
- the reference level of UCH-L1 is determined by an assay having a sensitivity of at least about 80% and a specificity of at least about 25%.
- the reference level of UCH-L1 is determined by an assay having a sensitivity of at least about 85%, at least about 90%, at least about 95%, or about 100% and a specificity of at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
- the reference level of UCH-L1 is determined by an assay having a sensitivity of at least about 30% and a specificity of at least about 90%. In some embodiments, the reference level of UCH-L1 is determined by an assay having a sensitivity of at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100% and a specificity of at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100%.
- the reference level of UCH-L1 is determined by an assay having a negative predictive value of at least about 65%. In some embodiments, the reference level of UCH-L1 is determined by an assay having a negative predictive value of at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100%.
- the reference level of UCH-L1 is determined by an assay having a positive predictive value of at least about 40%, for example, the reference level of UCH-L1 may be determined by an assay having a positive predictive value of at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%. In some embodiments, the reference level of UCH-L1 is determined by an assay having a positive predictive value of at least about 80%.
- the reference level of GFAP and the reference level of UCH-L1 are determined by an assay having a sensitivity of at least about 70% and a specificity of at least about 10%.
- the reference level of GFAP and the reference level of UCH-L1 may be determined by an assay having a sensitivity of at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100% and a specificity of at least about 10%, at least about 15%, at least about 20% at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
- UCH-L1 are determined by an assay having a sensitivity of at least about 65% and a specificity of at least about 25%.
- the reference level of GFAP and the reference level of UCH-L1 may be determined by an assay having a sensitivity of at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100% and a specificity of at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
- the reference level of GFAP and the reference level of UCH-L1 are determined by an assay having a positive predictive value of at least about 35%.
- the reference level of GFAP and the reference level of UCH-L1 may be determined by an assay having a positive predictive value of at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
- the reference level of GFAP and the reference level of UCH-L1 are determined by an assay having a negative predictive value of at least about 40%.
- the reference level of GFAP and the reference level of UCH-L1 may be determined by an assay having a negative predictive value of at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.
- the reference level of GFAP and the reference level of UCH-L1 are determined by an assay having a negative predictive value of at least about 55%.
- the sample is selected from the group consisting of a whole blood sample, a serum sample, a cerebrospinal fluid sample, a tissue sample, a bodily fluid sample, and a plasma sample.
- the sample is a whole blood sample obtained from a human, such as a pediatric human.
- the sample is a serum sample obtained from a human, such as a pediatric human.
- the sample is a cerebrospinal fluid obtained from a human, such as a pediatric human.
- the sample is a plasma sample obtained from a human, such as a pediatric human. More specifically, the pediatric human from which the sample is collected may be less than about 18 years old.
- the method can be carried out on any pediatric subject without regard to factors selected from the group consisting of the pediatric subject’s clinical condition, the subject’s laboratory values, and the subject’s classification as suffering from mild, moderate or severe traumatic brain injury.
- the method can further include treating the pediatric subject determined as having sustained a mild TBI with a traumatic brain injury treatment, as described below. In some embodiments, the method can further include monitoring the pediatric subject determined as having sustained a mild TBI, as described below.
- test can be any assay known in the art such as, for example, immunoassays, protein immunoprecipitation, immunoelectrophoresis, chemical analysis, SDS-PAGE and Western blot analysis, or protein immunostaining, electrophoresis analysis, a protein assay, a competitive binding assay, a functional protein assay, or chromatography or spectrometry methods, such as high-performance liquid chromatography (HPLC) or liquid chromatography-mass spectrometry (LC/MS).
- HPLC high-performance liquid chromatography
- LC/MS liquid chromatography-mass spectrometry
- the assay can be employed in a clinical chemistry format such as would be known by one of ordinary skill in the art. Such assays are described in further detail herein.
- the values used in an assay that employs specific sample type (e.g., such as an immunoassay that utilizes serum or a point-of-care device that employs whole blood) can be extrapolated to other assay formats using known techniques in the art, such as assay standardization.
- specific sample type e.g., such as an immunoassay that utilizes serum or a point-of-care device that employs whole blood
- assay standardization one way in which assay standardization can be performed is by applying a factor to the calibrator employed in the assay to make the sample concentration read higher or low r er to get a slope that aligns with the comparator method.
- the subject identified or assessed in the methods described above as having traumatic brain injury may be treated or monitored.
- the method further includes treating the human pediatric subject assessed as having traumatic brain injury with a traumatic brain injury treatment, such as any treatments known in the art.
- treatment of traumatic brain injury can take a variety of farms depending on the severity of the injury to the head.
- the treatment may include one or more of rest, abstaining from events that aggravate symptoms (such as sports), avoiding tight or wearing sunglasses when out in the light, symptomatic management such as medication for relief of a headache or migraine, anti-nausea medication, etc.
- Treatment for patients suffering from severe TBI might include administration of one or more appropriate medications (such as, for example, diuretics, anti-convulsant medications, medications to sedate and put an individual in a drug-induced coma, or other pharmaceutical or biopharmaceutical medications (either known or developed in the fixture for treatment of TBI), one or more surgical procedures (such as, for example, removal of a hematoma, repairing a skull fracture, decompressive craniectomy, etc.) and one or more therapies (such as, for example one or more rehabilitation, cognitive behavioral therapy, anger management, counseling psychology, etc.).
- the method further includes monitoring the human pediatric subject assessed as having traumatic brain injury- (e.g., mild or moderate to severe traumatic).
- a pediatric subject identified as having traumatic brain injury such as mild traumatic brain injury or severe traumatic brain injury, may be monitored with CT scan or MRI.
- UCH-L1 levels can be measured by any means, such as antibody dependent methods, such as immunoassays, protein immunoprecipitation, immunoelectrophoresis, chemical analysis, SDS-PAGE and Western blot analysis, protein immunostaining, electrophoresis analysis, a protein assay, a competitive binding assay, a functional protein assay, or chromatography or spectrometry methods, such as high- performance liquid chromatography (HPLC) or liquid chromatography-mass spectrometry (LC/MS).
- the assay can be employed in clinical chemistry format such as would be known by one skilled in the art.
- measuring the level of UCH-L1 includes contacting the sample with a first specific binding member and second specific binding member.
- the first specific binding member is a capture antibody and the second specific binding member is a detection antibody.
- measuring the level of UCH- L1 includes contacting the sample, either simultaneously or sequentially, in any order: (1) at least one capture antibody (e.g., UCH-L1 -capture antibody), which binds to an epitope on UCH-L1 or UCH-L1 fragment to form an at least one capture antibody-UCH-Ll antigen complex (e.g., UCH-L1 -capture antibody-UCH-Ll antigen complex), and (2) at least one detection antibody (e.g., UCH-Ll-detection antibody), which includes a detectable label and binds to an epitope on UCH-L1 that is not bound by the capture antibody, to form a UCH-L1 antigen-at least one detection antibody complex (e.g., UCH-Ll-detection
- the method further comprises a third specific binding member, such as a second detection antibody which includes a detectable label and binds to an epitope on UCH-L1 that is not bound by the capture antibody and the first detection antibody.
- a third specific binding member such as a second detection antibody which includes a detectable label and binds to an epitope on UCH-L1 that is not bound by the capture antibody and the first detection antibody.
- the first specific binding member is immobilized on a solid support.
- the second specific binding member is immobilized on a solid support.
- the first specific binding member is a UCH-L1 antibody as described below.
- the sample is diluted or undiluted.
- the sample can be from about 1 to about 25 microliters, about 1 to about 24 microliters, about 1 to about 23 microliters, about 1 to about 22 microliters, about 1 to about 21 microliters, about 1 to about 20 microliters, about 1 to about 18 microliters, about 1 to about 17 microliters, about 1 to about 16 microliters, about 15 microliters or about 1 microliter, about 2 microliters, about 3 microliters, about 4 microliters, about 5 microliters, about 6 microliters, about 7 microliters, about 8 microliters, about 9 microliters, about 10 microliters, about 11 microliters, about 12 microliters, about 13 microliters, about 14 microliters, about 15 microliters, about 16 microliters, about 17 microliters, about 18 microliters, about 19 microliters, about 20 microliters, about 21 microliters, about 22 microliters, about 23 microliters, about 24 microliters or about 25
- ARCHITECT® other than a point-of-care device may be capable of measuring levels of UCH-L1 in a sample higher or greater than 25,000 pg/mL.
- Other methods of detection include the use of or can be adapted for use on a nanopore device or nanowell device, e.g. for single molecule detection. Examples of nanopore devices are described in International Patent Publication No. WO 2016/161402, which is hereby incorporated by reference in its entirety. Examples of nanowell device are described in International Patent Pubheation No. WO 2016/161400, which is hereby incorporated by reference in its entirety. Other devices and methods appropriate for single molecule detection also can be employed.
- GFAP levels can be measured by any means, such as antibody dependent methods, such as immunoassays, protein immunoprecipitation, immunoelectrophoresis, chemical analysis, SDS-PAGE and Western blot analysis, or protein immunostaining, electrophoresis analysis, a protein assay, a competitive binding assay, a functional protein assay, or chromatography or spectrometry methods, such as high- performance liquid chromatography (HPLC) or liquid chromatography-mass spectrometry (LC/MS).
- the assay can be employed in clinical chemistry format such as would be known by one skilled in the art.
- measuring the level of GFAP includes contacting the sample with a first specific binding member and second specific binding member.
- the first specific binding member is a capture antibody and the second specific binding member is a detection antibody.
- measuring the level of GFAP includes contacting the sample, either simultaneously or sequentially, in any order: (1) at least one capture antibody (e.g., GFAP-capture antibody), which binds to an epitope on GFAP or GFAP fragment to form an at least one capture antibody-GFAP antigen complex (e.g., GFAP-capture antibody-GFAP antigen complex), and (2) at least one detection antibody (e.g., GFAP-detection antibody), which includes a detectable label and binds to an epitope on GFAP that is not bound by the capture antibody, to form a GFAP antigen-at least one detection antibody complex (e.g., GFAP antigen-GFAP-detection antibody complex), such that an at least one capture antibody (e.g., GFAP-
- the first specific binding member is immobilized on a solid support.
- the second specific binding member is immobilized on a solid support.
- the first specific binding member is a GFAP antibody as described below.
- the sample is diluted or undiluted.
- the sample can be from about 1 to about 25 microliters, about 1 to about 24 microliters, about 1 to about 23 microliters, about 1 to about 22 microliters, about 1 to about 21 microliters, about 1 to about 20 microliters, about 1 to about 18 microliters, about 1 to about 17 microliters, about 1 to about 16 microliters, about 15 microliters or about 1 microliter, about 2 microliters, about 3 microliters, about 4 microliters, about 5 microliters, about 6 microliters, about 7 microliters, about 8 microliters, about 9 microliters, about 10 microliters, about 11 microliters, about 12 microliters, about 13 microliters, about 14 microliters, about 15 microliters, about 16 microliters, about 17 microliters, about 18 microliters, about 19 microliters, about 20 microliters, about 21 microliters, about 22 microliters, about 23 microliters, about 24 microliters or about 25
- Some instruments such as, for example the Abbott Laboratories instrument ARCHITECT®, and other core laboratory instruments
- a point-of-care device may be capable of measuring levels of GFAP in a sample higher or greater than 50,000 pg/mL.
- Other methods of detection include the use of or can be adapted for use on a nanopore device or nanowell device, e.g. for single molecule detection. Examples of nanopore devices are described in International Patent Publication No. WO 2016/161402, which is hereby incorporated by reference in its entirety. Examples of nanowell device are described in International Patent Pubheation No. WO 2016/161400, which is hereby incorporated by reference in its entirety. Other devices and methods appropriate for single molecule detection also can be employed. 6.
- the methods described herein may use an isolated antibody that specifically binds to GFAP, UCH-L1 or GFAP and UCH-L1.
- the methods described herein may use an isolated antibody that specifically binds to ubiquitin carboxy-terminal hydrolase LI (“UCH-L1”) (or fragments thereof), referred to as ‘UCH-L1 antibody.’'
- the UCH-L1 antibodies can be used to assess the UCH-L1 status as a measure of traumatic brain injury, detect the presence of UCH-L1 in a sample, quantify the amount of UCH-L1 present in a sample, or detect the presence of and quantify the amount of UCH-L1 in a sample.
- Ubiquitin carboxy-terminal hydrolase LI (“UCH-L1”), which is also known as
- ubiquitin C-terminal hydrolase is a deubiquitinating enzyme.
- UCH-L1 is a member of a gene family whose products hydrolyze small C-terminal adducts of ubiquitin to generate the ubiquitin monomer.
- Expression of UCH-L1 is highly specific to neurons and to cells of the diffuse neuroendocrine system and their tumors. It is abundantly present in all neurons (accounts for 1-2% of total brain protein), expressed specifically in neurons and testis/ovary.
- the catalytic triad of UCH-L1 contains a cysteine at position 90, an aspartate at position 176, and a histidine at position 161 that are responsible for its hydrolase activity.
- Human UCH-L1 may have the following amino acid sequence:
- the human UCH-L1 may be a fragment or variant of SEQ ID NO: 1.
- the fragment of UCH-L1 may be between 5 and 225 amino acids, between 10 and 225 amino acids, between 50 and 225 amino acids, between 60 and 225 amino acids, between 65 and 225 amino acids, between 100 and 225 amino acids, between 150 and 225 amino acids, between 100 and 175 amino acids, or between 175 and 225 amino acids in length.
- the fragment may comprise a contiguous number of amino acids from SEQ ID NO: 1.
- the antibody is an antibody that binds to UCH-L1, a fragment thereof, an epitope of UCH-L1, or a variant thereof.
- the antibody may be a fragment of the anti-UCH-Ll antibody or a variant or a derivative thereof.
- the antibody may be a polyclonal or monoclonal antibody.
- the antibody may be a chimeric antibody, a single chain antibody, an affinity matured antibody, a human antibody, a humanized antibody, a fully human antibody or an antibody fragment, such as a Fab fragment, or a mixture thereof.
- Antibody fragments or derivatives may comprise F(ab’)2, Fv or scFv fragments.
- the antibody derivatives can be produced by peptidomimetics. Further, techniques described for the production of single chain antibodies can be adapted to produce single chain antibodies.
- the anti-UCH-Ll antibodies may be a chimeric anti-UCH-Ll or humanized anti- UCH-Ll antibody.
- both the humanized antibody and chimeric antibody are monovalent.
- both the humanized antibody and chimeric antibody comprise a single Fab region linked to an Fc region.
- Human antibodies may be derived from phage-display technology or from transgenic mice that express human immunoglobulin genes.
- the human antibody may be generated as a result of a human in vivo immune response and isolated. See, for example, Funaro et al., BMC Biotechnology, 2008(8): 85. Therefore, the antibody may be a product of the human and not animal repertoire. Because it is of human origin, the risks of reactivity against self-antigens may be minimized.
- standard yeast display libraries and display technologies may be used to select and isolate human anti-UCH-Ll antibodies. For example, libraries of naive human single chain variable fragments (scFv) may be used to select human anti-UCH-Ll antibodies.
- Transgenic animals may be used to express human antibodies.
- Humanized antibodies may be antibody molecules from non-human species antibody that binds the desired antigen having one or more complementarity determining regions (CDRs) from the non-human species and framework regions from a human immunoglobulin molecule.
- CDRs complementarity determining regions
- the antibody is distinguishable from known antibodies in that it possesses different biological function(s) than those known in the art. i. Epitope
- the antibody may immunospecifically bind to UCH-L1 (SEQ ID NO: 1), a fragment thereof, or a variant thereof.
- the antibody may immunospecifically recognize and bind at least three amino acids, at least four amino acids, at least five amino acids, at least six amino acids, at least seven amino acids, at least eight amino acids, at least nine amino acids, or at least ten amino acids within an epitope region.
- the antibody may immunospecifically recognize and bind to an epitope that has at least three contiguous amino acids, at least four contiguous amino acids, at least five contiguous amino acids, at least six contiguous amino acids, at least seven contiguous amino acids, at least eight contiguous amino acids, at least nine contiguous amino acids, or at least ten contiguous amino acids of an epitope region.
- Anti-UCH-Ll antibodies may be generated using the techniques described herein as well as using routine techniques known in the art.
- the anti-UCH- Ll antibody may be an unconjugated UCH-L1 antibody, such as UCH-L1 antibodies available from United State Biological (Catalog Number: 031320), Cell Signaling Technology (Catalog Number: 3524), Sigma-Aldrich (Catalog Number: HPA005993), Santa Cruz Biotechnology, Inc.
- the anti-UCH-Ll antibody may be conjugated to a fluorophore, such as conjugated UCH-L1 antibodies available from BioVision (Catalog Number: 6960-25) or Aviva Systems Biology (Cat. Nos. OAAF01904-FTrC).
- conjugated UCH-L1 antibodies available from BioVision (Catalog Number: 6960-25) or Aviva Systems Biology (Cat. Nos. OAAF01904-FTrC).
- Other UCH-L1 antibodies that can be used in the methods described herein include those described in WO 2018/081649, the contents of which are herein incorporated by reference.
- the methods described herein may use an isolated antibody that specifically binds to Glial fibrillary acidic protein (“GFAP”) (or fragments thereof), referred to as “GFAP antibody.”
- GFAP antibody Glial fibrillary acidic protein
- the GFAP antibodies can be used to assess the GFAP status as a measure of traumatic brain injury, detect the presence of GFAP in a sample, quantify the amount of GFAP present in a sample, or detect the presence of and quantify the amount of GFAP in a sample.
- Glial fibrillary acidic protein is a 50 kDa intracytoplasmic filamentous protein that constitutes a portion of the cytoskeleton in astrocytes, and it has proved to be the most specific marker for cells of astrocytic origin.
- GFAP protein is encoded by the GFAP gene in humans.
- GFAP is the principal intermediate filament of mature astrocytes. In the central rod domain of the molecule, GFAP shares considerable structural homology with the other intermediate filaments. GFAP is involved in astrocyte motility and shape by providing structural stability to astrocytic processes.
- Glial fibrillary acidic protein and its breakdown products are brain-specific proteins released into the blood as part of the pathophysiological response after traumatic brain injury (TB1).
- TB1 traumatic brain injury
- astrocytes proliferate and show extensive hypertrophy of the cell body and processes, and GFAP is markedly upregulated.
- GFAP is markedly upregulated.
- astrocyte malignancy there is a progressive loss of GFAP production.
- GFAP can also be detected in Schwann cells, enteric glia cells, salivary- gland neoplasms, metastasizing renal carcinomas, epiglottic cartilage, pituicytes, immature oligodendrocytes, papillary meningiomas, and myoepithelial cells of the breast.
- Human GFAP may have the following amino acid sequence: [0189] MERRRITSAARRSYVSSGEMMVGGLAPGRRLGPGTRLSLARMPPPLPTRV DFSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRA KEPTKLADVYQAELRELRLRLDQLTANSARLEVERDNLAQDLATVRQKLQDETNLR LEAENNLAAYRQEADEATLARLDLERKIESLEEEIRFLRK1HEEEVRELQEQLARQQV HVELDVAKPDLTAALKEIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAELL RQAKHEANDYRRQLQSLTCDLESLRGTNESLERQMREQEERHVREAASYQEALARL EEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIR ETSLDTKSVSEGHLKRNIWKTVEMRDGE
- the human GFAP may be a fragment or variant of SEQ ID NO: 2.
