WO2022236134A1 - Anti-il-27 antibodies and uses thereof - Google Patents
Anti-il-27 antibodies and uses thereof Download PDFInfo
- Publication number
- WO2022236134A1 WO2022236134A1 PCT/US2022/028189 US2022028189W WO2022236134A1 WO 2022236134 A1 WO2022236134 A1 WO 2022236134A1 US 2022028189 W US2022028189 W US 2022028189W WO 2022236134 A1 WO2022236134 A1 WO 2022236134A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- binding portion
- antigen binding
- set forth
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present disclosure relates generally to compositions and methods for modulating IL-27 signaling. More particularly, the present disclosure relates to immunogenic compositions (e.g., antibodies, antibody fragments, and the like) that bind to IL-27 and modulate IL-27 signaling.
- immunogenic compositions e.g., antibodies, antibody fragments, and the like
- T cells such as T cells, macrophages, and natural killer cells
- Tumor-specific or -associated antigens can induce immune cells to recognize and eliminate malignancies (Chen & Mellman, (2013) Immunity 39(1): 1-10).
- IL-27 is a heterodimeric cytokine, composed of two subunits (EBI3 and IL-27p28).
- IL-27 is structurally related to both the IL-12 and IL-6 cytokine families. IL-27 binds to and mediates signaling through a heterodimer receptor consisting of IL-27Ra (WSX1) and gpl30 chains, which mediate signaling predominantly through STAT1 and STAT3.
- WSX1 IL-27Ra
- gpl30 chains which mediate signaling predominantly through STAT1 and STAT3.
- Initial reports characterized IL-27 as an immune-enhancing cytokine that supports CD4+ T cell proliferation, T helper (Th)l cell differentiation, and IFN-g production, often acting in concert with IL-12. Subsequent studies have shown that IL-27 displays complex immunomodulatory functions, resulting in either proinflammatory or anti-inflammatory effects depending on the biological context and experimental models being used.
- IL-27 may drive the expression of different immune- regulatory molecules in human cancer cells, which may support local derangement of the immune response in vivo (Fabbi et al., (2017) Mediators Inflamm 3958069. Published online 2017 Feb 1. doi:10.1155/2017/3958069, and references contained therein).
- Some aspects of the present disclosure are directed to a method of stimulating an immune response in a subject, the method comprising administering to the subject an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof specifically binds to an epitope comprising one or more amino acids of (i) amino acids 37 to 56 corresponding to SEQ ID NO: 2 (IL-27p28), (ii) amino acids 142 to 164 corresponding to SEQ ID NO: 2 (IL-27p28), or (iii) both (i) and (ii); wherein the antibody or antigen binding portion thereof is administered at a dose of at least about 0.003 mg/kg to at least about 20 mg/kg.
- Some aspects of the present disclosure are directed to a method of treating a cancer in a subject in need thereof comprising administering to the subject an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof specifically binds to an epitope comprising one or more amino acids of (i) amino acids 37 to 56 corresponding to SEQ ID NO: 2 (IL-27p28), (ii) amino acids 142 to 164 corresponding to SEQ ID NO: 2 (IL-27p28), or (iii) both (i) and (ii); wherein the antibody or antigen binding portion thereof is administered at a dose of at least about 0.003 mg/kg to at least about 20 mg/kg.
- the antibody or antigen binding portion thereof is administered at a dose of at least about 0.003 mg/kg, at least about 0.006 mg/kg, at least about 0.009 mg/kg, at least about 0.03 mg/kg, at least about 0.06 mg/kg, at least about 0.09 mg/kg, at least about 0.3 mg/kg, at least about 0.6 mg/kg, at least about 0.9 mg/kg, at least about 1.0 mg/kg, at least about 2 mg/kg, at least about 3 mg/kg, at least about 4 mg/kg, at least about 5 mg/kg, at least about 6 mg/kg, at least about 7 mg/kg, at least about 8 mg/kg, at least about 9 mg/kg, at least about 10 mg/kg, at least about 11 mg/kg, at least about 12 mg/kg, at least about 13 mg/kg, at least about 14 mg/kg, at least about 15 mg/kg, at least about 16 mg/kg, at least about 17 mg/kg, at least about 18 mg/kg, at least about
- the antibody or antigen binding portion thereof is administered once about every week, once about every two weeks, once about every three weeks, once about every four weeks, once about every 6 weeks, once about every 8 weeks, or once about every 12 weeks.