- the fragment of GFAP may be between 5 and 400 amino acids, between 10 and 400 amino acids, between 50 and 400 amino acids, between 60 and 400 amino acids, between 65 and 400 amino acids, between 100 and 400 amino acids, between 150 and 400 amino acids, between 100 and 300 amino acids, or between 200 and 300 amino acids in length.
- the fragment may comprise a contiguous number of amino acids from SEQ ID NO: 2.
- the human GFAP fragment or variant of SEQ ID NO: 2 may be a GFAP breakdown product (BDP).
- the GFAP BDP may be 38 kDa, 42 kDa (fainter 41 kDa), 47 kDa (fainter 45 kDa); 25 kDa (fainter 23 kDa); 19 kDa, or 20 kDa.
- BDP GFAP breakdown products
- at least two antibodies that bind non-overlapping epitopes within GFAP breakdown products (BDP) such as the 38 kDa BDP defined by amino acids 60-383 of the GFAP protein sequence (SEQ ID NO:2), may assist with maintaining the dynamic range and low end sensitivity of the immunoassays.
- at least two antibodies bind non-overlapping epitopes near the N-terminus of the 38 kDa BDP.
- At least two antibodies bind non-overlapping epitopes between amino acids 60-383 of SEQ ID NO:2.
- at least one first antibody (such as a capture antibody) binds to an epitope near the N-terminus of the 38 kDa BDP and at least one second antibody (such as a detection antibody) binds to an epitope near the middle of the 38 kDa BDP that does not overlap with the first antibody.
- at least one first antibody (such as a capture antibody) binds to an epitope between amino acids 60-383 of SEQ ID NO:2 and at least one second antibody binds to an epitope between amino acids 60- 383 of SEQ ID NO:2 that do not overlap with the first antibody.
- the epitope bound by first antibody may be 10 amino acids, 11 amino acids, 12 amino acids, 13 amino acids, 14 amino acids or 15 amino acids in length.
- the epitope bound by the second antibody may be 10 amino acids, 11 amino acids, 12 amino acids, 13 amino acids, 14 amino acids or 15 amino acids in length.
- One skilled in the art could readily determine antibodies binding to non- overtyping epitopes within the 38 kDa BDP defined by amino acids 60-383 of SEQ ID NO:2 using routine techniques known in the art.
- antibodies can be selected which similarly may assist with maintaining the dynamic range and low end sensitivity' of the immunoassays.
- first antibody such as a capture antibody
- second antibody such as a detection antibody
- GFAP antibodies have been described in the literature and are commercially available.
- the antibody is an antibody that binds to GFAP, a fragment thereof, an epitope of GFAP, or a variant thereof.
- the antibody may be a fragment of the anti-GFAP antibody or a variant or a derivative thereof.
- the antibody may be a polyclonal or monoclonal antibody.
- the antibody may be a chimeric antibody, a single chain antibody, an affinity matured antibody, a human antibody, a humanized antibody, a fully human antibody or an antibody fragment, such as a Fab fragment, or a mixture thereof.
- Antibody fragments or derivatives may comprise F(ab’) 2 , Fv or scFv fragments.
- the antibody derivatives can be produced by peptidomimetics. Further, techniques described for the production of single chain antibodies can be adapted to produce single chain antibodies.
- the anti-GFAP antibodies may be a chimeric anti-GFAP or humanized anti-GFAP antibody.
- both the humanized antibody and chimeric antibody are monovalent.
- both the humanized antibody and chimeric antibody comprise a single Fab region linked to an Fc region.
- Human antibodies may be derived from phage-display technology or from transgenic mice that express human immunoglobulin genes.
- the human antibody may be generated as a result of a human in vivo immune response and isolated. See, for example, Funaro et al., BMC Biotechnology, 2008(8):85. Therefore, the antibody may be a product of the human and not animal repertoire. Because it is of human origin, the risks of reactivity against self-antigens may be minimized.
- standard yeast display libraries and display technologies may be used to select and isolate human anti-GFAP antibodies. For example, libraries of naive human single chain variable fragments (scFv) may be used to select human anti-GFAP antibodies.
- Transgenic animals may be used to express human antibodies.
- Humanized antibodies may be antibody molecules from non-human species antibody that binds the desired antigen having one or more complementarity determining regions (CDRs) from the non-human species and framework regions from a human immunoglobulin molecule.
- CDRs complementarity determining regions
- the antibody is distinguishable from known antibodies in that it possesses different biological fimction(s) than those known in the art. i. Epitope
- the antibody may immunospecifically bind to GFAP (SEQ ID NO: 2), a fragment thereof, or a variant thereof.
- the antibody may immunospecifically recognize and bind at least three amino acids, at least four amino acids, at least five amino acids, at least six amino acids, at least seven amino acids, at least eight amino acids, at least nine amino acids, or at least ten amino acids within an epitope region.
- the antibody may immunospecifically recognize and bind to an epitope that has at least three contiguous amino acids, at least four contiguous amino acids, at least five contiguous amino acids, at least six contiguous amino acids, at least seven contiguous amino acids, at least eight contiguous amino acids, at least nine contiguous amino acids, or at least ten contiguous amino acids of an epitope region.
- Anti-GFAP antibodies may be generated using the techniques described herein as well as using routine techniques known in the art.
- the anti-GFAP antibody may be an unconjugated GFAP antibody, such as GFAP antibodies available ftom Dako (Catalog Number: M0761), ThermoFisher Scientific (Catalog Numbers: MA5-12023, A-21282, 13-0300, MAI-19170, MAI-19395, MA5-15086, MA5-16367, MAI-35377, MA1- 06701, or MAI-20035), AbCam (Catalog Numbers: ab!0062, ab4648, ab68428, ab33922, ab207165, abl 90288, abl 15898, orab21837), EMD Millipore (Catalog Numbers: FCMAB257P, MAB360, MAB3402, 04-1031, 04-1062, MAB5628), Santa Cruz (Catalog Numbers: sc-166481, sc-1664
- the anti-GFAP antibody may be conjugated to a fluorophore, such as conjugated GFAP antibodies available ftom ThermoFisher Scientific (Catalog Numbers: A-21295 or A-21294), EMD Millipore (Catalog Numbers: MAB3402X, MAB3402B, MAB3402B, or MAB3402C3) or AbCam (Catalog Numbers: ab49874 or abl94325).
- conjugated GFAP antibodies available ftom ThermoFisher Scientific (Catalog Numbers: A-21295 or A-21294), EMD Millipore (Catalog Numbers: MAB3402X, MAB3402B, MAB3402B, or MAB3402C3) or AbCam (Catalog Numbers: ab49874 or abl94325).
- Other GFAP antibodies that can be used in the methods described herein include those described in WO 2018/081649, the contents of which are herein incorporated by reference.
- Antibodies may be prepared by any of a variety of techniques, including those well known to those skilled in the art.
- antibodies can be produced by cell culture techniques, including the generation of monoclonal antibodies via conventional techniques, or via transfection of antibody genes, heavy chains, and/or light chains into suitable bacterial or mammalian cell hosts, in order to allow for the production of antibodies, wherein the antibodies may be recombinant.
- the various forms of the term "transfection" are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, calcium-phosphate precipitation, DEAE-dextran transfection and the like.
- eukaryotic cells Although it is possible to express the antibodies in either prokaryotic or eukaryotic host cells, expression of antibodies in eukaryotic cells is preferable, and most preferable in mammalian host cells, because such eukaryotic cells (and in particular mammalian cells) are more likely than prokaryotic cells to assemble and secrete a properly folded and immunologically active antibody.
- Exemplary mammalian host cells for expressing the recombinant antibodies include Chinese Hamster Ovary (CHO cells) (including dhfr-CHO cells, described in Urlaub and Chasin, Proc. Natl Acad. Sci. USA, 77: 4216-4220 (1980)), used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp, J. Mol. Biol., 159: 601-621 (1982), NSO myeloma cells, COS cells, and SP2 cells.
- the antibodies When recombinant expression vectors encoding antibody genes are introduced into mammalian host cells, the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown. Antibodies can be recovered from the culture medium using standard protein purification methods.
- Host cells can also be used to produce functional antibody fragments, such as Fab fragments or scFv molecules. It will be understood that variations on the above procedure may be performed. For example, it may be desirable to transfect a host cell with DNA encoding functional fragments of either the light chain and/or the heavy chain of an antibody. Recombinant DNA technology may also be used to remove some, or all, of the DNA encoding either or both of the light and heavy chains that is not necessary for binding to the antigens of interest. The molecules expressed from such truncated DNA molecules are also encompassed by the antibodies.
- bifunctional antibodies may be produced in which one heavy- and one light chain are an antibody (i.e., binds an analyte, e.g., human troponin I, UCH-L1, or GFAP) and the other heavy and light chain are specific for an antigen other than the analyte by crosslinking an antibody to a second antibody by standard chemical crosslinking methods.
- analyte e.g., human troponin I, UCH-L1, or GFAP
- a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain is introduced into dhfr-CHO cells by calcium phosphate- mediated transfection.
- the antibody heavy and light chain genes are each operatively linked to CMV enhancer/AdMLP promoter regulatory elements to drive high levels of transcription of the genes.
- the recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate sei ection/amplifi cation.
- the selected transformant host cells are cultured to allow for expression of the antibody heavy and tight chains and intact antibody is recovered from the culture medium.
- Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells, and recover the antibody from the culture medium.
- the method of synthesizing a recombinant antibody may be by culturing a host cell in a suitable culture medium until a recombinant antibody is synthesized. The method can further comprise isolating the recombinant antibody from the culture medium.
- Methods of preparing monoclonal antibodies involve the preparation of immortal cell lines capable of producing antibodies having the desired specificity.
- Such cell lines may be produced from spleen cells obtained from an immunized animal.
- the animal may be immunized with the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) or a fragment and/or variant thereof.
- the peptide used to immunize the animal may comprise amino acids encoding human Fc, for example the fragment crystallizable region or tail region of human antibody.
- the spleen cells may then be immortalized by, for example, fusion with a myeloma cell fusion partner. A variety of fusion techniques may be employed.
- the spleen cells and myeloma cells may be combined with a nonionic detergent for a few minutes and then plated at low density on a selective medium that supports that growth of hybrid cells, but not myeloma cells.
- a nonionic detergent for a few minutes and then plated at low density on a selective medium that supports that growth of hybrid cells, but not myeloma cells.
- One such technique uses hypoxanthine, aminopterin, thymidine (HAT) selection.
- Another technique includes electrofusion. After a sufficient time, usually about 1 to 2 weeks, colonies of hybrids are observed. Single colonies are selected and their culture supernatants tested for binding activity against the polypeptide. Hybridomas having high reactivity and specificity' may be used.
- Monoclonal antibodies may be isolated from the supernatants of growing hybridoma colonies.
- various techniques may be employed to enhance the yield, such as injection of the hybridoma cell line into the peritoneal cavity of a suitable vertebrate host, such as a mouse.
- Monoclonal antibodies may then be harvested from the ascites fluid or the blood.
- Contaminants may be removed from the antibodies by conventional techniques, such as chromatography, gel filtration, precipitation, and extraction. Affinity' chromatography is an example of a method that can be used in a process to purify the antibodies.
- the proteolytic enzyme papain preferentially cleaves IgG molecules to yield several fragments, two of which (the F(ab) fragments) each comprise a covalent heterodimer that includes an intact antigen-binding site.
- the enzyme pepsin is able to cleave IgG molecules to provide several fragments, including the F(ab’)z fragment, which comprises both antigen-binding sites.
- the Fv fragment can be produced by preferential proteolytic cleavage of an IgM, and on rare occasions IgG or IgA immunoglobulin molecules.
- the Fv fragment may be derived using recombinant techniques.
- the Fv fragment includes a non-covalent VH::VL heterodimer including an antigen-binding site that retains much of the antigen recognition and binding capabilities of the native antibody molecule.
- the antibody, antibody fragment, or derivative may comprise a heavy chain and a light chain complementarity determining region (“CDR”) set, respectively interposed between a heavy chain and a light chain framework (“FR”) set which provide support to the CDRs and define the spatial relationship of the CDRs relative to each other.
- the CDR set may contain three hypervariable regions of a heavy or light chain V region.
- Suitable methods of producing or isolating antibodies of the requisite specificity can be used, including, but not limited to, methods that select recombinant antibody from a peptide or protein library (e.g., but not limited to, a bacteriophage, ribosome, oligonucleotide, RNA, cDNA, yeast or the like, display library); e.g., as available from various commercial vendors such as Cambridge Antibody Technologies (Cambridgeshire, UK), MorphoSys (Martinsreid/Planegg, Del.), Biovation (Aberdeen, Scotland, UK) BioInvent (Lund, Sweden), using methods known in the art. See U.S. Patent Nos.
- An affinity matured antibody may be produced by any one of a number of procedures that are known in the art. For example, see Marks et al., BioTechnology, 10: 779- 783 (1992) describes affinity maturation by VH and VL domain shuffling. Random mutagenesis of CDR and/or framework residues is described by Barbas et al., Proc. Nat. Acad. Set. USA, 91: 3809-3813 (1994); Schier et al., Gene, 169: 147-155 (1995); Yelton et al., J. Immunol., 155: 1994-2004 (1995); Jackson et al., J.
- Antibody variants can also be prepared using delivering a polynucleotide encoding an antibody to a suitable host such as to provide transgenic animals or mammals, such as goats, cows, horses, sheep, and the like, that produce such antibodies in their milk. These methods are known in the art and are described for example in U.S. Patent Nos. 5,827,690; 5,849,992; 4,873,316; 5,849,992; 5,994,616; 5,565,362; and 5,304,489.
- Antibody variants also can be prepared by delivering a polynucleotide to provide transgenic plants and cultured plant cells (e.g., but not limited to tobacco, maize, and duckweed) that produce such antibodies, specified portions or variants in the plant parts or in cells cultured therefrom.
- plant cells e.g., but not limited to tobacco, maize, and duckweed
- Transgenic maize has been used to express mammalian proteins at commercial production levels, with biological activities equivalent to those produced in other recombinant systems or purified from natural sources. See, e.g.. Hood et al., Adv. Exp. Med. Biol. (1999) 464: 127- 147 and references cited therein.
- Antibody variants have also been produced in large amounts from transgenic plant seeds including antibody fragments, such as single chain antibodies (scFv's), including tobacco seeds and potato tubers. See, e.g., Conrad et al. (1998) Plant Mol. Biol. 38: 101-109 and reference cited therein.
- scFv's single chain antibodies
- Antibody derivatives can be produced, for example, by adding exogenous sequences to modify immunogenicity' or reduce, enhance or modify binding, affinity, on-rate, off-rate, avidity, specificity, half-life, or any other suitable characteristic. Generally, part or all of the non-human or human CDR sequences are maintained while the non-human sequences of the variable and constant regions are replaced with human or other amino acids.
- Small antibody fragments may be diabodies having two antigen-binding sites, wherein fragments comprise a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (VH VL).
- the antibodies may be recovered and purified from recombinant cell cultures by known methods including, but not limited to, protein A purification, ammonium sulfide or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography.
- High performance liquid chromatography HPLC can also be used for purification.
- antibodies can be labeled with a detectable moiety such as a radioactive atom, a chromophore, a fluorophore, or the like.
- a detectable moiety such as a radioactive atom, a chromophore, a fluorophore, or the like.
- Such labeled antibodies can be used for diagnostic techniques, either in vivo, or in an isolated test sample. They can be linked to a cytokine, to a ligand, to another antibody.
- Suitable agents for coupling to antibodies to achieve an anti- tumor effect include cytokines, such as interleukin 2 (IL-2) and Tumor Necrosis Factor (TNF); photosensitizers, for use in photodynamic therapy, including aluminum (Hl) phthalocyanine tetrasulfonate, hematoporphyrin, and phthalocyanine; radionuclides, such as iodine-131 (1311), yttrium-90 (90Y), bismuth-212 (212Bi), bismuth-213 (213Bi), technetium- 99m (99mTc), rhenium-186 (186Re), and rhenium-188 (188Re); antibiotics, such as doxorubicin, adriamycin, daunorubicin, methotrexate, daunomycin, neocarzinostatin, and carboplatin; bacterial, plant, and other toxins, such as diphtheria toxin, pseudo
- Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof.
- monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow et al., Antibodies: A Laboratory Manual, second edition, (Cold Spring Harbor Laboratory' Press, Cold Spring Harbor, 1988); Hammerling, et al., In Monoclonal Antibodies and T-Cell Hybridomas, (Elsevier, N. Y., 1981).
- monoclonal antibody as used herein is not limited to antibodies produced through hybridoma technology.
- monoclonal antibody refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
- Methods of generating monoclonal antibodies as well as antibodies produced by the method may comprise culturing a hybridoma cell secreting an antibody wherein, preferably, the hybridoma is generated by fusing splenocytes isolated from an animal, e.g., a rat or a mouse, immunized with the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) with myeloma cells and then screening the hybridomas resulting from the fusion for hybridoma clones that secrete an antibody able to bind a polypeptide.
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- rats can be immunized with an analyte (e.g., GFAP, UCH-Ll or GFAP and UCH-L1) antigen.
- an analyte e.g., GFAP, UCH-Ll or GFAP and UCH-L1
- the analyte e.g., GFAP, UCH-Ll or GFAP and UCH-Ll
- an adjuvants include complete or incomplete Freund's adjuvant, RIBI (muramyl dipeptides) or ISCOM (immunostimulating complexes).
- Such adjuvants may protect the polypeptide from rapid dispersal by sequestering it in a local deposit, or they may contain substances that stimulate the host to secrete factors that are chemotactic for macrophages and other components of the immune system.
- the immunization schedule will involve two or more administrations of the polypeptide, spread out over several weeks; however, a single administration of the polypeptide may also be used.
- antibodies and/or antibody-producing cells may be obtained from the animal.
- An anti-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) antibody-containing serum is obtained from the animal by bleeding or sacrificing the animal.
- the serum may be used as it is obtained from the animal, an immunoglobulin fraction may be obtained from the serum, or the anti-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) antibodies may be purified from the serum.
- Serum or immunoglobulins obtained in this manner are polyclonal, thus having a heterogeneous array of properties.
- rat spleen is harvested and splenocytes isolated.
- the splenocytes are then fused by well-known techniques to any suitable myeloma cells, for example, cells from cell line SP20 available from the American Type Culture Collection (ATCC, Manassas, Va., US). Hybridomas are selected and cloned by limited dilution.
- hybridoma clones are then assayed by methods known in the art for cells that secrete antibodies capable of binding the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1). Ascites fluid, which generally contains high levels of antibodies, can be generated by immunizing rats with positive hybridoma clones.