- the antibody or antigen binding portion thereof is administered once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 0.3 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 1 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 3 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 6 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 10 mg/kg once about every four weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 13 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 16 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 20 mg/kg once about every four weeks.
- the antibody or antigen binding portion thereof inhibits or reduces
- the antibody or antigen binding portion thereof inhibits or reduces inhibition of CD161 expression in a cell in the subject. In some aspects, the antibody or antigen binding portion thereof inhibits or reduces PD-L1 expression in a cell in the subject. In some aspects, the antibody or antigen binding portion thereof induces or enhances PD-1 mediated secretion of one or more cytokines from a cell in the subject. In some aspects, the anti-IL-27 antibody alters the expression of TIM-3 in a cell. In some aspects, the cell is a tumor cell or an immune cell.
- the epitope comprises one or more amino acids of Gln37, Leu38,
- the epitope comprises Aspl46, Argl49, and/or Phel53 of SEQ ID NO: 2 (IL-27p28). In some aspects, the epitope further comprises Hisl50 and/or Leul56 of SEQ ID NO: 2 (IL-27p28).
- the epitope further comprises Gln37, Leu38, Glu42, Leul42, and/or Glul64 of SEQ ID NO: 2 (IL-27p28). In some aspects, the epitope further comprises Glu46, Val49, Ser50, and/or Leul62 of SEQ ID NO: 2 (IL-27p28). In some aspects, the epitope consists or consists essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu 142, Asp 146, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL- 27p28).
- the epitope further comprises one or more amino acids of Leu53, Lys56, Asp 143, Leu 147, Argl52, Alal57, Glyl59, Phel60, or Asnl61 of SEQ ID NO: 2 (IL-27p28). In some aspects, the epitope further comprises one or more amino acids of Leu53, Lys56, Aspl43, Argl45, Leu 147, Argl52, Alal57, Glyl59, Phel60, Asnl61, or Prol63 of SEQ ID NO: 2 (IL- 27p28).
- the epitope consists or consists essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leu 156, Alal57, Glyl59, Phel60, Asnl61, Leul62, and Glul64 of SEQ ID NO: 2 (IL- 27p28).
- the epitope consists or consists essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64,of SEQ ID NO: 2 (IL-27p28).
- the antibody or the antigen binding portion thereof comprise heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein (i) light chain CDR1 consists of N-XXXXXXLFSSNXKXYXX-C, light chain CDR3 consists of N-XXXASAXXX-C, heavy chain CDR2 consists of N- XXSSSXSYXYXXXXXXX-C, and heavy chain CDR3 consists of N- XXXXGRTSYTATXHNXXXX-C, wherein X is any amino acids.
- the antibody or the antigen binding portion thereof comprises a heavy chain CDR3 comprising the sequence set forth in SEQ ID NO: 121 or 124. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain CDR2 comprising the sequence set forth in SEQ ID NO: 120 or 123. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain CDR1 comprising the sequence set forth in SEQ ID NO: 119 or 122. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain CDR3 comprising the sequence set forth in SEQ ID NO: 129 or 132.
- the antibody or the antigen binding portion thereof comprises a light chain CDR2 comprising the sequence set forth in SEQ ID NO: 128 or 131. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain CDR1 comprising the sequence set forth in SEQ ID NO: 127 or 130.
- the antibody or the antigen binding portion thereof comprises: (a) a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120, and a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 121; or (b) a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, and a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124.
- the antibody or the antigen binding portion thereof comprises: (a) a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 127, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 128, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 129; or (b) a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- the antibody or the antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 121, a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 127, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 128, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 129.
- the antibody or the antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124 a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- the antibody or the antigen binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence that has at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 125. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 125.