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- Ascites fluid which generally contains high levels of antibodies, can be generated by immunizing rats with positive hybridoma clones.
- antibody-producing immortalized hybridomas may be prepared from the immunized animal. After immunization, the animal is sacrificed and the splenic B cells are fused to immortalized myeloma cells as is well known in the art. See, e.g., Harlow and Lane, supra. In a preferred embodiment, the myeloma cells do not secrete immunoglobulin polypeptides (a non-secretory cell line).
- the hybridomas are screened using the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1), or a portion thereof, or a cell expressing the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- the initial screening is performed using an enzyme-linked immunosorbent assay (ELISA) or a radioimmunoassay (RIA), preferably an ELISA.
- ELISA enzyme-linked immunosorbent assay
- RIA radioimmunoassay
- Anti-analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- Anti-analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- Hybridomas may be cultured and expanded in vivo in syngeneic animals, in animals that lack an immune system, e.g., nude mice, or in cell culture in vitro. Methods of selecting, cloning and expanding hybridomas are well known to those of ordinary skill in the art.
- hybridomas are rat hybridomas.
- hybridomas are produced in a non-human, non-rat species such as mice, sheep, pigs, goats, cattle, or horses.
- the hybridomas are human hybridomas, in which a human non-secretory myeloma is fused with a human cell expressing an anti-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) antibody.
- an anti-analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- Antibody fragments that recognize specific epitopes may be generated by known techniques.
- Fab and F(ab') 2 fragments may be produced by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce two identical Fab fragments) or pepsin (to produce an F(ab') 2 fragment).
- a F(ab') 2 fragment of an IgG molecule retains the two antigen-binding sites of the larger ("parent") IgG molecule, including both tight chains (containing the variable light chain and constant tight chain regions), the CHI domains of the heavy chains, and a disulfide-forming hinge region of the parent IgG molecule. Accordingly, an F(ab') 2 fragment is still capable of crosslinking antigen molecules like the parent IgG molecule.
- recombinant antibodies are generated from single, isolated lymphocytes using a procedure referred to in the art as the selected lymphocyte antibody method (SLAM), as described in U.S. Patent No. 5,627,052; PCT Publication No. WO 92/02551; and Babcook et al., Proc. Natl. Acad. Set. USA, 93: 7843-7848 (1996).
- SAM selected lymphocyte antibody method
- single cells secreting antibodies of interest e.g., lymphocytes derived from any one of the immunized animals are screened using an antigen-specific hemolytic plaque assay, wherein the antigen analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1), a subunit of the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1), or a fragment thereof, is coupled to sheep red blood cells using a tinker, such as biotin, and used to identify single cells that secrete antibodies with specificity for the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH- Ll).
- the antigen analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- a subunit of the analyte e.g., GFAP, UCH-L1 or
- variable region cDNAs are rescued from the cells by reverse transcriptase-PCR (RT-PCR) and these variable regions can then be expressed, in the context of appropriate immunoglobulin constant regions (e.g., human constant regions), in mammalian host cells, such as COS or CHO cells.
- the host cells transfected with the amplified immunoglobulin sequences, derived from in vivo selected lymphocytes, can then undergo further analysis and selection in vitro, for example, by panning the transfected cells to isolate cells expressing antibodies to the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1 ).
- the amplified immunoglobulin sequences further can be manipulated in vitro, such as by in vitro affinity maturation method. See, for example, PCT Publication No. WO 97/29131 and PCT Publication No. WO 00/56772.
- the XENOMOUSE® transgenic mouse contains approximately 80% of the human antibody repertoire through introduction of megabase sized, germline configuration YAC fragments of the human heavy chain loci and x light chain loci. See Mendez et al., Nature Genetics, 15: 146-156 (1997), Green and Jakobovits, J. Exp. Med., 188: 483-495 (1998), the disclosures of which are hereby incorporated by reference.
- an antibody library' is screened to identify an antibody having the desired analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-Ll)-binding specificity.
- desired analyte e.g., GFAP, UCH-L1 or GFAP and UCH-Ll
- Methods for such screening of recombinant antibody libraries are well known in the art and include methods described in, for example, U.S. Patent No. 5,223,409 (Ladner et al.); PCT Publication No. WO 92/18619 (Kang et al.); PCT Publication No. WO 91/17271 (Dower et al.); PCT Publication No.
- WO 92/20791 (Winter et al.); PCT Publication No. WO 92/15679 (Markland et al.); PCT Publication No. WO 93/01288 (Breitling et al.); PCT Publication No. WO 92/01047 (McCafferty' et al.); PCT Publication No. WO 92/09690 (Garrard et al.); Fuchs et al., Bio/Technology, 9: 1369-1372 (1991); Hay et al., Hum. Antibod.
- Hybridomas 3: 81-85 (1992); Huse et al., Science, 246: 1275-1281 (1989); McCafferty et al., Nature, 348: 552-554 (1990); Griffiths et al., EMBO J., 12: 725-734 (1993); Hawkins et al., J. Mol. Biol., 226: 889-896 (1992); Clackson et al., Nature, 352: 624-628 (1991); Gram et al., Proc. Natl. Acad. Set.
- the recombinant antibody library' may be from a subject immunized with the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1), or a portion of the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- a portion of the analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- the recombinant antibody library may be from a naive subject, i.e., one who has not been immunized with the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1), such as a human antibody library from a human subject who has not been immunized with human analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- a naive subject i.e., one who has not been immunized with the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- the analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- Antibodies are selected by screening the recombinant antibody library with the peptide comprising human analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) to thereby select those antibodies that recognize the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1). Methods for conducting such screening and selection are well known in the art, such as described in the references in the preceding paragraph.
- human analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- the art-known method of surface plasmon resonance can be used to select antibodies having the desired Kofi rate constant.
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- standard methods known in the art for assessing the inhibition of the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) activity may be used.
- the disclosure pertains to an isolated antibody, or an antigen-binding portion thereof, that binds human analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- human analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1.
- the antibody is a neutralizing antibody.
- the antibody is a recombinant antibody or a monoclonal antibody.
- antibodies can also be generated using various phage display methods known in the art.
- phage display methods functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them.
- Such phage can be utilized to display antigen-binding domains expressed from a repertoire or combinatorial antibody library (e.g., human or murine).
- Phage expressing an antigen binding domain that binds the antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead.
- Phage used in these methods are typically filamentous phage including fd and M13 binding domains expressed from phage with Fab, Fv, or disulfide stabilized Fv antibody domains recombinantly fused to either the phage gene in or gene Vin protein.
- Examples of phage display methods that can be used to make the antibodies include those disclosed in Brinkmann et al., J. Immunol. Methods, 182: 41-50 (1995); Ames et al., J. Immunol. Methods, 184:177-186 (1995); Kettleborough et al., Eur. J.
- the antibody coding regions from the phage can be isolated and used to generate whole antibodies including human antibodies or any other desired antigen binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described in detail below.
- techniques to recombinantly produce Fab, Fab', and F(ab') 2 fragments can also be employed using methods known in the art such as those disclosed in PCT publication No. WO 92/22324; Mullinax et al., BioTechniques, 12(6): 864- 869 (1992); Sawai et al., Am. J. Reprod.
- a covalent fusion is created between an mRNA and the peptide or protein that it encodes by in vitro translation of synthetic mRNAs that carry puromycin, a peptidyl acceptor antibiotic, at their 3' end.
- a specific mRNA can be enriched from a complex mixture of mRNAs (e.g., a combinatorial library) based on the properties of the encoded peptide or protein, e.g., antibody, or portion thereof, such as binding of the antibody, or portion thereof, to the dual specificity antigen.
- Nucleic acid sequences encoding antibodies, or portions thereof, recovered from screening of such libraries can be expressed by recombinant means as described above (e.g., in mammalian host cells) and, moreover, can be subjected to further affinity maturation by either additional rounds of screening of mRNA-peptide fusions in which mutations have been introduced into the originally selected sequence(s), or by other methods for affinity maturation in vitro of recombinant antibodies, as described above.
- a preferred example of this methodology- is PROfusion display technology.
- the antibodies can also be generated using yeast displaymethods known in the art.
- yeast display methods genetic methods are used to tether antibody domains to the yeast cell wall and display them on the surface of yeast.
- yeast can be utilized to display antigen-binding domains expressed from a repertoire or combinatorial antibody library- (e.g., human or murine).
- yeast display methods that can be used to make the antibodies include those disclosed in U.S. Patent No. 6,699,658 (Wittrup etal.) incorporated herein by reference.
- Antibodies may be produced by any of a number of techniques known in the art. For example, expression from host cells, wherein expression vectors) encoding the heavy and light chains is (are) transfected into a host cell by standard techniques.
- the various forms of the term "transfection" are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, calcium-phosphate precipitation, DEAE-dextran transfection, and the like.
- eukaryotic cells Although it is possible to express the antibodies in either prokaryotic or eukaryotic host cells, expression of antibodies in eukaryotic cells is preferable, and most preferable in mammalian host cells, because such eukaryotic cells (and in particular mammalian cells) are more likely than prokaryotic cells to assemble and secrete a properly folded and immunologically active antibody.
- Exemplary mammalian host cells for expressing the recombinant antibodies include Chinese Hamster Ovary- (CHO cells) (including dhfr-CHO cells, described in Uriaub and Chasin, Proc. Natl. Acad. Set. USA, 77: 4216-4220 (1980), used with a DHFR selectable marker, e.g., as described in Kaufinan and Sharp, J. Mol. Biol., 159: 601-621 (1982), NS0 myeloma cells, COS cells, and SP2 cells.
- Chinese Hamster Ovary- CHO cells
- dhfr-CHO cells described in Uriaub and Chasin, Proc. Natl. Acad. Set. USA, 77: 4216-4220 (1980
- a DHFR selectable marker e.g., as described in Kaufinan and Sharp, J. Mol. Biol., 159: 601-621 (1982
- NS0 myeloma cells COS cells
- the antibodies When recombinant expression vectors encoding antibody genes are introduced into mammalian host cells, the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or, more preferably, secretion of the antibody into the culture medium in which the host cells are grown. Antibodies can be recovered from the culture medium using standard protein purification methods.
- Host cells can also be used to produce functional antibody fragments, such as Fab fragments or scFv molecules. It will be understood that variations on the above procedure may be performed. For example, it may be desirable to transfect a host cell with DNA encoding functional fragments of either the light chain and/or the heavy chain of an antibody. Recombinant DNA technology may also be used to remove some, or all, of the DNA encoding either or both of the light and heavy chains that is not necessary for binding to the antigens of interest. The molecules expressed from such truncated DNA molecules are also encompassed by the antibodies.
- bifunctional antibodies may be produced in which one heavy and one light chain are an antibody (i.e., binds human analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1)) and the other heavy and light chain are specific for an antigen other than human analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) by crosslinking an antibody to a second antibody by standard chemical crosslinking methods.
- human analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- an antigen other than human analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- a recombinant expression vector encoding both the antibody heavy chain and the antibody light chain is introduced into dhfr-CHO cells by calcium phosphate- mediated transfection.
- the antibody heavy and light chain genes are each operatively linked to CMV enhancer/AdMLP promoter regulatory elements to drive high levels of transcription of the genes.
- the recombinant expression vector also carries a DHFR gene, which allows for selection of CHO cells that have been transfected with the vector using methotrexate sei ection/amplifi cation.
- the selected transformant host cells are cultured to allow for expression of the antibody heavy and fight chains and intact antibody is recovered from the culture medium.
- Standard molecular biology techniques are used to prepare the recombinant expression vector, transfect the host cells, select for transformants, culture the host cells, and recover the antibody from the culture medium.
- the disclosure provides a method of synthesizing a recombinant antibody by culturing a host cell in a suitable culture medium until a recombinant antibody is synthesized. The method can further comprise isolating the recombinant antibody from the culture medium.
- the humanized antibody may be an antibody or a variant, derivative, analog or portion thereof which immunospecifically binds to an antigen of interest and which comprises a framework (FR) region having substantially the amino acid sequence of a human antibody and a complementary determining region (CDR) having substantially the amino acid sequence of a non-human antibody.
- the humanized antibody may be from a non-human species antibody that binds the desired antigen having one or more complementarity determining regions (CDRs) from the non-human species and framework regions from a human immunoglobulin molecule.
- the term "substantially" in the context of a CDR refers to a CDR having an amino acid sequence at least 90%, at least 95%, at least 98% or at least 99% identical to the amino acid sequence of a non-human antibody CDR.
- a humanized antibody comprises substantially all of at least one, and typically two, variable domains (Fab, Fab', F(ab') 2 , FabC, Fv) in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin (i.e., donor antibody) and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence.
- a humanized antibody also comprises at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- a humanized antibody contains both the light chain as well as at least the variable domain of a heavy chain.
- the antibody also may include the CHI, hinge, CH2, CH3, and CH4 regions of the heavy chain.
- a humanized antibody only contains a humanized light chain.
- a humanized antibody only contains a humanized heavy chain.
- a humanized antibody only contains a humanized variable domain of a light chain and/or of a heavy chain.
- the humanized antibody can be selected from any class of immunoglobulins, including IgM, IgG, IgD, IgA and IgE, and any isotype, including without limitation IgG 1, IgG2, IgG3, and IgG4.
- the humanized antibody may comprise sequences from more than one class or isotype, and particular constant domains may be selected to optimize desired effector functions using techniques well-known in the art.
- the framework and CDR regions of a humanized antibody need not correspond precisely to the parental sequences, e.g., the donor antibody CDR or the consensus framework may be mutagenized by substitution, insertion and/or deletion of at least one amino acid residue so that the CDR or framework residue at that site does not correspond to either the donor antibody or the consensus framework. In one embodiment, such mutations, however, will not be extensive. Usually, at least 90%, at least 95%, at least 98%, or at least 99% of the humanized antibody residues will correspond to those of the parental FR and CDR sequences.
- the term "consensus framework" refers to the framework region in the consensus immunoglobulin sequence.
- the term "consensus immunoglobulin sequence” refers to the sequence formed from the most frequently occurring amino acids (or nucleotides) in a family of related immunoglobulin sequences (See e.g., Winnaker, From Genes to Clones (Verlagsgesellschaft, Weinheim, Germany 1987)). In a family of immunoglobulins, each position in the consensus sequence is occupied by the amino acid occurring most frequently at that position in the family. If two amino acids occur equally frequently, either can be included in the consensus sequence.
- the humanized antibody may be designed to minimize unwanted immunological response toward rodent anti-human antibodies, which limits the duration and effectiveness of therapeutic applications of those moieties in human recipients.
- the humanized antibody may have one or more amino acid residues introduced into it from a source that is non-human.
- non-human residues are often referred to as “import” residues, which are typically taken from a variable domain.
- Humanization may be performed by substituting hypervariable region sequences for the corresponding sequences of a human antibody.
- “humanized” antibodies are chimeric antibodies wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence ftom a non-human species.
- the humanized antibody may be a human antibody in which some hypervariable region residues, and possibly some FR residues are substituted by residues ftom analogous sites in rodent antibodies.
- Humanization or engineering of antibodies of the present disclosure can be performed using any known method, such as but not limited to those described in U.S. Patent Nos. 5,723,323; 5,976,862; 5,824,514; 5,817,483; 5,814,476; 5,763,192; 5,723,323; 5,766,886; 5,714,352; 6,204,023; 6,180,370; 5,693,762; 5,530,101; 5,585,089; 5,225,539; and 4,816,567.
- the humanized antibody may retain high affinity for the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) and other favorable biological properties.
- the humanized antibody may be prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available. Computer programs are available that illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen.
- FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristics, such as increased affinity for the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1), is achieved.
- the hypervariable region residues may be directly and most substantially involved in influencing antigen binding.
- human antibodies can be generated.
- transgenic animals e.g., mice that are capable, upon immunization, of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production.
- JH antibody heavy-chain joining region
- the humanized or fully human antibodies may be prepared according to the methods described in U.S. Patent Nos. 5,770,429; 5,833,985; 5,837,243; 5,922,845; 6,017,517; 6,096,311; 6,111,166; 6,270,765; 6,303,755; 6,365,116; 6,410,690; 6,682,928; and 6,984,720, the contents each of which are herein incorporated by reference.
- GFAP analyte of interest
- UCH-L1 or GFAP and UCH-L1 analyte of interest
- the methods may also be adapted in view of other methods for analyzing analytes.
- immunoassay such as sandwich immunoassay (e.g., monoclonal-monoclonal sandwich immunoassays, monoclonal- polyclonal sandwich immunoassays, including enzyme detection (enzyme immunoassay (EIA) or enzyme-linked immunosorbent assay (ELISA), competitive inhibition immunoassay (e.g., forward and reverse), enzyme multiplied immunoassay technique (EMIT), a competitive binding assay, bioluminescence resonance energy transfer (BRET), one-step antibody detection assay, homogeneous assay, heterogeneous assay, capture on the fly assay, single molecule detection assay, etc.
- sandwich immunoassay e.g., monoclonal-monoclonal sandwich immunoassays, monoclonal- polyclonal sandwich immunoassays, including enzyme detection (enzyme immunoassay (EIA) or enzyme-linked immunosorb
- the analyte of interest, and/or peptides of fragments thereof may be analyzed using GFAP, UCH-L1 or GFAP and UCH-L1 antibodies in an immunoassay.
- the presence or amount of analyte can be determined using antibodies and detecting specific binding to the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- the antibody, or antibody fragment thereof may specifically bind to the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- one or more of the antibodies can be used in combination with one or more commercially available monoclonal/polyclonal antibodies. Such antibodies are available from companies such as R&D Systems, Inc. (Minneapolis, MN) and Enzo Life Sciences International, Inc. (Plymouth Meeting, PA).
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- an immunoassay such as sandwich immunoassay (e.g., monoclonal-monoclonal sandwich immunoassays, monoclonal- polyclonal sandwich immunoassays, including radioisotope detection (radioimmunoassay (RIA)) and enzyme detection (enzyme immunoassay (EIA) or enzyme-linked immunosorbent assay (ELISA) (e.g., Quantikine ELISA assays, R&D Systems, Minneapolis, MN)).
- sandwich immunoassay e.g., monoclonal-monoclonal sandwich immunoassays, monoclonal- polyclonal sandwich immunoassays, including radioisotope detection (radioimmunoassay (RIA)) and enzyme detection (enzyme immunoassay (EIA) or enzyme-linked immunosorbent assay (
- a point-of-care device that can be used is i-STAT® (Abbott, Laboratories, Abbott Park, IL).
- Other methods that can be used include a chemiluminescent microparticle immunoassay, in particular one employing the ARCHI TECT® automated analyzer (Abbott Laboratories, Abbott Park, IL), as an example.
- Other methods include, for example, mass spectrometry, and immunohistochemistry (e.g., with sections from tissue biopsies), using anti-analyte (e.g., anti-UCH-Ll and/or anti-GFAP) antibodies (monoclonal, polyclonal, chimeric, humanized, human, etc.) or antibody fragments thereof against analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- anti-analyte e.g., anti-UCH-Ll and/or anti-GFAP
- antibodies monoclonal, polyclonal, chimeric, humanized, human, etc.
- antibody fragments thereof against analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- Other methods of detection include those described in, for example, U.S. Patent Nos.
- immobilized antibodies or antibody fragments thereof may be incorporated into the immunoassay.
- the antibodies may be immobilized onto a variety of supports, such as magnetic or chromatographic matrix particles, the surface of an assay plate (such as microtiter wells), pieces of a solid substrate material, and the like.
- An assay strip can be prepared by coating the antibody or plurality of antibodies in an array on a solid support. This strip can then be dipped into the test sample and processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot.
- a homogeneous format may be used. For example, after the test sample is obtained from a subject, a mixture is prepared. The mixture contains the test sample being assessed for analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1), a first specific binding partner, and a second specific binding partner. The order in which the test sample, the first specific binding partner, and the second specific binding partner are added to form the mixture is not critical. The test sample is simultaneously contacted with the first specific binding partner and the second specific binding partner.
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- the order in which the test sample, the first specific binding partner, and the second specific binding partner are added to form the mixture is not critical.
- the test sample is simultaneously contacted with the first specific binding partner and the second specific binding partner.
- the first specific binding partner and any GFAP, UCH-L1 or GFAP and UCH-L1 contained in the test sample may form a first specific binding partner-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-Ll)-antigen complex and the second specific binding partner may form a first specific binding partner-analyte of interest (e.g., GFAP, UCH-L1 or GFAP and UCH-Ll)-second specific binding partner complex.
- a first specific binding partner-analyte e.g., GFAP, UCH-L1 or GFAP and UCH-Ll
- the second specific binding partner and any GFAP, UCH-L1 or GFAP and UCH-Llcontained in the test sample may form a second specific binding partner-analyte (e.g., UCH-Ll)-antigen complex and the first specific binding partner may form a first specific binding partner-analyte of interest (e.g., GFAP, UCH-L1 or GFAP and UCH-Ll)-second specific binding partner complex.
- a second specific binding partner-analyte e.g., UCH-Ll
- first specific binding partner-analyte of interest e.g., GFAP, UCH-L1 or GFAP and UCH-Ll
- the first specific binding partner may be an anti-analyte antibody (e.g., anti-UCH-Ll antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 1 or anti-GFAP antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 2).
- anti-analyte antibody e.g., anti-UCH-Ll antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 1
- anti-GFAP antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 2
- the second specific binding partner may be an anti-analyte antibody (e.g., anti-UCH-Ll antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous [3] amino acids of SEQ ID NO: 1 or anti-GFAP antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 2).
- the second specific binding partner is labeled with or contains a detectable label as described above.
- a heterogeneous format may be used. For example, after the test sample is obtained from a subject, a first mixture is prepared.
- the mixture contains the test sample being assessed for analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) and a first specific binding partner, wherein the first specific binding partner and any GFAP, UCH-L1 or GFAP and UCH-L1 contained in the test sample form a first specific binding partner-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-Ll)-antigen complex.
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- a first specific binding partner-analyte e.g., GFAP, UCH-L1 or GFAP and UCH-Ll
- the first specific binding partner may be an anti-analyte antibody (e.g., anti-UCH-Ll antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 1 or anti-GFAP antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 2).
- anti-analyte antibody e.g., anti-UCH-Ll antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 1
- anti-GFAP antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 2
- the order in which the test sample and the first specific binding partner are added to form the mixture is not critical.
- the first specific binding partner may be immobilized on a solid phase.
- the solid phase used in the immunoassay can be any solid phase known in the art, such as, but not limited to, a magnetic particle, a bead, a test tube, a microtiter plate, a cuvette, a membrane, a scaffolding molecule, a film, a filter paper, a disc, and a chip.
- the bead may be a magnetic bead or a magnetic particle.
- Magnetic beads/particles may be ferromagnetic, ferrimagnetic, paramagnetic, superparamagnetic or ferrofluidic.
- Exemplary ferromagnetic materials include Fe, Co, Ni, Gd, Dy, CrOz, MnAs, MnBi, EuO, and NiO/Fe.
- Examples of ferrimagnetic materials include NiFerOt, CoFezO4, FeaO4 (or FeO-FezOs).
- Beads can have a solid core portion that is magnetic and is surrounded by one or more non-magnetic layers. Alternately, the magnetic portion can be a layer around a non-magnetic core.
- the solid support on which the first specific binding member is immobilized may be stored in dry form or in a liquid.
- the magnetic beads may be subjected to a magnetic field prior to or after contacting with the sample with a magnetic bead on which the first specific binding member is immobilized.
- any unbound analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- any unbound analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- the unbound analyte can be removed by washing.
- the first specific binding partner is present in excess of any analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) present in the test sample, such that all analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) that is present in the test sample is bound by the first specific binding partner.
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- a second specific binding partner is added to the mixture to form a first specific binding partner-analyte of interest (e.g., GFAP, UCH-L1 or GFAP and UCH-Ll)-second specific binding partner complex.
- a first specific binding partner-analyte of interest e.g., GFAP, UCH-L1 or GFAP and UCH-Ll
- the second specific binding partner may be an anti-analyte antibody (e.g., anti-UCH-Ll antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 1 or anti-GFAP antibody that binds to an epitope having an amino acid sequence comprising at least three contiguous (3) amino acids of SEQ ID NO: 2).
- the second specific binding partner is labeled with or contains a detectable label as described above.
- immobilized antibodies or antibody fragments thereof may be incorporated into the immunoassay.
- the antibodies may be immobilized onto a variety of supports, such as magnetic or chromatographic matrix particles (such as a magnetic bead), latex particles or modified surface latex particles, polymer or polymer film, plastic or plastic film, planar substrate, the surface of an assay plate (such as microtiter wells), pieces of a solid substrate material, and the like.
- An assay strip can be prepared by coating the antibody or plurality of antibodies in an array on a solid support. This strip can then be dipped into the test sample and processed quickly through washes and detection steps to generate a measurable signal, such as a colored spot.
- a sandwich immunoassay measures the amount of antigen between two layers of antibodies (i.e., at least one capture antibody) and a detection antibody (i.e., at least one detection antibod)')-
- the capture antibody and the detection antibody bind to different epitopes on the antigen, e.g., analyte of interest such as GFAP, UCH-L1 or GFAP and UCH- L1.
- binding of the capture antibody to an epitope does not interfere with binding of the detection antibody to an epitope.
- Either monoclonal or polyclonal antibodies may be used as the capture and detection antibodies in the sandwich immunoassay.
- At least two antibodies are employed to separate and quantify analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) in a test sample. More specifically, the at least two antibodies bind to certain epitopes of analyte (e.g., GFAP, UCH-L1 or GFAP and UCH- Ll) forming an immune complex which is referred to as a "sandwich".
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH- Ll
- One or more antibodies can be used to capture the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) in the test sample (these antibodies are frequently referred to as a "capture” antibody or “capture” antibodies) and one or more antibodies is used to bind a detectable (namely, quantifiable) label to the sandwich (these antibodies are frequently referred to as the "detection” antibody or “detection” antibodies).
- the binding of an antibody to its epitope desirably is not diminished by the binding of any other antibody in the assay to its respective epitope.
- Antibodies are selected so that the one or more first antibodies brought into contact with a test sample suspected of containing analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) do not bind to all or part of an epitope recognized by the second or subsequent antibodies, thereby interfering with the ability of the one or more second detection antibodies to bind to the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH- Ll).
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH- Ll
- the antibodies may be used as a first antibody in said immunoassay.
- the antibody immunospecifically binds to epitopes on analyte (e.g., GFAP, UCH-L1 or GFAP and UCH- Ll).
- said immunoassay may comprise a second antibody that immunospecifically binds to epitopes that are not recognized or bound by the first antibody.
- test sample suspected of containing analyte e.g., GFAP, UCH-L1 or GFAP and
- UCH-L1 can be contacted with at least one first capture antibody (or antibodies) and at least one second detection antibodies either simultaneously or sequentially.
- a test sample suspected of containing analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- the at least one first capture antibody that specifically binds to a particular epitope under conditions which allow the formation of a first antibody-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) antigen complex.
- a first multiple capture antibody-UCH-Ll, GFAP or UCH- L1 and GFAP antigen complex is formed.
- the antibodies are used in molar excess amounts of the maximum amount of analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) expected in the test sample.
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- the antibodies are used in molar excess amounts of the maximum amount of analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) expected in the test sample.
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- the at least one first capture antibody can be bound to a solid support which facilitates the separation the first antibody-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH- Ll) complex from the test sample.
- a solid support which facilitates the separation the first antibody-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH- Ll) complex from the test sample.
- Any solid support known in the art can be used, including but not limited to, solid supports made out of polymeric materials in the forms of wells, tubes, or beads (such as a microparticle).
- the antibody can be bound to the solid support by adsorption, by covalent bonding using a chemical coupling agent or by other means known in the art, provided that such binding does not interfere with the ability of the antibody to bind analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- the solid support can be derivatized to allow reactivity' with various functional groups on the antibody.
- Such derivatization requires the use of certain coupling agents such as, but not limited to, maleic anhydride, N-hydroxysuccinimide and l-ethyl-3-(3- dimethylaminopropyl)carbodiimide.
- test sample suspected of containing analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- the incubation can be carried out at a pH of from about 4.5 to about 10.0, at a temperature of from about 2°C to about 45°C, and for a period from at least about one (1 ) minute to about eighteen (18) minutes, from about 2-6 minutes, from about 7 -12 minutes, from about 5-15 minutes, or from about 3-4 minutes.
- the first/multiple capture antibody-analyte e.g., GFAP, UCH-
- the complex is then contacted with at least one second detection antibody (under conditions that allow for the formation of a first/multiple antibody- analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) antigen-second antibody complex).
- a first/multiple antibody- analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1 antigen-second antibody complex.
- the test sample is contacted with the detection antibody simultaneously with the capture antibody.
- first antibody-analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- first/multiple capture antibody-analyte e.g., GFAP, UCH-L1 or GFAP and UCH-Ll
- the at least second (and subsequent) antibody when the at least second (and subsequent) antibody is brought into contact with the first antibody-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) complex, a period of incubation under conditions similar to those described above is required for the formation of the first/multiple antibody-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-Ll)-second/multiple antibody complex.
- the first antibody-analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- At least one second antibody contains a detectable label.
- the detectable label can be bound to the at least one second antibody prior to, simultaneously with or after the formation of the first/multiple antibody-analyte (e.g., GFAP, UCH-L1 or GFAP and UCH- Ll)-second/multiple antibody complex. Any detectable label known in the art can be used.
- Chemiluminescent assays can be performed in accordance with the methods described in Adamczyk et al., Anal. Chim. Acta 579(1): 61-67 (2006).
- a microplate chemiluminometer (Mithras LB-940, Berthold Technologies U.S.A., LLC, Oak Ridge, TN) enables the assay of multiple samples of small volumes rapidly.
- the chemiluminometer can be equipped with multiple reagent injectors using 96-well black polystyrene microplates (Costar #3792). Each sample can be added into a separate well, followed by the simultaneous/sequential addition of other reagents as determined by the type of assay employed. Desirably, the formation of pseudobases in neutral or basic solutions employing an acridinium aryl ester is avoided, such as by acidification. The chemiluminescent response is then recorded well-by-well. In this regard, the time for recording the chemiluminescent response will depend, in part, on the delay between the addition of the reagents and the particular acridinium employed.
- first specific binding partner-antigen e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- second specific binding partner is used and the second specific binding partner is delectably labeled with an acridinium compound
- first specific binding partner-analyte e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- Any unbound specific binding partner, whether labeled or unlabeled can be removed from the mixture using any technique known in the art, such as washing.
- Hydrogen peroxide can be generated in situ in the mixture or provided or supplied to the mixture before, simultaneously with, or after the addition of an above-described acridinium compound. Hydrogen peroxide can be generated in situ in a number of ways such as would be apparent to one skilled in the art.
- a source of hydrogen peroxide can be simply added to the mixture.
- the source of the hydrogen peroxide can be one or more buffers or other solutions that are known to contain hydrogen peroxide.
- a solution of hydrogen peroxide can simply be added.
- a detectable signal namely, a chemiluminescent signal, indicative of the presence of analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) is generated.
- the basic solution contains at least one base and has a pH greater than or equal to 10, preferably, greater than or equal to 12.
- Examples of basic solutions include, but are not limited to, sodium hydroxide, potassium hydroxide, calcium hydroxide, ammonium hydroxide, magnesium hydroxide, sodium carbonate, sodium bicarbonate, calcium hydroxide, calcium carbonate, and calcium bicarbonate.
- the amount of basic solution added to the sample depends on the concentration of the basic solution.
- enzymatic labels including but not limited to alkaline phosphatase
- the chemiluminescent signal, or other signal, that is generated can be detected using routine techniques known to those skilled in the art. Based on the intensity of the signal generated, the amount of analyte of interest (e.g., GFAP, UCH-L1 or GFAP and UCH- Ll) in the sample can be quantified. Specifically, the amount of analyte (e.g., GFAP, UCH- L1 or GFAP and UCH-L1) in the sample is proportional to the intensity of the signal generated.
- analyte of interest e.g., GFAP, UCH- L1 or GFAP and UCH- L1
- an aliquot of labeled analyte of interest e.g., analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) having a fluorescent label, a tag attached with a cleavable linker, etc.
- analyte of interest e.g., GFAP, UCH-L1 or GFAP and UCH-L1
- analyte of interest antibody e.g., GFAP, UCH-L1 or GFAP and UCH-L1 antibody
- an immobilized specific binding partner such as an antibody
- an immobilized specific binding partner can either be sequentially or simultaneously contacted with the test sample and a labeled analyte of interest, analyte of interest fragment or analyte of interest variant thereof.
- the analyte of interest peptide, analyte of interest fragment or analyte of interest variant can be labeled with any detectable label, including a detectable label comprised of tag attached with a cleavable linker.
- the antibody can be immobilized on to a solid support.
- the antibody can be coupled to an antibody, such as an anti-species antibody, that has been immobilized on a solid support, such as a microparticle or planar substrate.
- an antibody such as an anti-species antibody
- the labeled analyte of interest, the test sample and the antibody are incubated under conditions similar to those described above in connection with the sandwich assay format.
- Two or more different species of antibody-analyte of interest complexes may then be generated.
- one of the antibody-analyte of interest complexes generated contains a detectable label (e.g., a fluorescent label, etc.) while the other antibody-analyte of interest complex does not contain a detectable label.
- the antibody-analyte of interest complex can be, but does not have to be, separated from the remainder of the test sample prior to quantification of the detectable label. Regardless of whether the antibody-analyte of interest complex is separated from the remainder of the test sample, the amount of detectable label in the antibody-analyte of interest complex is then quantified.
- concentration of analyte of interest such as membrane-associated analyte of interest, soluble analyte of interest, fragments of soluble analyte of interest, variants of analyte of interest (membrane-associated or soluble analyte of interest) or any combinations thereof
- concentration of analyte of interest such as membrane-associated analyte of interest, soluble analyte of interest, fragments of soluble analyte of interest, variants of analyte of interest (membrane-associated or soluble analyte of interest) or any combinations thereof
- an immobilized analyte of interest e.g., GFAP
- UCH-L1 or GFAP and UCH-L1 can either be sequentially or simultaneously contacted with a test sample and at least one labeled antibody.
- the analyte of interest can be bound to a solid support, such as the solid supports discussed above in connection with the sandwich assay format.
- the immobilized analyte of interest, test sample and at least one labeled antibody are incubated under conditions similar to those described above in connection with the sandwich assay format.
- Two different species of analyte of interest-antibody complexes are then generated. Specifically, one of the analyte of interest-antibody complexes generated is immobilized and contains a detectable label (e.g., a fluorescent label, etc.) while the other analyte of interest-antibody complex is not immobilized and contains a detectable label.
- a detectable label e.g., a fluorescent label, etc.
- the non-immobilized analyte of interest-antibody complex and the remainder of the test sample are removed from the presence of the immobilized analyte of interest-antibody complex through techniques known in the art, such as washing.
- the amount of detectable label in the immobilized analyte of interest-antibody complex is then quantified following cleavage of the tag.
- the concentration of analyte of interest in the test sample can then be determined by comparing the quantity of detectable label as described above.
- a solid substrate is pre-coated with an immobilization agent.
- the capture agent, the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) and the detection agent are added to the solid substrate together, followed by a wash step prior to detection.
- the capture agent can bind the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) and comprises a ligand for an immobilization agent.
- the capture agent and the detection agents may be antibodies or any other moiety capable of capture or detection as described herein or known in the art.
- the ligand may comprise a peptide tag and an immobilization agent may comprise an anti-peptide tag antibody.
- the ligand and the immobilization agent may be any pair of agents capable of binding together so as to be employed for a capture on the fly assay (e.g., specific binding pair, and others such as are known in the art). More than one analyte may be measured.
- the solid substrate may be coated with an antigen and the analyte to be analyzed is an antibody.
- a solid support such as a microparticle pre-coated with an immobilization agent (such as biotin, streptavidin, etc.) and at least a first specific binding member and a second specific binding member (which function as capture and detection reagents, respectively) are used.
- an immobilization agent such as biotin, streptavidin, etc.
- the first specific binding member comprises a ligand for the immobilization agent (for example, if the immobilization agent on the solid support is streptavidin, the ligand on the first specific binding member may be biotin) and also binds to the analyte of interest (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- the second specific binding member comprises a detectable label and binds to an analyte of interest (e.g., GFAP, UCH-L1 or GFAP and UCH- Ll).
- the solid support and the first and second specific binding members may be added to a test sample (either sequentially or simultaneously).
- the ligand on the first specific binding member binds to the immobilization agent on the solid support to form a solid support/first specific binding member complex.
- Any analyte of interest present in the sample binds to the solid support/first specific binding member complex to form a solid support/first specific binding member/analyte complex.
- the second specific binding member binds to the solid support/first specific binding member/analyte complex and the detectable label is detected.
- An optional wash step may be employed before the detection.
- more than one analyte may be measured.
- more than two specific binding members can be employed.
- multiple detectable labels can be added.
- multiple analytes of interest can be detected, or their amounts, levels or concentrations, measured, determined or assessed.
- the use of a capture on the fly assay can be done in a variety of formats as described herein, and known in the art.
- the format can be a sandwich assay such as described above, but alternately can be a competition assay, can employ a single specific binding member, or use other variations such as are known.
- Single molecule detection assays and methods such as the use of a nanopore device or nanowell device, can also be used.
- nanopore devices are described in International Patent Publication No. WO 2016/161402, which is hereby incorporated by reference in its entirety.
- nanowell device are described in International Patent Publication No. WO 2016/161400, which is hereby incorporated by reference in its entirety.
- Other devices and methods appropriate for single molecule detection can also be employed.
- the methods of diagnosing, prognosticating, and/or assessing, as described above, can further include using other factors for the diagnosis, prognostication, and assessment.