- the antibody or the antigen binding portion thereof comprises a light chain variable region comprising an amino acid sequence that has at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 133.
- the antibody or the antigen binding portion thereof comprises a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 133.
- the antibody or the antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 125 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 133.
- the antibody or the antigen binding portion thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 135. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 139. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain comprising the amino acid sequence set forth in SEQ ID NO: 137. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 135 and a light chain comprising the amino acid sequence set forth in SEQ ID NO: 137. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 139 and a light chain comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the cancer is selected from lung cancer (e.g., non-small cell lung cancer), sarcoma, testicular cancer, ovarian cancer, pancreas cancer, breast cancer (e.g., triple negative breast cancer), melanoma, head and neck cancer (e.g., squamous head and neck cancer), colorectal cancer, bladder cancer, endometrial cancer, prostate cancer, thyroid cancer, hepatocellular carcinoma (HCC), gastric cancer, brain cancer, lymphoma (e.g., DL-BCL), leukemia (e.g., AML), renal cancer (e.g., renal cell carcinoma (RCC), e.g., clear cell RCC and/or non-clear cell RCC), and any combination thereof.
- lung cancer e.g., non-small cell lung cancer
- sarcoma testicular cancer
- ovarian cancer pancreas cancer
- breast cancer e.g., triple negative breast cancer
- melanoma melanoma
- the method further comprises administering an additional therapeutic agent to the subject.
- the additional therapeutic agent is administered before the antibody or antigen-binding portion thereof, after the antibody or antigen-binding portion thereof, or concurrently with the antibody or antigen-binding portion thereof.
- the additional therapeutic agent comprises a chemotherapy, a targeted anti-cancer therapy, an oncolytic drug, a cytotoxic agent, an immune-based therapy, a cytokine, surgical procedure, a radiation procedure, an activator of a costimulatory molecule, an inhibitor of an inhibitory molecule, a vaccine, a cellular immunotherapy, a biologic agent, or a combination thereof.
- the additional therapeutic agent comprises a PD-1 antagonist, a PD-L1 inhibitor, a TIM-3 inhibitor, a LAG-3 inhibitor, a TIGIT inhibitor, a CD112R inhibitor, a TAM inhibitor, a STING agonist, a 4- IBB agonist, or a combination thereof.
- the additional therapeutic agent comprises a PD-1 antagonist.
- the PD-1 antagonist is selected from the group consisting of: PDR001, nivolumab, pembrolizumab, pidilizumab, MEDI0680, REGN2810, TSR-042, PF-06801591, and AMP-224.
- the PD-L1 inhibitor is selected from the group consisting of: FAZ053, Atezolizumab, Avelumab, Durvalumab, and BMS-936559.
- the additional therapeutic agent is selected from the group consisting of Sunitinib (SUTENT ® ), Cabozantinib (CABOMETYX ® ), Axitinib (INLYTA ® ), Lenvatinib (LENVIMA ® ), Everolimus (AFINITOR ® ), Bevacizumab (AVASTIN ® ), epacadostat, NKTR-214 (CD-122-biased agonist), Tivozanib (FOTIVDA ® ), abexinostat, Ipilimumab (YERVOY ® ), tremelimumab, Pazopanib (VOTRIENT ® ), Sorafenib (NEXAVAR ® ), Temsirolimus (TORISEL ® ), Ramucirumab (CYRAMZA ® ), niraparib, savolitinib, vorolanib (X-82), Regorafenib
- the additional therapeutic agent is a TIM-3 inhibitor.
- the TIM-3 inhibitor is MGB453 or TSR-022.
- the additional therapeutic agent is a LAG-3 inhibitor.
- the LAG-3 inhibitor is selected from the group consisting of LAG525, BMS-986016, and TSR-033.
- the additional therapeutic agent is a TIGIT inhibitor.
- the additional therapeutic agent is a CD112R inhibitor.
- the additional therapeutic agent is a TAM (Axl, Mer, Tyro) inhibitor.