- other factors can include measuring and/or determining blood urea nitrogen (BUN) levels and/or sodium/creatinine ratios.
- the methods can further include measuring and/or determining other biomarkers, such as Myelin Basic Protein (MBP), Neurofilament Light Protein (NFL), and a-amino-3-hydroxy-5-methyl-4- isoxazolepropionic acid receptor (AMP AR).
- MBP Myelin Basic Protein
- NNL Neurofilament Light Protein
- AMP AR a-amino-3-hydroxy-5-methyl-4- isoxazolepropionic acid receptor
- traumatic brain injury may be diagnosed using the Glasgow Coma Scale or the outcome of the traumatic brain injury may be predicted using the Extended Glasgow Outcome Scale (GOSE).
- GOSE Extended Glasgow Outcome Scale
- Other tests, scales or indices can also be used either alone or in combination with the Glasgow Coma Scale.
- An example is the Collinsos Los Amigos Scale.
- the Collinsos Los Amigos Scale measures the levels of awareness, cognition, behavior and interaction with the environment.
- the Collinsos Los Amigos Scale includes: Level I: No Response; Level II: Generalized Response; Level III: Localized Response; Level IV: Confused-agitated; Level V: Confused-inappropriate; Level VI: Confused-appropriate; Level VII: Automatic-appropriate; and Level VIII: Purposefill- appropriate.
- Other classification systems based on CT scan results can be used to predict outcome in patients, such as any classification systems known in the art.
- An example is the Marshall classification of traumatic brain injury, which places patients into one of six categories (I to VI) of increasing severity on the basis of findings on non-contrast CT scan of the brain. Higher categories have worse prognosis and survival.
- the Marshall classification is primarily concerned with two features: 1) degree of swelling, as determined by midline shift and/or compression of basal cisterns, and 2) presence and size of contusions/hemonhages referred to “high or mixed density lesions.”
- Another example is the Rotterdam score, which incorporates additional variables (e.g.
- the Rotterdam classification includes four independently scored elements. Similar to the Marshall system, the Rotterdam classification includes 1) degree of basal cistem compression and 2) degree of midline shift. The Rotterdam does not, however, include contusions, but rather restricts mass lesions to 3) epidural hematomas, and adds 4) intraventricular and/or subarachnoid blood. Each of these is given a score, and these scores are tallied, with the addition of 1 to the total. Higher scores worse prognosis and survival.
- the sample is obtained after the human pediatric subject sustained an injury to the head caused by physical shaking, blunt impact by an external mechanical or other force that results in a closed or open head trauma, one or more fells, explosions or blasts or other types of blunt force trauma.
- the sample is obtained after the human pediatric subject has ingested or been exposed to a chemical, toxin or combination of a chemical and toxin.
- the sample is obtained from a human pediatric subject that suffers from an autoimmune disease, a metabolic disorder, a brain tumor, hypoxia, one or more viruses, meningitis, hydrocephalus or combinations thereof.
- the methods described herein use samples that also can be used to determine whether or not a subject has or is at risk of developing mild traumatic brain injury by determining the levels of GFAP, UCH-L1 or GFAP and UCH-L1 in a subject using the anti-GFAP antibodies and anti-UCH-Ll antibodies described above, or antibody fragments thereof.
- the disclosure also provides a method for determining whether a pediatric subject having, or at risk for, traumatic brain injuries, discussed herein and known in the art, is a candidate for therapy or treatment.
- the pediatric subject is at least one who: (i) has experienced an injury to the head; (ii) ingested and/or been exposed to one or more chemicals and/or toxins; (iii) suffers from an autoimmune disease, a metabolic disorder, a brain tumor, hypoxia, one or more viruses, meningitis, hydrocephalus or suffers from any combinations thereof; or (iv) any combinations of (i)-(iii); or, who has actually been diagnosed as having, or being at risk for TBI (such as, for example, subjects suffering from an autoimmune disease, a metabolic disorder, a brain tumor, hypoxia, one or more viruses, meningitis, hydrocephalus or combinations thereof), and/or who demonstrates an unfavorable (i.e., clinically undesirable) concentration or amount of GFAP, UCH-L1 , GFAP fragment, and/or UCH-L1 fragment, as described herein.
- sample refers to fluid sample containing or suspected of containing GFAP, UCH-L1 or GFAP and UCH-L1.
- the sample may be derived from any suitable source.
- the sample may comprise a liquid, fluent particulate solid, or fluid suspension of solid particles.
- the sample may be processed prior to the analysis described herein. For example, the sample may be separated or purified from its source prior to analysis; however, in certain embodiments, an unprocessed sample containing GFAP, UCH-L1 or GFAP and UCH-L1 may be assayed directly.
- the source containing GFAP, UCH-L1 or GFAP and UCH- L1 is a human (e.g., pediatric human) bodily substance (e.g., bodily fluid, blood such as whole blood, serum, plasma, urine, saliva, sweat, sputum, semen, mucus, lacrimal fluid, lymph fluid, amniotic fluid, interstitial fluid, lung lavage, cerebrospinal fluid, feces, tissue, organ, or the like).
- Tissues may include, but are not limited to skeletal muscle tissue, liver tissue, lung tissue, kidney tissue, myocardial tissue, brain tissue, bone marrow, cervix tissue, skin, etc.
- the sample may be a liquid sample or a liquid extract of a solid sample.
- the source of the sample may be an organ or tissue, such as a biopsy sample, which may be solubilized by tissue disintegration/cell lysis.
- the sample volume may be about 0.5 nL, about 1 nL, about 3 nL, about 0.01 ⁇ L, about 0.1 ⁇ L, about 1 ⁇ L, about 5 ⁇ L, about 10 ⁇ L, about 100 ⁇ L, about 1 mL, about 5 mL, about 10 mL, or the like.
- the volume of the fluid sample is between about 0.01 ⁇ L and about 10 mL, between about 0.01 ⁇ L and about 1 mL, between about 0.01 ⁇ L and about 100 ⁇ L, or between about 0.1 ⁇ L and about 10 ⁇ L.
- the fluid sample may be diluted prior to use in an assay.
- the source containing GFAP, UCH-L1 or GFAP and UCH- L1 is a human body fluid (e.g., blood, serum)
- the fluid may be diluted with an appropriate solvent (e.g., a buffer such as PBS buffer).
- an appropriate solvent e.g., a buffer such as PBS buffer.
- a fluid sample may be diluted about 1-fold, about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 6-fold, about 10-fold, about 100-fold, or greater, prior to use.
- the fluid sample is not diluted prior to use in an assay.
- the sample may undergo pre-analytical processing.
- Pre-analytical processing may offer additional functionality' such as nonspecific protein removal and/or effective yet cheaply implementable mixing functionality'.
- General methods of pre-analytical processing may include the use of electrokinetic trapping, AC electrokinetics, surface acoustic waves, isotachophoresis, dielectrophoresis, electrophoresis, or other pre- concentration techniques known in the art.
- the fluid sample may be concentrated prior to use in an assay.
- the source containing GFAP, UCH-L1 or GFAP and UCH-L1 is a human (e.g., pediatric) body fluid (e.g., blood, serum)
- the fluid may be concentrated by precipitation, evaporation, filtration, centrifugation, or a combination thereof.
- a fluid sample may be concentrated about 1-fold, about 2-fold, about 3-fold, about 4-fold, about 5-fold, about 6-fold, about 10-fold, about 100- fold, or greater, prior to use.
- control such as a positive and/or negative control, which are well known in the art.
- the control may be analyzed concurrently with the sample from the subject as described above.
- the results obtained from the subject sample can be compared to the results or information obtained fiom the control.
- Standard curves may be provided, with which assay results for the sample may be compared.
- Such standard curves present levels of marker as a function of assay units, i.e., fluorescent signal intensity, if a fluorescent label is used.
- controls may relate to (e.g., be based on) samples or information taken from healthy subjects that are considered to be healthy and have sustained no apparent TBI (“healthy controls”).
- a method for determining the presence, amount, or concentration of GFAP, UCH-L1 or GFAP and UCH-L1 in a test sample comprises assaying the test sample for GFAP, UCH-L1 or GFAP and UCH-L1 by an immunoassay, for example, employing at least one capture antibody that binds to an epitope on GFAP, UCH-L1 or GFAP and UCH-L1 and at least one detection antibody that binds to an epitope on GFAP, UCH-L1 or GFAP and UCH-L1 which is different from the epitope for the capture antibody and optionally includes a detectable label, and comprising comparing a signal generated by the detectable label as a direct or indirect indication of the presence, amount or concentration of GFAP, UCH-L1 or GFAP and UCH-L1 in the test sample to a signal generated as a direct or indirect indication of the presence, amount or
- kits which may be used in the methods described herein for assaying or assessing a test sample for GFAP, UCH-L1 or GFAP and UCH-L1 fragments).
- the kit comprises at least one component for assaying the test sample for GFAP, UCH-L1 or GFAP and UCH-L1 instructions for assaying the test sample for .
- the kit can comprise instructions for assaying the test sample for GFAP, UCH-L1 or GFAP and UCH-L1 by immunoassay, e.g., chemiluminescent microparticle immunoassay.
- kits can be affixed to packaging material or can be included as a package insert, or can be viewed or downloaded from a particular website that is recited as part of the kit packaging or inserted materials. While the instructions are typically written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this disclosure. Such media include, but are not limited to, electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. As used herein, the term "instructions" can include the address of an internet site that provides the instructions.
- the at least one component may include at least one composition comprising one or more isolated antibodies or antibody fragments thereof that specifically bind to GFAP, UCH-L1 or GFAP and UCH-L1.
- the antibody may be a GFAP, UCH-L1 or GFAP and UCH-L1 capture antibody and/or a GFAP, UCH-L1 or GFAP and UCH-L1 detection antibody.
- the kit can comprise a calibrator or control, as described above, e.g., purified, and optionally lyophilized, GFAP, UCH-L1 or GFAP and UCH-L1 , and/or at least one container (e.g., tube, microtiter plates or strips, which can be already coated with an anti-GFAP, UCH-L1 or GFAP and UCH-L1 monoclonal antibody) for conducting the assay, and/or a buffer, such as an assay buffer or a wash buffer, either one of which can be provided as a concentrated solution, a substrate solution for the detectable label (e.g., an enzymatic label), or a stop solution.
- the kit comprises all components, i.e., reagents, standards, buffers, diluents, etc., which are necessary to perform the assay.
- the instructions also can include instructions for generating a standard curve.
- the kit may further comprise reference standards for quantifying GFAP, UCH-L1 or GFAP and UCH-L1.
- the reference standards may be employed to establish standard curves for interpolation and/or extrapolation of GFAP, UCH-L1 or GFAP and UCH-L1 concentrations.
- the reference standards may include a high GFAP, UCH-L1 or GFAP and UCH-L1 concentration level, for example, about 100000 pg/mL, about 125000 pg/mL, about 150000 pg/mL, about 175000 pg/mL, about 200000 pg/mL, about 225000 pg/mL, about 250000 pg/mL, about 275000 pg/mL, or about 300000 pg/mL; a medium GFAP, UCH-L1 or GFAP and UCH-L1 concentration level, for example, about 25000 pg/mL, about 40000 pg/mL, about 45000 pg/mL, about 50000 pg/mL, about 55000 pg/mL, about 60000 pg/mL, about 75000 pg/mL or about 100000 pg/mL; and/or a low GFAP, UCH-L1 or GFAP and UCH
- any antibodies which are provided in the kit, such as recombinant antibodies specific for GFAP, UCH-L1 or GFAP and UCH-L1, can incorporate a detectable label, such as a fluorophore, radioactive moiety, enzyme, biotin/avidin label, chromophore, chemiluminescent label, or the like, or the kit can include reagents for labeling the antibodies or reagents for detecting the antibodies (e.g., detection antibodies) and/or for labeling the analytes (e.g., GFAP, UCH-L1 or GFAP and UCH-L1) or reagents for detecting the analyte (e.g., GFAP, UCH-L1 or GFAP and UCH-L1).
- the antibodies, calibrators, and/or controls can be provided in separate containers or pre-dispensed into an appropriate assay format, for example, into microtiter plates.
- the kit includes quality control components (for example, sensitivity panels, calibrators, and positive controls).
- quality control components for example, sensitivity panels, calibrators, and positive controls.
- Preparation of quality control reagents is well- known in the art and is described on insert sheets for a variety of immunodiagnostic products.
- Sensitivity panel members optionally are used to establish assay performance characteristics, and further optionally are useful indicators of the integrity of the immunoassay kit reagents, and the standardization of assays,
- the kit can also optionally include other reagents required to conduct a diagnostic assay or facilitate quality control evaluations, such as buffers, salts, enzymes, enzyme co- factors, substrates, detection reagents, and the like.
- Other components such as buffers and solutions for the isolation and/or treatment of a test sample (e.g., pretreatment reagents), also can be included in the kit.
- the kit can additionally include one or more other controls.
- One or more of the components of the kit can be lyophilized, in which case the kit can forther comprise reagents suitable for the reconstitution of the lyophilized components.
- the various components of the kit optionally are provided in suitable containers as necessary, e.g., a microtiter plate.
- the kit can forther include containers for holding or storing a sample (e.g., a container or cartridge for a urine, whole blood, plasma, or serum sample). Where appropriate, the kit optionally also can contain reaction vessels, mixing vessels, and other components that facilitate the preparation of reagents or the test sample.
- the kit can also include one or more instrument for assisting with obtaining a test sample, such as a syringe, pipette, forceps, measured spoon, or the like.
- the kit can comprise at least one acridinium-9-carboxamide, at least one acridinium-9-carboxylate aryl ester, or any combination thereof. If the detectable label is at least one acridinium compound, the kit also can comprise a source of hydrogen peroxide, such as a buffer, solution, and/or at least one basic solution. If desired, the kit can contain a solid phase, such as a magnetic particle, bead, test tube, microtiter plate, cuvette, membrane, scaffolding molecule, film, filter paper, disc, or chip.
- a source of hydrogen peroxide such as a buffer, solution, and/or at least one basic solution.
- the kit can contain a solid phase, such as a magnetic particle, bead, test tube, microtiter plate, cuvette, membrane, scaffolding molecule, film, filter paper, disc, or chip.
- the kit can further comprise one or more components, alone or in further combination with instructions, for assaying the test sample for another analyte, which can be a biomarker, such as a biomarker of traumatic brain injury' or disorder.
- a biomarker such as a biomarker of traumatic brain injury' or disorder.
- kits or components thereof, as well as the method for assessing or determining the concentration of GFAP, UCH-L1 or GFAP and UCH-L1 in a test sample by an immunoassay as described herein, can be adapted for use in a variety of automated and semi- automated systems (including those wherein the solid phase comprises a microparticle), as described, e.g., U.S. Patent No. 5,063,081, U.S. Patent Application Publication Nos.
- Some of the differences between an automated or semi-automated system as compared to a non-automated system include the substrate to which the first specific binding partner (e.g., analyte antibody or capture antibody) is attached (which can affect sandwich formation and analyte reactivity), and the length and timing of the capture, detection, and/or any optional wash steps.
- the first specific binding partner e.g., analyte antibody or capture antibody
- an automated or semi-automated format e.g., ARCHITECT® and any successor platform, Abbott Laboratories
- an automated or semi-automated format may have a relatively shorter incubation time (e.g., approximately 18 minutes for ARCHITECT®).
- an automated or semi-automated format e.g., ARCHITECT® and any successor platform
- a relatively shorter incubation time e.g., approximately 4 minutes for the ARCHITECT® and any successor platform.
- kits, and kit components can be employed in other formats, for example, on electrochemical or other hand-held or point-of-care assay systems.
- the present disclosure is, for example, applicable to the commercial Abbott Point of Care (i-STAT®, Abbott Laboratories) electrochemical immunoassay system that performs sandwich immunoassays.
- a microfabricated silicon chip is manufactured with a pair of gold amperometric working electrodes and a silver-silver chloride reference electrode. On one of the working electrodes, polystyrene beads (0.2 mm diameter) with immobilized capture antibody are adhered to a polymer coating of patterned polyvinyl alcohol over the electrode. This chip is assembled into an i-STAT® cartridge with a fluidics format suitable for immunoassay.
- GFAP GFAP
- UCH-L1 or GFAP and UCH-L1 antibodies one or more monoclonal/polyclonal antibody or a fragment thereof, a variant thereof, or a fragment of a variant thereof that can bind GFAP, UCH-L1 or GFAP and UCH-L1 antibodies
- one or more anti-GFAP UCH-L1 or GFAP and UCH-L1 DVD-Igs (or a fragment thereof, a variant thereof, or a fragment of a variant thereof that can bind GFAP, UCH-L1 or GFAP and UCH-L1), either of which can be delectably labeled.
- an aqueous reagent that includes p-aminophenol phosphate.
- a sample from a subject suspected of suffering from TBI is added to the holding chamber of the test cartridge, and the cartridge is inserted into the i-STAT® reader.
- a pump element within the cartridge pushes the sample into a conduit containing the chip.
- the sample is brought into contact with the sensors allowing the enzyme conjugate to dissolve into the sample.
- the sample is oscillated across the sensors to promote formation of the sandwich of approximately 2-12 minutes.
- the penultimate step of the assay the sample is pushed into a waste chamber and wash fluid, containing a substrate for the alkaline phosphatase enzyme, is used to wash excess enzyme conjugate and sample off the sensor chip.
- the alkaline phosphatase label reacts with p-aminophenol phosphate to cleave the phosphate group and permit the liberated p-aminophenol to be electrochemically oxidized at the working electrode.
- the reader is able to calculate the amount of GFAP, UCH-L1 or GFAP and UCH-L1 in the sample by means of an embedded algorithm and factory-determined calibration curve.
- Adaptation of a cartridge for multiplex use, such as used for i-Stat has been described in the patent literature, such as for example, U.S. Patent No. 6,438,498, the contents of which are herein incorporated by reference.
- kits as described herein necessarily encompass other reagents and methods for carrying out the immunoassay.
- various buffers such as are known in the art and/or which can be readily prepared or optimized to be employed, e.g., for washing, as a conjugate diluent, and/or as a calibrator diluent.
- An exemplary conjugate diluent is ARCHITECT® conjugate diluent employed in certain kits (Abbott Laboratories, Abbott Park, IL) and containing 2-(N-morpholino)ethanesulfonic acid (MES), a salt, a protein blocker, an antimicrobial agent, and a detergent.
- MES 2-(N-morpholino)ethanesulfonic acid
- An exemplary calibrator diluent is ARCHITECT® human calibrator diluent employed in certain kits (Abbott Laboratories, Abbott Park, IL), which comprises a buffer containing MES, other salt, a protein blocker, and an antimicrobial agent. Additionally, as described in U.S. Patent Application No. 61/142,048 filed December 31 , 2008, improved signal generation may be obtained, e.g., in an i-STAT® cartridge format, using a nucleic acid sequence linked to the signal antibody as a signal amplifier.
- the assays and kits also optionally can be employed to assess GFAP, UCH-Ll or GFAP and UCH-L1 in other diseases, disorders, and conditions as appropriate.
- the method of assay also can be used to identify a compound that ameliorates diseases, such as traumatic brain injury.
- a cell that expresses GFAP, UCH-Ll or GFAP and UCH-Ll can be contacted with a candidate compound.
- the level of expression of GFAP, UCH-Ll or GFAP and UCH-Ll in the cell contacted with die compound can be compared to that in a control cell using the method of assay described herein.
- i-STAT® UCH-L1 Assay Monoclonal antibody pairs, such as Antibody A as a capture monoclonal antibody and Antibody B and C as a detection monoclonal antibody, were tested.
- Antibody A is an exemplary anti-UCH-Ll antibody that was internally developed at Abbott Laboratories (Abbott Park, IL).
- Antibody B and C recognize different epitopes of UCH-L1 and enhance the detection of antigen in the sample that were developed by Banyan Biomarkers (Alachua, Florida).
- the combination of the antibodies provides a synergistic effect when used together and provides for an increased signal as compared to use of the antibodies not combined.
- the UCH-L1 assay design was evaluated against key performance attributes.
- the cartridge configuration was Antibody Configuration: Antibody A (Capture Antibody )/Antibody B+C (Detection Antibody); Reagent conditions: 0.8% solids, 125 ⁇ g /mL Fab Alkaline Phosphatase cluster conjugate; and Sample Inlet Print: UCH-L1 standard.
- the assay time was 10-15 min (with 7-12 min sample capture time).
- the i-STAT UCH-L1 assay was used in a TBI patient population study.
- i-STAT® GFAP Assay The i-STAT® GFAP assay was used in a TBI patient population study. Monoclonal antibody pairs, such as Antibody A as a capture monoclonal antibody and Antibody B as a detection monoclonal antibody, were used. Antibody A and Antibody B are exemplary anti-GFAP antibodies that were internally developed at Abbott Laboratories (Abbott Park, IL). Antibody A and Antibody B both bind to epitopes within the same GFAP breakdown product (BDP). The combination of the antibodies provided a synergistic effect when used together and provided for an increased signal as compared to use of the antibodies not combined. The GFAP assay design was evaluated against key performance attributes.
- the cartridge configuration was Antibody Configuration: Antibody A (Capture Antibody)/Antibody B (Detection Antibody); Reagent conditions: 0.8% solids. 250 ⁇ g/mL Fab Alkaline Phosphatase cluster conjugate; and Sample Inlet Print: GFAP specific.
- the assay time was 10-15 min (with 7-12 min sample capture time).
- TRACK-TBI Traumatic Brain Injury
- Subject Groups - TRACK-TBI Pediatric TBI patients were evaluated. Subjects consisted of 50 pediatric subjects with biomarker results, 40 pediatric subjects with a valid CT scan, 23 pediatric subjects with a valid MRI scan, and 0 controls.
- Subject Groups - Hennepin Pediatric TBI patients were evaluated. Subjects consisted of 1 pediatric subject with biomarker results and a valid CT scan and 3 controls (for a total of 4 subjects).
- ROC receiver operating characteristic
- Table 3 shows tiie sensitivity, specificity, negative predictive value, and positive predictive value for cutoff values (i.e. reference values) of 55 pg/mL and 300 pg/mL, respectively.
- Cutoff values were further evaluated. A cutoff of at least 30 pg/mL for GFAP and at least 360 pg/mL for UCH-L1 was tested. The results are shown in Tables 4 and 5 below.
- a method of evaluating a pediatric subject for a head injury comprising: a) performing an assay on a sample which has been taken from the subject after an actual or suspected head injury to measure a level of ubiquitin carboxy- terminal hydrolase LI (UCH-L1), and/or a level of glial fibrillary acidic protein (GFAP) in the sample; and b) determining that the subject has sustained a traumatic brain injury (TBI) when: i . the level of GFAP in the sample is greater than a reference level of GFAP, wherein the reference level of GFAP is at least about 30 pg/mL, ii.
- UCH-L1 ubiquitin carboxy- terminal hydrolase LI
- GFAP glial fibrillary acidic protein
- the level of UCH-L1 in the sample is greater than a reference level of UCH-L1, wherein the reference level of UCH-L1 is at least about 55 pg/mL, or iii. the level of GFAP in the sample is greater than a reference level of GFAP and the level of UCH-L1 in the sample is greater than a reference level of UCH-L1, wherein the reference level of GFAP is at least about 30 pg/mL and the reference level of UCH-L1 is about 360 pg/mL.
- Clause 2 The method of clause 1, wherein the subject is determined to have sustained a TBI when the level of GFAP in the sample is greater than a reference level of GFAP, wherein the reference level of GFAP is at least about 50 pg/mL.
- Clause 3 The method of clause 2, wherein the reference level of GFAP is at least about 65 pg/mL.
- Clause 4 The method of clause 3, wherein the reference level of GFAP is about 1000 pg/mL.
- Clause 5 The method of clause 1, wherein the subject is determined to have sustained a TBI when the level of UCH-L1 in the sample is greater than a reference level of UCH-L1 , wherein the reference level of UCH-L1 is about 300 pg/mL.
- Clause 6 The method of clause 1, wherein the subject is determined to have sustained a TBI when the level of GFAP in the sample is greater than a reference level of GFAP and the level of UCH-L1 in the sample is greater than a reference level of UCH-L1, wherein the reference level of GFAP is about 65 pg/mL and the reference level of UCH-L1 is about 360 pg/mL.
- Clause 7 The method of any one of clauses 1-6, wherein the sample is collected within about 48 hours after the actual or suspected head injury'.
- Clause 8 The method of any one of clauses 1-7, wherein the subject has received a Glasgow Coma Scale score before or after the assay is performed.
- Clause 9 The method of clause 8, wherein the subject is suspected as having a moderate to severe TBI based on the Glasgow Coma Scale score, or wherein the reference level is correlated with subjects having moderate to severe TBI.
- Clause 10 The method of clause 8, wherein the subject is suspected as having mild TBI based on the Glasgow Coma Scale score, or wherein the reference level is correlated with subjects having mild TBI.
- the reference level of GFAP is (i) determined by an assay having a sensitivity of at least about 90% and a specificity of at least about 40%; (ii) determined by an assay having a sensitivity of at least about 50% and a specificity of at least about 90%; (iii) determined by an assay having a negative predictive value of at least about 70%; (iv) determined by an assay having a negative predictive value of at least about 90%; (v) determined by an assay having a positive predictive value of at least about 50%; or (vi) determined by an assay having a positive predictive value of at least about 80%; b) the reference level of UCH-L1 is (i) determined by an assay having a sensitivity of at least about 80% and a specificity of at least about 25%; (ii) determined by an assay having a sensitivity of at least about 30% and a specificity of at least about 90%; (iii) determined by an assay
- Clause 12 The method of any one of clauses 1-11, further comprising treating the pediatric subject determined as having a TBI with a treatment for TBI and optionally, monitoring the pediatric subject after receiving said treatment.
- Clause 13 The method of any one of clauses 1-12 wherein the pediatric subject is a human.
- a method of evaluating whether to perform a head computerized tomography (CT) scan on a pediatric subject comprising: a) performing an assay on a sample which has been taken from the subject after an actual or suspected head injury to measure a level of ubiquitin carboxy - terminal hydrolase LI (UCH-L1), and/or a level of glial fibrillary' acidic protein (GFAP) in the sample; and b) determining that a head CT scan should be performed on the pediatric subject when: i. the level of GFAP in the sample is greater than a reference level of GFAP, wherein the reference level of GFAP is at least about 30 pg/mL, ii.
- CT head computerized tomography
- the level of UCH-L1 in the sample is greater than a reference level of UCH-L1, wherein the reference level of UCH-L1 is at least about 55 pg/mL, or iii. the level of GFAP in the sample is greater than a reference level of GFAP and the level of UCH-L1 in the sample is greater than a reference level of UCH-L1, wherein the reference level of GFAP is at least about 30 pg/mL and the reference level of UCH-L1 about 360 pg/mL.
- Clause 15 The method of clause 14, wherein it is determined that a head CT scan should be performed when the level of GFAP in the sample is greater than a reference level of GFAP, wherein the reference level of GFAP is at least about 50 pg/mL.
- Clause 16 The method of clause 15, wherein the reference level of GFAP is at least about 65 pg/mL.
- Clause 17 The method of clause 16, wherein the reference level of GFAP is about 1000 pg/mL.
- Clause 18 The method of clause 14, wherein it is determined that a head CT scan should be performed when the level of UCH-L1 in the sample is greater than a reference level of UCH- Ll, wherein the reference level of UCH-L1 is about 300 pg/mL.
- Clause 19 The method of clause 14, wherein it is determined that a head CT scan should be performed when the level of GFAP in the sample is greater than a reference level of GFAP and the level of UCH-L1 in the sample is greater than a reference level of UCH-L1 , wherein the reference level of GFAP is about 65 pg/mL and the reference level of UCH-L1 is about 360 pg/mL.
- Clause 20 The method of any one of clauses 14-19, wherein: a) the reference level of GFAP is (i) determined by an assay having a sensitivity of at least about 90% and a specificity of at least about 40%; (ii) determined by an assay having a sensitivity of at least about 50% and a specificity of at least about 90%; (iii) determined by an assay having a negative predictive value of at least about 70%; (iv) determined by an assay having a negative predictive value of at least about 90%; (v) determined by an assay having a positive predictive value of at least about 50%; or (vi) determined by an assay having a positive predictive value of at least about 80%; b) the reference level of UCH-L1 is (i) determined by an assay having a sensitivity of at least about 80% and a specificity of at least about 25%; (ii) determined by an assay having a sensitivity of at least about 30% and a specificity of at least about 90%; (iii) determined by an as
- Clause 21 The method of any one of clauses 14-20, wherein the sample is collected within about 48 hours after the actual or suspected head injury.
- Clause 22 The method of any one of clauses 1-21, further comprising performing an assay on the samples to measure or detect a level of one or more other biomarkers that are not UCH-L1 or GFAP.
- Clause 23 The method of clause 22, wherein the one or more other biomarkers are selected from the group consisting of S100 ⁇ , neuron-specific enolase (NSE), lipoprotein 1, Tau, C- reactive protein (CRP), free brain-derived neurotrophic factor (BDNF), p-Tau, total BDNF, troponin I (Tnl), and a combination thereof.
- NSE neuron-specific enolase
- CCP C- reactive protein
- BDNF free brain-derived neurotrophic factor
- Tnl troponin I
- a capture antibody which binds to an epitope on UCH-L1 or UCH-L1 fragment to form a capture antibody-UCH-Ll antigen complex
- a detection antibody which includes a detectable label and binds to an epitope on UCH-L1 that is not bound by the capture antibody, to form a UCH- L1 antigen-detection antibody complex, such that a capture antibody-UCH-Ll antigen-detection antibody complex is formed, and
- Clause 26 The method of any one of clauses 1-25, wherein measuring the level of GFAP comprises performing an immunoassay.
- a capture antibody which binds to an epitope on GFAP or GFAP fragment to form a capture antibody-GFAP antigen complex
- a detection antibody which includes a detectable label and binds to an epitope on GFAP that is not bound by the capture antibody, to form a GFAP antigen-detection antibody complex, such that a capture antibody-GFAP antigen-detection antibody complex is formed, and
- Clause 28 The method of any one of clauses 1-28, wherein the sample is a whole blood sample, a serum sample, a cerebrospinal fluid sample, a plasma sample, a tissue sample, a saliva sample, an oropharyngeal sample, a nasopharyngeal sample, a nasal mucus sample, or a bodily fluid.
- Clause 29 The method of any one of clauses 1-29, wherein the sample is obtained after the subject sustained a head injury' caused by physical shaking, blunt impact by an external mechanical or other force that results in a closed or open head trauma, one or more falls, explosions or blasts or other types of blunt force trauma.
- Clause 30 The method of any one of clauses 1-28, wherein the sample is obtained after the subject has ingested or been exposed to a chemical, toxin or combination of a chemical and toxin.
- Clause 31 The method of clause 30, wherein the chemical or toxin is fire, mold, asbestos, a pesticide, an insecticide, an organic solvent, a paint, a glue, a gas, an organic metal, a drug of abuse or one or more combinations thereof.
- Clause 32 The method of any one of clauses 1-31, wherein the sample is obtained from a pediatric subject that suffers from an autoimmune disease, a metabolic disorder, a brain tumor, hypoxia, a virus, meningitis, hydrocephalus or combinations thereof.
- Clause 33 The method of any one of clauses 1-32, wherein the assay is an immunoassay or a clinical chemistry assay.
- Clause 34 The method of any one of clauses 1-33, wherein the assay is performed using single molecule detection or a point-of-care device.
- Clause 35 The method of any one of clauses 1-6, wherein the sample is collected within about 6 hours after the actual or suspected head injury.
- Clause 36 The method of any one of clauses 1-6, wherein the sample is collected within about 12 hours after the actual or suspected head injury.
- Clause 37 The method of any one of clauses 1-6, wherein the sample is collected within about 14 horns after the actual or suspected head injury.
- Clause 38 The method of any one of clauses 1-6, wherein the sample is collected within about 24 hours after the actual or suspected head injury.
- a method of evaluating a pediatric subject for a head injury comprising: c) performing an assay on a sample which has been taken from the subject after an actual or suspected head injury to measure a level of ubiquitin carboxy- terminal hydrolase LI (UCH-L1), and/or a level of glial fibrillary' acidic protein (GFAP) in the sample; and d) determining that the subject has more likely than not sustained a traumatic brain injury (TBI) when: i) the level of GFAP in the sample is greater than a reference level of GFAP, wherein the reference level of GFAP is at least about 30 pg/mL, ii) the level of UCH-L1 in the sample is greater than a reference level of UCH-L1, wherein the reference level of UCH-L1 is at least about 55 pg/mL, or iii) the level of GFAP in the sample is greater than a reference level of GFAP and the level of UCH-L1
- TBI traumatic
- Clause 40 The method of clause 39, wherein the subject is determined to have more likely than not sustained a TBI when the level of GFAP in the sample is greater than a reference level of GFAP, wherein the reference level of GFAP is at least about 50 pg/mL.
- Clause 41 The method of clause 40, wherein the reference level of GFAP is at least about 65 pg/mL.
- Clause 42 Hie method of clause 41, wherein the reference level of GFAP is about 1000 pg/mL.
- Clause 43 The method of clause 39, wherein the subject is determined to have more likely than not sustained a TBI when the level of UCH-L1 in the sample is greater than a reference level of UCH-L1, wherein the reference level of UCH-L1 is about 300 pg/mL.
- Clause 44 The method of clause 39, wherein the subject is determined to have more likely than not sustained a TBI when the level of GFAP in the sample is greater than a reference level of GFAP and the level of UCH-L1 in the sample is greater than a reference level of UCH-L1, wherein the reference level of GFAP is about 65 pg/mL and the reference level of UCH-L1 is about 360 pg/mL.
- Clause 45 The method of any one of clauses 39-44, wherein the sample is collected within about 48 hours after the actual or suspected head injury.
- Clause 46 The method of any one of clauses 39-45, wherein the subject has received a Glasgow Coma Scale score before or after the assay is performed.
- Clause 47 The method of clause 46, wherein the subject is suspected as having a moderate to severe TBI based on the Glasgow Coma Scale score, or wherein the reference level is correlated with subjects having moderate to severe TBI.
- Clause 48 The method of clause 46, wherein the subject is suspected as having mild TBI based on the Glasgow Coma Scale score, or wherein the reference level is correlated with subjects having mild TBI.
- the reference level of GFAP is (i) determined by an assay having a sensitivity of at least about 90% and a specificity of at least about 40%; (ii) determined by an assay having a sensitivity of at least about 50% and a specificity of at least about 90%; (iii) determined by an assay having a negative predictive value of at least about 70%; (iv) determined by an assay having a negative predictive value of at least about 90%; (v) determined by an assay having a positive predictive value of at least about 50%; or (vi) determined by an assay having a positive predictive value of at least about 80%; b) the reference level of UCH-L1 is (i) determined by an assay having a sensitivity of at least about 80% and a specificity of at least about 25%; (ii) determined by an assay having a sensitivity of at least about 30% and a specificity of at least about 90%; (iii) determined by an assay having an assay having a sensitivity of at least about 30% and a specificity
- Clause 51 The method of any one of clauses 39-50 wherein the pediatric subject is a human.
- Clause 52 The method of any one of clauses 39-44, wherein the sample is collected within about 6 hours after the actual or suspected head injury.
- Clause 53 The method of any one of clauses 39-44, wherein the sample is collected within about 12 hours after the actual or suspected head injury.
- Clause 54 The method of any one of clauses 39-44, wherein the sample is collected within about 14 hours after the actual or suspected head injury.
- Clause 55 The method of any one of clauses 39-44, wherein the sample is collected within about 24 hours after the actual or suspected head injury.