- the additional therapeutic agent is a 4- IBB agonist.
- the additional therapeutic agent is a Tyrosine Kinase Inhibitor (TKI).
- the subject exhibits increased expression of one or more biomarkers selected from the group consisting of EBI3, IL-27, TNFa, MIP-la (CCL3), IFN ⁇ , IL-10, IL-6, and any combination thereof; wherein the increased expression of the one or more biomarkers is relative to the expression of the one or more biomarker prior to the administration.
- the subject exhibits increased expression of EBI3; wherein the increased expression EBI3 is relative to the expression EBI3 prior to the administration.
- the subject exhibits increased expression of one or more biomarkers selected from the group consisting of Eotaxin-1 (CCL11), TARC (CCL17), VEGF-A, IL-7, IL-8, MCP-1, MCP-4, and any combination thereof; wherein the increased expression of the one or more biomarkers is relative to the expression of the one or more biomarker prior to the administration.
- the subject exhibits increased expression of Eotaxin-1 (CCL11), wherein the increased expression of Eotaxin-1 (CCL11) is relative to the expression of Eotaxin-1 (CCL11) prior to the administration.
- the subject exhibits an increased circulating level of IFN ⁇ , relative to the circulating level of!FNy prior to the administration.
- FIGs. 1A-1C are schematics of a phase 1 dose-escalation study for an anti-IL-27 antibody.
- ccRCC clear cell renal cell carcinoma
- CR complete response
- HCC hepatocellular carcinoma
- N number
- PR partial response
- pts patients
- RP2D recommended Phase 2 dose
- 2L second line.
- FIG. 2 is a Swimmer's plot showing the time on study and RECIST response grouped by starting dose.
- FIG. 3 is a waterfall plot illustrating the best percentage change in target lesions from baseline.
- FIG. 4 is a graphical representation of the pharmacokinetics of anti-IL-27 Abl administered at doses of 0.03, 0.1, 0.3, 1, 3, and 10 mg/kg.
- FIGs. 5A-5B are graphical representation of T cells gated using an anti-CD-3 antibody (FIG. 5A) and analyzed using an anti-pSTATl Y701 antibody, as compared to pre-dose (FIG. 5B).
- FIG.s 5C-5D are bar graphs illustrating pSTATl inhibition following administration of 0.1 mg/kg (FIG. 5C) or 1 mg/kg (FIG. 5D) anti-IL-27 Abl predose and up to cycle 2, day 1.
- FIGs. 6A-6F are images of target lesions (target lesion 1, FIGs.
- FIGs. 6A-6C target lesion 2, FIGs 6C-6F; arrows) in a 64-year-old patient with squamous cell non-small cell lung cancer with metastases to the mediastinal nodes, lung, and pleura who was enrolled at 10 mg/kg.
- FIGs. 6A and 6D are images at baseline
- FIGs. 6B and 6E are images at week 8
- FIGs. 6C and 6F are images at week 12.
- FIG. 7 is s a Swimmer’s plot depicting time on study and RECIST response grouped by starting dose of the 29 patients enrolled in a dose escalation study.
- the median time on study was 9 weeks (with a range of 1 to 71 weeks).
- FIGs. 8A-8B show target lesion changes over time.
- FIG. 8B is a spider plot depicting the target lesion change from baseline over time.
- FIGs. 9A-9B are graphical representations of anti-IL-27 Abl monotherapy dose escalation response.
- FIG. 9A is a waterfall plot depeciting the best percentage chaine in sum of target lesions.
- FIG. 9B is a spider plot depicting the lesion change over time.
- FIGs. 10A-10B are graphical representation of the anti-IL-27 Abl pharmokinetic profile.
- FIG. 10A shows Cycle 1 anti-IL-27 Abl PK by dose regimen, irrespective of tumor type.
- FIG. 10B shows the PK of anti-IL-27 Abl when given once every four weeks as monotherapy in the dose escalation phase of the study (mixed solid tumors) and in the HCC and ccRCC expansions.
- FIGs. 11A-11B are graphical representations of anti-IL-27 Abl ccRCC monotherapy dose escalation response.