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Chemical & Material Sciences (AREA)
- Urology & Nephrology (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Biotechnology (AREA)
- Analytical Chemistry (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Food Science & Technology (AREA)
- Medicinal Chemistry (AREA)
- Physics & Mathematics (AREA)
- Cell Biology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Peptides Or Proteins (AREA)
- Measurement Of The Respiration, Hearing Ability, Form, And Blood Characteristics Of Living Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Magnetic Resonance Imaging Apparatus (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3216320A CA3216320A1 (en) | 2021-05-18 | 2022-05-18 | Methods of evaluating brain injury in a pediatric subject |
| BR112023024169A BR112023024169A2 (pt) | 2021-05-18 | 2022-05-18 | Métodos para avaliar lesão cerebral em um indivíduo pediátrico |
| JP2023571582A JP2024519858A (ja) | 2021-05-18 | 2022-05-18 | 小児対象における脳損傷を査定する方法 |
| AU2022279156A AU2022279156A1 (en) | 2021-05-18 | 2022-05-18 | Methods of evaluating brain injury in a pediatric subject |
| CN202280036556.9A CN117751288A (zh) | 2021-05-18 | 2022-05-18 | 评价儿科受试者的脑损伤的方法 |
| EP22728744.8A EP4341699A1 (en) | 2021-05-18 | 2022-05-18 | Methods of evaluating brain injury in a pediatric subject |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163189757P | 2021-05-18 | 2021-05-18 | |
| US63/189,757 | 2021-05-18 | ||
| US202163192370P | 2021-05-24 | 2021-05-24 | |
| US63/192,370 | 2021-05-24 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2022245920A1 true WO2022245920A1 (en) | 2022-11-24 |
| WO2022245920A9 WO2022245920A9 (en) | 2023-01-19 |
Family
ID=81975040
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/029798 Ceased WO2022245920A1 (en) | 2021-05-18 | 2022-05-18 | Methods of evaluating brain injury in a pediatric subject |
Country Status (7)
| Country | Link |
|---|---|
| US (1) | US20220381796A1 (https=) |
| EP (1) | EP4341699A1 (https=) |
| JP (1) | JP2024519858A (https=) |
| AU (1) | AU2022279156A1 (https=) |
| BR (1) | BR112023024169A2 (https=) |
| CA (1) | CA3216320A1 (https=) |
| WO (1) | WO2022245920A1 (https=) |
Citations (103)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US102331A (en) | 1870-04-26 | Improved carpet-tacking machine | ||
| US609631A (en) | 1898-08-23 | schmidt | ||
| US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
| US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| US5006309A (en) | 1988-04-22 | 1991-04-09 | Abbott Laboratories | Immunoassay device with liquid transfer between wells by washing |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| US5063081A (en) | 1988-11-14 | 1991-11-05 | I-Stat Corporation | Method of manufacturing a plurality of uniform microfabricated sensing devices having an immobilized ligand receptor |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5089424A (en) | 1988-06-14 | 1992-02-18 | Abbott Laboratories | Method and apparatus for heterogeneous chemiluminescence assay |
| WO1992002551A1 (en) | 1990-08-02 | 1992-02-20 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| WO1992015679A1 (en) | 1991-03-01 | 1992-09-17 | Protein Engineering Corporation | Improved epitode displaying phage |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| WO1993001288A1 (de) | 1991-07-08 | 1993-01-21 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Phagemid zum screenen von antikörpern |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| WO1993011161A1 (en) | 1991-11-25 | 1993-06-10 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5241070A (en) | 1988-09-26 | 1993-08-31 | Ciba Corning Diagnostics Corp. | Nucleophilic polysubstituted aryl acridinium esters and uses thereof |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| WO1994002602A1 (en) | 1992-07-24 | 1994-02-03 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5294404A (en) | 1991-06-03 | 1994-03-15 | Abbott Laboratories | Reagent pack for immunoassays |
| US5304489A (en) | 1987-02-17 | 1994-04-19 | Genpharm International, Inc. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| US5352803A (en) | 1992-03-30 | 1994-10-04 | Abbott Laboratories | 5(6)-methyl substituted fluorescein derivatives |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5468646A (en) | 1986-10-22 | 1995-11-21 | Abbott Laboratories | Chemiluminescent acridinium salts |
| US5480792A (en) | 1990-09-14 | 1996-01-02 | Biosite Diagnostics, Inc. | Antibodies to complexes of ligand receptors and ligands and their utility in ligand-receptor assays |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| US5525524A (en) | 1991-04-10 | 1996-06-11 | Biosite Diagnostics, Inc. | Crosstalk inhibitors and their uses |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5593896A (en) | 1992-03-30 | 1997-01-14 | Abbott Laboratories | Reagents and methods for the detection and quantification of thyroxine in fluid samples |
| WO1997029131A1 (en) | 1996-02-09 | 1997-08-14 | Basf Aktiengesellschaft | HUMAN ANTIBODIES THAT BIND HUMAN TNF$g(a) |
| US5679526A (en) | 1989-01-10 | 1997-10-21 | Biosite Diagnostics Incorporated | Threshold ligand-receptor assay |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| US5723323A (en) | 1985-03-30 | 1998-03-03 | Kauffman; Stuart Alan | Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US5763192A (en) | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| WO1998031700A1 (en) | 1997-01-21 | 1998-07-23 | The General Hospital Corporation | Selection of proteins using rna-protein fusions |
| US5824799A (en) | 1993-09-24 | 1998-10-20 | Biosite Diagnostics Incorporated | Hybrid phthalocyanine derivatives and their uses |
| US5827690A (en) | 1993-12-20 | 1998-10-27 | Genzyme Transgenics Corporatiion | Transgenic production of antibodies in milk |
| US5833985A (en) | 1994-03-07 | 1998-11-10 | Medarex, Inc. | Bispecific molecules for use in inducing antibody dependent effector cell-mediated cytotoxicity |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US5837243A (en) | 1995-06-07 | 1998-11-17 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| US5851776A (en) | 1991-04-12 | 1998-12-22 | Biosite Diagnostics, Inc. | Conjugates and assays for simultaneous detection of multiple ligands |
| US5885527A (en) | 1992-05-21 | 1999-03-23 | Biosite Diagnostics, Inc. | Diagnostic devices and apparatus for the controlled movement of reagents without membrances |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| US5922615A (en) | 1990-03-12 | 1999-07-13 | Biosite Diagnostics Incorporated | Assay devices comprising a porous capture membrane in fluid-withdrawing contact with a nonabsorbent capillary network |
| US5939272A (en) | 1989-01-10 | 1999-08-17 | Biosite Diagnostics Incorporated | Non-competitive threshold ligand-receptor assays |
| US5947124A (en) | 1997-03-11 | 1999-09-07 | Biosite Diagnostics Incorporated | Diagnostic for determining the time of a heart attack |
| WO1999045031A2 (en) | 1998-03-03 | 1999-09-10 | Abgenix, Inc. | Cd147 binding molecules as therapeutics |
| WO1999053049A1 (en) | 1998-04-15 | 1999-10-21 | Abgenix, Inc. | Epitope-driven human antibody production and gene expression profiling |
| US5998209A (en) | 1995-04-21 | 1999-12-07 | Abgenix, Inc. | Generation of large genomic DNA deletions |
| US6017517A (en) | 1996-12-18 | 2000-01-25 | The Dial Corporation | Method for treating human nails |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| US6091001A (en) | 1995-03-29 | 2000-07-18 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
| US6111166A (en) | 1994-09-19 | 2000-08-29 | Medarex, Incorporated | Transgenic mice expressing human Fcα and β receptors |
| US6113855A (en) | 1996-11-15 | 2000-09-05 | Biosite Diagnostics, Inc. | Devices comprising multiple capillarity inducing surfaces |
| WO2000056772A1 (en) | 1999-03-25 | 2000-09-28 | Knoll Gmbh | Human antibodies that bind human il-12 and methods for producing |
| US6130364A (en) | 1995-03-29 | 2000-10-10 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
| US6143576A (en) | 1992-05-21 | 2000-11-07 | Biosite Diagnostics, Inc. | Non-porous diagnostic devices for the controlled movement of reagents |
| US6204023B1 (en) | 1985-11-01 | 2001-03-20 | Xoma Ltd. | Modular assembly of antibody genes, antibodies prepared thereby and use |
| WO2001058956A2 (en) | 2000-02-10 | 2001-08-16 | Abbott Laboratories | Antibodies that bind human interleukin-18 and methods of making and using |
| WO2002002773A2 (en) | 2000-06-29 | 2002-01-10 | Abbott Laboratories | Dual specificity antibodies and methods of making and using |
| US6365116B1 (en) | 1999-01-19 | 2002-04-02 | Nalco Chemical Company | Rheology modification of settled solids in mineral processing |
| US6438498B1 (en) | 2000-02-10 | 2002-08-20 | I-Stat Corporation | System, method and computer implemented process for assaying coagulation in fluid samples |
| US20030170881A1 (en) | 2002-03-05 | 2003-09-11 | I-Stat Corporation | Apparatus and methods for analyte measurement and immuno assay |
| US20030186374A1 (en) | 2001-10-01 | 2003-10-02 | Hufton Simon E. | Multi-chain eukaryotic display vectors and uses thereof |
| US6632926B1 (en) | 1998-11-18 | 2003-10-14 | Genentech, Inc. | Antibody variants |
| US6682928B2 (en) | 1997-12-02 | 2004-01-27 | Medarex, Inc. | Cells expressing anti-Fc receptor binding components |
| US20040018577A1 (en) | 2002-07-29 | 2004-01-29 | Emerson Campbell John Lewis | Multiple hybrid immunoassay |
| US6699658B1 (en) | 1996-05-31 | 2004-03-02 | Board Of Trustees Of The University Of Illinois | Yeast cell surface display of proteins and uses thereof |
| US20050054078A1 (en) | 2003-09-10 | 2005-03-10 | Miller Cary James | Immunoassay device with improved sample closure |
| US6914128B1 (en) | 1999-03-25 | 2005-07-05 | Abbott Gmbh & Co. Kg | Human antibodies that bind human IL-12 and methods for producing |
| US6984720B1 (en) | 1999-08-24 | 2006-01-10 | Medarex, Inc. | Human CTLA-4 antibodies |
| US20060134713A1 (en) | 2002-03-21 | 2006-06-22 | Lifescan, Inc. | Biosensor apparatus and methods of use |
| US20060160164A1 (en) | 2003-09-10 | 2006-07-20 | Miller Cary J | Immunoassay device with immuno-reference electrode |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| WO2016161400A1 (en) | 2015-04-03 | 2016-10-06 | Abbott Laboratories | Devices and methods for sample analysis |
| WO2016161402A1 (en) | 2015-04-03 | 2016-10-06 | Abbott Laboratories | Devices and methods for sample analysis |
| WO2018081649A1 (en) | 2016-10-28 | 2018-05-03 | Banyan Biomarkers, Inc. | Antibodies to ubiquitin c-terminal hydrolase l1 (uch-l1) and glial fibrillary acidic protein (gfap) and related methods |
| US20180313838A1 (en) * | 2017-04-28 | 2018-11-01 | Abbott Laboratories | Methods for aiding in the hyperacute diagnosis and determination of traumatic brain injury using early biomarkers on at least two samples from the same human subject |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3129780A4 (en) * | 2014-04-07 | 2017-12-13 | Iron Horse Diagnostics Inc. | Traumatic brain injury and neurodegenerative biomarkers, methods, and systems |
| CA3261113A1 (en) * | 2017-03-23 | 2025-10-27 | Abbott Laboratories | Methods for aiding in the diagnosis and determination of the extent of traumatic brain injury in a human subject using the early biomarker ubiquitin carboxy-terminal hydrolase l1 |
| WO2018191531A1 (en) * | 2017-04-15 | 2018-10-18 | Abbott Laboratories | Methods for aiding in the hyperacute diagnosis and determination of traumatic brain injury in a human subject using early biomarkers |
| US10866251B2 (en) * | 2017-05-25 | 2020-12-15 | Abbott Laboratories | Methods for aiding in the determination of whether to perform imaging on a human subject who has sustained or may have sustained an injury to the head using early biomarkers |
| JP7269182B2 (ja) * | 2017-05-30 | 2023-05-08 | アボット・ラボラトリーズ | 心臓トロポニンi及び早期バイオマーカーを使用する、ヒト対象における軽度外傷性脳損傷を診断及び査定する一助となるための方法 |
| EP3721233A2 (en) * | 2017-12-09 | 2020-10-14 | Abbott Laboratories | Methods for aiding in the diagnosis and evaluation of a subject who has sustained an orthopedic injury and that has or may have sustained an injury to the head, such as mild traumatic brain injury (tbi), using glial fibrillary acidic protein (gfap) and/or ubiquitin carboxy-terminal hydrolase l1 (uch-l1) |
| JP7379165B2 (ja) * | 2017-12-09 | 2023-11-14 | アボット・ラボラトリーズ | Gfapとuch-l1との組合せを使用する、ヒト対象における外傷性脳損傷を診断及び査定する一助となるための方法 |
-
2022
- 2022-05-18 US US17/747,397 patent/US20220381796A1/en active Pending
- 2022-05-18 BR BR112023024169A patent/BR112023024169A2/pt unknown
- 2022-05-18 WO PCT/US2022/029798 patent/WO2022245920A1/en not_active Ceased
- 2022-05-18 CA CA3216320A patent/CA3216320A1/en active Pending
- 2022-05-18 AU AU2022279156A patent/AU2022279156A1/en active Pending
- 2022-05-18 JP JP2023571582A patent/JP2024519858A/ja active Pending
- 2022-05-18 EP EP22728744.8A patent/EP4341699A1/en active Pending
Patent Citations (135)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US102331A (en) | 1870-04-26 | Improved carpet-tacking machine | ||
| US609631A (en) | 1898-08-23 | schmidt | ||
| US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5824514A (en) | 1985-03-30 | 1998-10-20 | Stuart A. Kauffman | Process for the production of expression vectors comprising at least one stochastic sequence of polynucleotides |
| US5976862A (en) | 1985-03-30 | 1999-11-02 | Ixsys Corporation | Process for obtaining DNA, RNA, peptides, polypeptides, or proteins, by recombinant DNA technique |
| US5814476A (en) | 1985-03-30 | 1998-09-29 | Stuart Kauffman | Process for the production of stochastically-generated transcription or translation products |
| US5817483A (en) | 1985-03-30 | 1998-10-06 | Stuart Kauffman | Process for the production of stochastically-generated peptides,polypeptides or proteins having a predetermined property |
| US5723323A (en) | 1985-03-30 | 1998-03-03 | Kauffman; Stuart Alan | Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof |
| US6204023B1 (en) | 1985-11-01 | 2001-03-20 | Xoma Ltd. | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US5468646A (en) | 1986-10-22 | 1995-11-21 | Abbott Laboratories | Chemiluminescent acridinium salts |
| US5783699A (en) | 1986-10-22 | 1998-07-21 | Abbott Laboratories | Chemiluminescent acridinium salts |
| US5543524A (en) | 1986-10-22 | 1996-08-06 | Abbott Laboratories | Chemiluminescent acridinium salts |
| US5763192A (en) | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
| US5565362A (en) | 1987-02-17 | 1996-10-15 | Pharming B.V. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| US5304489A (en) | 1987-02-17 | 1994-04-19 | Genpharm International, Inc. | DNA sequences to target proteins to the mammary gland for efficient secretion |
| US5994616A (en) | 1987-02-17 | 1999-11-30 | Pharming B.V. | Targeted synthesis of protein in mammary gland of a non-human transgenic mammal |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5006309A (en) | 1988-04-22 | 1991-04-09 | Abbott Laboratories | Immunoassay device with liquid transfer between wells by washing |
| US5089424A (en) | 1988-06-14 | 1992-02-18 | Abbott Laboratories | Method and apparatus for heterogeneous chemiluminescence assay |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5241070A (en) | 1988-09-26 | 1993-08-31 | Ciba Corning Diagnostics Corp. | Nucleophilic polysubstituted aryl acridinium esters and uses thereof |
| US5063081A (en) | 1988-11-14 | 1991-11-05 | I-Stat Corporation | Method of manufacturing a plurality of uniform microfabricated sensing devices having an immobilized ligand receptor |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5939272A (en) | 1989-01-10 | 1999-08-17 | Biosite Diagnostics Incorporated | Non-competitive threshold ligand-receptor assays |
| US5679526A (en) | 1989-01-10 | 1997-10-21 | Biosite Diagnostics Incorporated | Threshold ligand-receptor assay |
| EP0404097A2 (de) | 1989-06-22 | 1990-12-27 | BEHRINGWERKE Aktiengesellschaft | Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US6114598A (en) | 1990-01-12 | 2000-09-05 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US5922615A (en) | 1990-03-12 | 1999-07-13 | Biosite Diagnostics Incorporated | Assay devices comprising a porous capture membrane in fluid-withdrawing contact with a nonabsorbent capillary network |
| WO1991017271A1 (en) | 1990-05-01 | 1991-11-14 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992020791A1 (en) | 1990-07-10 | 1992-11-26 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| WO1992002551A1 (en) | 1990-08-02 | 1992-02-20 | B.R. Centre Limited | Methods for the production of proteins with a desired function |
| US5627052A (en) | 1990-08-02 | 1997-05-06 | B.R. Centre, Ltd. | Methods for the production of proteins with a desired function |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5985579A (en) | 1990-09-14 | 1999-11-16 | Biosite Diagnostics, Inc. | Antibodies to complexes of ligand receptors and ligands and their utility in ligand-receptor assays |
| US5480792A (en) | 1990-09-14 | 1996-01-02 | Biosite Diagnostics, Inc. | Antibodies to complexes of ligand receptors and ligands and their utility in ligand-receptor assays |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| WO1992009690A2 (en) | 1990-12-03 | 1992-06-11 | Genentech, Inc. | Enrichment method for variant proteins with altered binding properties |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1992015679A1 (en) | 1991-03-01 | 1992-09-17 | Protein Engineering Corporation | Improved epitode displaying phage |
| US5658727A (en) | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| US5525524A (en) | 1991-04-10 | 1996-06-11 | Biosite Diagnostics, Inc. | Crosstalk inhibitors and their uses |
| US5851776A (en) | 1991-04-12 | 1998-12-22 | Biosite Diagnostics, Inc. | Conjugates and assays for simultaneous detection of multiple ligands |
| US5294404A (en) | 1991-06-03 | 1994-03-15 | Abbott Laboratories | Reagent pack for immunoassays |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| WO1993001288A1 (de) | 1991-07-08 | 1993-01-21 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Phagemid zum screenen von antikörpern |
| WO1993011161A1 (en) | 1991-11-25 | 1993-06-10 | Enzon, Inc. | Multivalent antigen-binding proteins |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5352803A (en) | 1992-03-30 | 1994-10-04 | Abbott Laboratories | 5(6)-methyl substituted fluorescein derivatives |
| US5359093A (en) | 1992-03-30 | 1994-10-25 | Abbott Laboratories | Reagents and methods for the detection and quantification of thyroxine in fluid samples |
| US5573904A (en) | 1992-03-30 | 1996-11-12 | Abbott Laboratories | 5(6)-Methyl substituted fluorescein derivatives |
| US5496925A (en) | 1992-03-30 | 1996-03-05 | Abbott Laboratories | 5(6)-methyl substituted fluorescein derivatives |
| US5593896A (en) | 1992-03-30 | 1997-01-14 | Abbott Laboratories | Reagents and methods for the detection and quantification of thyroxine in fluid samples |
| US6019944A (en) | 1992-05-21 | 2000-02-01 | Biosite Diagnostics, Inc. | Diagnostic devices and apparatus for the controlled movement of reagents without membranes |
| US6143576A (en) | 1992-05-21 | 2000-11-07 | Biosite Diagnostics, Inc. | Non-porous diagnostic devices for the controlled movement of reagents |
| US5885527A (en) | 1992-05-21 | 1999-03-23 | Biosite Diagnostics, Inc. | Diagnostic devices and apparatus for the controlled movement of reagents without membrances |
| WO1994002602A1 (en) | 1992-07-24 | 1994-02-03 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5824799A (en) | 1993-09-24 | 1998-10-20 | Biosite Diagnostics Incorporated | Hybrid phthalocyanine derivatives and their uses |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| US5849992A (en) | 1993-12-20 | 1998-12-15 | Genzyme Transgenics Corporation | Transgenic production of antibodies in milk |
| US5827690A (en) | 1993-12-20 | 1998-10-27 | Genzyme Transgenics Corporatiion | Transgenic production of antibodies in milk |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5833985A (en) | 1994-03-07 | 1998-11-10 | Medarex, Inc. | Bispecific molecules for use in inducing antibody dependent effector cell-mediated cytotoxicity |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| US6111166A (en) | 1994-09-19 | 2000-08-29 | Medarex, Incorporated | Transgenic mice expressing human Fcα and β receptors |
| US6130364A (en) | 1995-03-29 | 2000-10-10 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
| US6091001A (en) | 1995-03-29 | 2000-07-18 | Abgenix, Inc. | Production of antibodies using Cre-mediated site-specific recombination |
| US5998209A (en) | 1995-04-21 | 1999-12-07 | Abgenix, Inc. | Generation of large genomic DNA deletions |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5837243A (en) | 1995-06-07 | 1998-11-17 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| US6410690B1 (en) | 1995-06-07 | 2002-06-25 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| US6270765B1 (en) | 1995-06-07 | 2001-08-07 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| WO1997029131A1 (en) | 1996-02-09 | 1997-08-14 | Basf Aktiengesellschaft | HUMAN ANTIBODIES THAT BIND HUMAN TNF$g(a) |
| US5985615A (en) | 1996-03-20 | 1999-11-16 | Abgenix, Inc. | Directed switch-mediated DNA recombination |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| US6699658B1 (en) | 1996-05-31 | 2004-03-02 | Board Of Trustees Of The University Of Illinois | Yeast cell surface display of proteins and uses thereof |
| US6303755B1 (en) | 1996-07-11 | 2001-10-16 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-FCA receptor antibodies |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| US6113855A (en) | 1996-11-15 | 2000-09-05 | Biosite Diagnostics, Inc. | Devices comprising multiple capillarity inducing surfaces |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US6017517A (en) | 1996-12-18 | 2000-01-25 | The Dial Corporation | Method for treating human nails |
| WO1998031700A1 (en) | 1997-01-21 | 1998-07-23 | The General Hospital Corporation | Selection of proteins using rna-protein fusions |
| US5947124A (en) | 1997-03-11 | 1999-09-07 | Biosite Diagnostics Incorporated | Diagnostic for determining the time of a heart attack |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US6682928B2 (en) | 1997-12-02 | 2004-01-27 | Medarex, Inc. | Cells expressing anti-Fc receptor binding components |
| WO1999045031A2 (en) | 1998-03-03 | 1999-09-10 | Abgenix, Inc. | Cd147 binding molecules as therapeutics |
| WO1999053049A1 (en) | 1998-04-15 | 1999-10-21 | Abgenix, Inc. | Epitope-driven human antibody production and gene expression profiling |
| WO2000009560A2 (en) | 1998-08-17 | 2000-02-24 | Abgenix, Inc. | Generation of modified molecules with increased serum half-lives |
| US6632926B1 (en) | 1998-11-18 | 2003-10-14 | Genentech, Inc. | Antibody variants |
| WO2000037504A2 (en) | 1998-12-23 | 2000-06-29 | Pfizer Inc. | Human monoclonal antibodies to ctla-4 |
| US6365116B1 (en) | 1999-01-19 | 2002-04-02 | Nalco Chemical Company | Rheology modification of settled solids in mineral processing |
| WO2000056772A1 (en) | 1999-03-25 | 2000-09-28 | Knoll Gmbh | Human antibodies that bind human il-12 and methods for producing |
| US6914128B1 (en) | 1999-03-25 | 2005-07-05 | Abbott Gmbh & Co. Kg | Human antibodies that bind human IL-12 and methods for producing |
| US6984720B1 (en) | 1999-08-24 | 2006-01-10 | Medarex, Inc. | Human CTLA-4 antibodies |
| US6438498B1 (en) | 2000-02-10 | 2002-08-20 | I-Stat Corporation | System, method and computer implemented process for assaying coagulation in fluid samples |
| WO2001058956A2 (en) | 2000-02-10 | 2001-08-16 | Abbott Laboratories | Antibodies that bind human interleukin-18 and methods of making and using |
| WO2002002773A2 (en) | 2000-06-29 | 2002-01-10 | Abbott Laboratories | Dual specificity antibodies and methods of making and using |
| US20030186374A1 (en) | 2001-10-01 | 2003-10-02 | Hufton Simon E. | Multi-chain eukaryotic display vectors and uses thereof |
| US20030170881A1 (en) | 2002-03-05 | 2003-09-11 | I-Stat Corporation | Apparatus and methods for analyte measurement and immuno assay |
| US20060134713A1 (en) | 2002-03-21 | 2006-06-22 | Lifescan, Inc. | Biosensor apparatus and methods of use |
| US20040018577A1 (en) | 2002-07-29 | 2004-01-29 | Emerson Campbell John Lewis | Multiple hybrid immunoassay |
| US20050054078A1 (en) | 2003-09-10 | 2005-03-10 | Miller Cary James | Immunoassay device with improved sample closure |
| US20060160164A1 (en) | 2003-09-10 | 2006-07-20 | Miller Cary J | Immunoassay device with immuno-reference electrode |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| WO2016161400A1 (en) | 2015-04-03 | 2016-10-06 | Abbott Laboratories | Devices and methods for sample analysis |
| WO2016161402A1 (en) | 2015-04-03 | 2016-10-06 | Abbott Laboratories | Devices and methods for sample analysis |
| WO2018081649A1 (en) | 2016-10-28 | 2018-05-03 | Banyan Biomarkers, Inc. | Antibodies to ubiquitin c-terminal hydrolase l1 (uch-l1) and glial fibrillary acidic protein (gfap) and related methods |
| US20180313838A1 (en) * | 2017-04-28 | 2018-11-01 | Abbott Laboratories | Methods for aiding in the hyperacute diagnosis and determination of traumatic brain injury using early biomarkers on at least two samples from the same human subject |
Non-Patent Citations (83)
| Title |
|---|
| ADAMCZYK ET AL., ANAL. CHIM. ACTA, vol. 579, no. 1, 2006, pages 61 - 67 |
| ADAMCZYK ET AL., BIOCONJUGATE CHEM., vol. 11, 2000, pages 714 - 724 |
| ADAMCZYK ET AL., BIOORG. MED CHEM. LETT., vol. 4, 2004, pages 2313 - 2317 |
| ADAMCZYK ET AL., BIOORG. MED. CHEM. LETT., vol. 16, 2006, pages 1324 - 1328 |
| ADAMCZYK ET AL., BIORG. MED. CHEM. LETT, vol. 14, 2004, pages 3917 - 3921 |
| ADAMCZYK ET AL., J. ORG. CHEM., vol. 63, 1998, pages 5636 - 5639 |
| ADAMCZYK ET AL., ORG. LETT., vol. 5, 2003, pages 3779 - 3782 |
| ADAMCZYK ET AL., ORG. LETT., vol. I, 1999, pages 779 - 781 |
| ADAMCZYK ET AL., TETRAHEDRON, vol. 55, 1999, pages 10899 - 10914 |
| AMES ET AL., J. IMMUNOL. METHODS, vol. 184, 1995, pages 177 - 186 |
| BABCOOK ET AL., PROC. NAIL. ACAD. SCI. USA, vol. 93, 1996, pages 7843 - 7848 |
| BABCOOK ET AL., PROC. NATL. ACAD. SCI. USA, vol. 93, 1996, pages 7843 - 7848 |
| BARBAS ET AL., PROC. NAT. ACAD. SCI. USA, vol. 91, 1994, pages 3809 - 3813 |
| BARBAS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 7978 - 7982 |
| BRINKMANN ET AL., J IMMUNOL. METHODS, vol. 182, 1995, pages 41 - 50 |
| BURTON ET AL., ADVANCES IN IMMUNOLOGY, vol. 57, 1994, pages 191 - 280 |
| CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883 |
| CHOTHIALESK, MOL. BIOI.., vol. 196, 1987, pages 901 - 917 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CONRAD ET AL., PLANT MOL. BIOL., vol. 38, 1998, pages 101 - 109 |
| CRAMER ET AL., CURR. TOP. MICROBIOL. IMMUNOL., vol. 240, 1999, pages 95 - 118 |
| EREN ET AL., IMMUNOL, vol. 93, 1998, pages 154 - 161 |
| FUNARO ET AL., BMC BIOTECHNOLOGY, no. 8, 2008, pages 315 - 322 |
| GARRARD ET AL., BIO/TECHNOLOGY, vol. 9, 1991, pages 1373 - 1377 |
| GRAM ET AL., PROC. NAIL. ACA . SCI. USA, vol. 89, 1992, pages 3576 - 3580 |
| GRAY ET AL., J. IMM. METH., vol. 182, 1995, pages 155 - 163 |
| GREEN ET AL., NATURE GENETICS, vol. 7, 1994, pages 13 - 21 |
| GREENJAKOBOVITS, J. EXP. MED., vol. 188, 1998, pages 483 - 495 |
| GRIFFITHS ET AL., UMBO J., vol. 12, 1993, pages 725 - 734 |
| HAMMERLING ET AL.: "Monoclonal Antibodies and T-Cell Hybridomas", 1981, ELSEVIER |
| HANES ET AL., PROC. NAIL. ACAD SCI. USA, vol. 95, 1998, pages 14130 - 14135 |
| HANES ET AL., PROC. NAIL. ACAD. SCI. USA, vol. 94, 1997, pages 4937 - 4942 |
| HARLOW ET AL.: "Antibodies: A laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| HAWKINS ET AL., J. MOL. BIOL., vol. 226, 1992, pages 889 - 896 |
| HAY ET AL., HUM. ANTIBOD. HYBRIDOMAS, vol. 3, 1992, pages 81 - 85 |
| HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, no. 14, 1993, pages 7995 - 7999 |
| HOOD ET AL., ADV. EXP. MED. BIOL., vol. 464, 1999, pages 127 - 147 |
| HOOGENBOOM ET AL., NUCL. ACIDS RES.., vol. 19, 1991, pages 4133 - 4137 |
| HUSE ET AL., SCIENCE, vol. 246, 1989, pages 1275 - 1281 |
| HUSTON ET AL., METHODS IN ENZYMOLOGY, vol. 203, 1991, pages 46 - 88 |
| HUSTON ET AL., PNAS USA, vol. 85, 1988, pages 5879 - 5883 |
| JACKSON ET AL., J. IMMUNOL., vol. 154, no. 7, pages 3310 - 3319 |
| KABAT ET AL., SEQUENCES OF PROTEINS OF IMMUNOLOGICAL INTEREST (NATIONAL INSTITUTES OF HEALTH. BETHESDA, MD., 1987 |
| KAUFMANSHARP, J MOL. BIOL., vol. 159, 1982, pages 601 - 621 |
| KAUTTNANSHARP, MOL. BIOL., vol. 159, 1982, pages 601 - 621 |
| KENNY ET AL., BIO/TECHNOL., vol. 13, 1995, pages 787 - 790 |
| KETTLEBOROUGH ET AL., EUR.J. IMMUNOL., vol. 24, 1994, pages 952 - 958 |
| MACCALLUM, J. MOL. BIOL., vol. 262, no. 5, 1996, pages 732 - 745 |
| MARKS ET AL., BIOTECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MATTINGLV ET AL.: "Luminescence Biotechnology: Instruments and Applications", 2002, CRC PRESS, pages: 77 - 105 |
| MATTINGLY, J. BIOLUMIN. CHEMILUMIN., vol. 6, 1991, pages 107 - 114 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554 |
| MCCAPRA ET AL., PHOTOCHEM. PHOTOBIOL., vol. 4, no. 11, 1965, pages 11 - 21 |
| MENDEZ ET AL., NATURE GENETICS, vol. 15, 1997, pages 146 - 156 |
| METZGER RYAN R. ET AL: "Temporal response profiles of serum ubiquitin C-terminal hydrolase-L1 and the 145-kDa alpha II-spectrin breakdown product after severe traumatic brain injury in children", JOURNAL OF NEUROSURGERY. PEDIATRICS, vol. 22, no. 4, 1 October 2018 (2018-10-01), US, pages 369 - 374, XP055951102, ISSN: 1933-0707, DOI: 10.3171/2018.4.PEDS17593 * |
| MILSTEIN, NATURE, vol. 305, no. 5934, 1983, pages 537 - 540 |
| MULLINAX ET AL., BIOTECHNIQUES, vol. 12, no. 6, 1992, pages 864 - 869 |
| NGUYEN ET AL., MICROBIOL. IMMUNOL., vol. 41, 1997, pages 901 - 907 |
| PADLAN, FASEB J., vol. 9, 1995, pages 133 - 139 |
| PAPA LINDA ET AL: "Evaluating glial and neuronal blood biomarkers GFAP and UCH-L1 as gradients of brain injury in concussive, subconcussive and non-concussive trauma: a prospective cohort study", BMJ PAEDIATRICS OPEN, vol. 3, no. 1, 1 August 2019 (2019-08-01), pages e000473, XP055951121, Retrieved from the Internet <URL:https://bmjpaedsopen.bmj.com/content/bmjpo/3/1/e000473.full.pdf> DOI: 10.1136/bmjpo-2019-000473 * |
| PERSIC ET AL., GENE, vol. 187, 1997, pages 9 - 18 |
| POWELL ET AL., BIOTECHNOL, vol. 8, 1990, pages 333 - 337 |
| RAZAVI ET AL., LUMINESCENCE, vol. 15, 2000, pages 239 - 244 |
| RHINE TARA ET AL: "2443 : Investigating markers of early traumatic brain injury (iMet): An interim analysis", JOURNAL OF CLINICAL AND TRANSLATIONAL SCIENCE, vol. 1, no. S1, 1 September 2017 (2017-09-01), pages 78 - 78, XP055951100, DOI: 10.1017/cts.2017.276 * |
| RHINE TARA ET AL: "Are UCH-L1 and GFAP promising biomarkers for children with mild traumatic brain injury?", BRAIN INJURY, vol. 30, no. 10, 23 August 2016 (2016-08-23), GB, pages 1231 - 1238, XP055951118, ISSN: 0269-9052, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5818714/pdf/nihms831590.pdf> DOI: 10.1080/02699052.2016.1178396 * |
| RHINE TARA ET AL: "Investigating Markers of Early Traumatic Brain Injury (iMet)", PEDIATRICS, 1 August 2019 (2019-08-01), pages 1 - 4, XP055951099, Retrieved from the Internet <URL:https://publications.aap.org/pediatrics/article/144/2_MeetingAbstract/429/3499/Investigating-Markers-of-Early-Traumatic-Brain> [retrieved on 20220812] * |
| ROBERTSSZOSTAK, PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 12297 - 12302 |
| SANDHU ET AL., CRIL. REV. BIOTECHNOL., vol. 16, 1996, pages 95 - 118 |
| SAWAI ET AL., AM. J. REPROD. IMMUNOL., vol. 34, 1995, pages 26 - 34 |
| SCHIER ET AL., GENE, vol. 169, 1995, pages 147 - 155 |
| SKERRA ET AL., SCIENCE, vol. 240, 1988, pages 1038 - 1041 |
| STAERZ ET AL., NATURE, vol. 314, no. 6012, 1985, pages 628 - 631 |
| STEENBAKKERS ET AL., MOLEC. BIOL. REPORTS, vol. 19, 1994, pages 125 - 134 |
| URLAUBCHASIN, PROC NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220 |
| URLAUBCHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220 |
| WELLS: "High Throughput Bioanalytical Sample Preparation. Methods and Automation Strategies", 2003, ELSEVIER |
| WEN ET AL., J IMMUNOL., vol. 17, 1987, pages 887 - 892 |
| WINNAKER, FROM GENES TO CLONES, 1987 |
| WU ET AL., NATURE BIOTECH.., vol. 25, 2007, pages 1290 - 1297 |
| WU, C.. ET AL., NATURE BIOTECHNOLOGY, vol. 25, no. 11, 2007, pages 1290 - 1297 |
| YELTON ET AL., J. IMMUNOL., vol. 155, 1995, pages 1994 - 2004 |
| ZAPATA ET AL., PROTEIN ENG., vol. 8, no. 10, 1995, pages 1057 - 1062 |
| ZHANG NANHUA ET AL: "Investigating Markers of Early Traumatic Brain Injury (iMet)", ARCHIVES OF PHYSICAL MEDICINE AND REHABILITATION, ELSEVIER, AMSTERDAM, NL, vol. 99, no. 11, 26 October 2018 (2018-10-26), XP085513971, ISSN: 0003-9993, DOI: 10.1016/J.APMR.2018.08.038 * |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2024519858A (ja) | 2024-05-21 |
| BR112023024169A2 (pt) | 2024-02-06 |
| WO2022245920A9 (en) | 2023-01-19 |
| US20220381796A1 (en) | 2022-12-01 |
| AU2022279156A1 (en) | 2023-11-02 |
| EP4341699A1 (en) | 2024-03-27 |
| AU2022279156A9 (en) | 2023-11-16 |
| CA3216320A1 (en) | 2022-11-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20260072042A1 (en) | Methods for aiding in diagnosing and evaluating a traumatic brain injury in a human subject using a combination of gfap and uch-l1 | |
| US20250020665A1 (en) | Methods for aiding in the determination of whether to perform imaging on a human subject who has sustained or may have sustained an injury to the head using early biomarkers | |
| EP3610268B1 (en) | Methods for aiding in the hyperacute diagnosis and determination of traumatic brain injury in a human subject using early biomarkers | |
| EP3635407B1 (en) | Methods for aiding in the hyperacute diagnosis and determination of traumatic brain injury using early biomarkers on at least two samples from the same human subject | |
| EP3631466A1 (en) | Methods for aiding in diagnosing and evaluating a mild traumatic brain injury in a human subject using cardiac troponin i and early biomarkers | |
| WO2018175942A1 (en) | Methods for aiding in the diagnosis and determination of the extent of traumatic brain injury in a human subject using the early biomarker ubiquitin carboxy-terminal hydrolase l1 | |
| US20250003988A1 (en) | Use of one or more biomarkers to determine traumatic brain injury (tbi) in a human subject having received a head computerized tomography scan that is negative for a tbi | |
| US20240094226A1 (en) | Biomarkers for use in determining traumatic brain injury (tbi) | |
| US20230213536A1 (en) | Use of biomarkers to determine sub-acute traumatic brain injury (tbi) in a subject having received a head computerized tomography (ct) scan that is negative for a tbi or no head ct scan | |
| EP3602069A1 (en) | Methods for aiding in the diagnosis and determination of the extent of traumatic brain injury in a human subject using the early biomarker ubiquitin carboxy-terminal hydrolase l1 | |
| US20220381796A1 (en) | Methods of evaluating brain injury in a pediatric subject | |
| US20240110928A1 (en) | Biomarkers and methods for differentiating between mild and supermild traumatic brain injury | |
| WO2023102384A1 (en) | Use of one or more biomarkers to determine traumatic brain injury (tbi) in a subject having received a head computerized tomography scan that is negative for a tbi | |
| EP4441509A1 (en) | Use of one or more biomarkers to determine traumatic brain injury (tbi) in a subject having received a head computerized tomography scan that is negative for a tbi | |
| AU2021390474A1 (en) | Use of one or more biomarkers to determine traumatic brain injury (tbi) in a subject having received a head computerized tomography scan that is negative for a tbi |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22728744 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 804519 Country of ref document: NZ Ref document number: 2022279156 Country of ref document: AU Ref document number: AU2022279156 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3216320 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022279156 Country of ref document: AU Date of ref document: 20220518 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023571582 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280036556.9 Country of ref document: CN |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023024169 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022728744 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022728744 Country of ref document: EP Effective date: 20231218 |
|
| ENP | Entry into the national phase |
Ref document number: 112023024169 Country of ref document: BR Kind code of ref document: A2 Effective date: 20231117 |