- FIG. 11A is a waterfall plot depeciting the best percentage chaine in sum of target lesions.
- FIG. 11B is a spider plot depicting the lesion change over time.
- FIGs. 12 A-12B are graphical representations of anti-IL-27 Ab 1 HCC monotherapy response.
- FIG. 12A is a waterfall plot depeciting the best percentage chaine in sum of target lesions.
- FIG. 12B is a spider plot depicting the lesion change over time.
- FIGs. 13A is graphical representation of IL-27-dependent pSTATl inhibition in T cells from the blood of a patient following adminstration of 0.1 mg/kg, 1.0 mg/kg, and 3.0 mg/kg of an anti-IL-27 antibody (y-axis) and the corresponding serum levels of the anti-IL-27 antibody (x-axis) after anti-IL-27 antibody administration.
- the vertical dotted line represents the serum concentration of anti-IL27 antibody that results in 90% inhibition (IC90) of IL-27-dependent pSTATl inhibition (0.7 ⁇ g/ml).
- FIGs. 13B-13D show the pharmacokinetic analysis of anti-IL-27 antibody in the serum of subjects following repeated administration of 0.1 mg/kg (FIG.
- FIG. 13B The serum level of anti-IL-27 antibody required to achieve the IC90 for IL-27-dependent inhibition of pSTATl in T cells from the blood of a subject is indicated by the horizontal dotted line in FIGs. 13B-13D.
- FIG. 14A is a graphical representation of Eotaxin-1 fold-change at C1D1 6-hour post dose time-point, relative to baseline, for patients exhibiting progressive disease (PD), stable disease (SD), or partial response (PR) following administration of varying doses of anti-IL-27 Ab 1.
- FIG. 14B is a graphical representation of a longitudinal analysis of Eotaxin-1 fold-change over baseline across C1D1 (predose and 6 hours post dose), C1D8, C2D1 (predose and 6 hours post dose), and C3D1 timepoints. The data for the patient exhibiting a partial response is labelled as "PR.” Each data set represents a single patient.
- FIG. 15 shows IL-27 fold-change levels over baseline at various visits, times, and dosage cohorts for anti-IL-27 Abl monotherapy patients.
- FIG. 16 shows circulating IFN ⁇ fold-change levels over baseline at various visits and times for lOmg/kg anti-IL-27 Abl monotherapy patients.
- FIGs. 17A-17F are graphical representations of fold-change expression relative to baseline of TARC (CCL17; FIG. 17A), VEGF-A (FIG. 17B), IL-7 (FIG. 17C), IL-8 (FIG. 17D), MCP-1 (FIG. 17E), and MCP-4 (FIG. 17F) in samples obtained from pateints admininstered anti- IL-27 Ab 1.
- FIG. 17G is a waterfall plot showing the percent change from baseline in target lesions for patients characterized in FIGs. 17A-17F. Data corresponding to a confirmed partial response (PR; 902-002) patient and a stable disease (SD; 901-008) patient exhibiting tumor reduction are labelled (FIGs. 17A-17G).
- FIGs. 18A-18B are graphical representations of longitudinal analyses of IL-7
- TARC CCL17
- VEGF-A FGF-A
- IL-8 IL-8
- MCP-1 MCP-4
- FIG. 18B TARC
- PR partial response
- SD patient with stable disease
- FIG. 18A-18B Data corresponding to a patient with stable disease (PR; 902-002) and a patient with stable disease (SD; 901-008) but exhibiting tumor reduction are labelled (FIGs. 18A-18B).
- FIG. 19 is a scatter plot illustrating IL-27-induced changes in gene expression from two individuals.
- FIGs. 20A-20C are scatter plots illustrating changes in gene expression from two individuals following contact with IL-27 heterodimer (FIG. 20A), EBI3 alone (FIG. 20B), or IL- 35 (FIG. 20C).
- FIGs. 21A-21B are volcano plots representing a gene set enrichment analysis of the
- FIG. 21A highlights (gray) enrichment of mRNA signatures associated with interferon signaling.
- FIG. 21B highlights (gray) hallmark IFNa signature genes.
- FIG. 22A-22H are graphical representations of single cell RNA-sequencing analysis of PBMCs stimulated with anti-CD3 (0.25 ⁇ g/ml) in vitro in the presence or absence of rhIL-27 (100 ng/ml).
- FIG. 22A shows the clustering of the various types of immune cells.
- FIG. 22B is a volcano plot illustrating IL-27-mediated gene expression changes identified in the total PBMC population, which included many interferon-stimulated genes.
- FIGs. 22C-22H are volcano plots illustrating the downregulation and upregulation of IL-27 signature genes in the immune cell subsets of NK cells (FIG. 22C), CD4 + T cells (FIG. 22D), B cells (FIG. 22E), monocytes (FIG. 22F), CD8 + T cells (FIG. 22G) and Treg cells (FIG. 22H).
- FIGs. 23A-23B are bar graphs illustrating assessment of IL-17A (FIG. 23 A) and
- IFN-g (FIG. 23B) in cultured supernatents of pooled PBMCs activated in the presence of anti-CD3 (0.25 ⁇ g/ml) and anti-PD-1 (1 ⁇ g/ml) in the presence of various cytokines (100 ng/ml; x-axis) for 4 days.
- FIG. 24A shows the clustering of the various types of immune cells based on single cell RNA-seq analysis of IL27 expression.
- FIG. 24B is a scatter plot showing an MF2 macrophage gene signature associated with progressive disease contains several interferon-stimulated genes and is highly enriched in IL27-positive vs IL27-negative macrophages.
- FIGs. 24C-24E are graphical representations illustrating increased expression of IL27 in macrophages from patients with progressive disease (FIG. 24C); in macrophages from metastatic and primary tumors compared to normal tissue (FIG. 24F); and in macrophages from patients with Stage IV disease (FIG. 24E).
- FIG. 24C shows the clustering of the various types of immune cells based on single cell RNA-seq analysis of IL27 expression.
- FIG. 24B is a scatter plot showing an MF2 macrophage gene signature associated with progressive disease contains several interferon-stimulated genes and is highly enriched in IL27-
- FIG. 24F is a volcano plot illustrating the MF2 signature genes (gray) of IL-27 stimulated monocyte-derived macrophages in vitro.
- FIGs. 24G-24H are images of immunohistochemistry for IL-27 on tissue microarrays showing positive expression in macrophages in the TME of lung adenocarcinoma (AdenoCa; FIG. 24G) and squamous cell carcinoma (SCC; FIG. 24H).
- FIG. 25 A shows the clustering of the various types of cells in the tumor microenvironment based on single-cell RNA-seq analysis of IL27 expression.
- FIG. 25B is a violin plot of IL27RA expression in different cell populations compared to tumor cells.
- FIG. 25C is a violin plot of IL27RA expression in tumor cells from patients with progressive disease compared to tumor cells from patients with residual disease or who are treatment naive.
- FIG. 26A is a bar graph illustrating IL27RA mRNA transcript expression across the Cancer Cell Line Encyclopedia (CCLE) for various lung cancer cell lines including NCI- 112228.
- FIGs. 26B-26C are graphical representations illustrating pSTATl levels (FIG. 26B) and PDL1 expression (FIG. 26C) in NCI-H2228 lung cancer cells after IL-27 stimulation.
- FIG. 26D is a graphical representation of microarray profiling of NCI-H228 cells cultured in the presence or absence of IL-27 for 48 hrs. Several interferon-responsive genes are flagged (FIG. 26D).
- the antibody or antigen binding portion thereof specifically binds to an epitope comprising one or more amino acids of (i) amino acids 37 to 56 corresponding to SEQ ID NO: 2 (IL-27p28), (ii) amino acids 142 to 164 corresponding to SEQ ID NO: 2 (IL-27p28), or (iii) both (i) and (ii).
- agonist refers to any molecule that partially or fully promotes, induces, increases, and/or activates a biological activity of a native polypeptide disclosed herein.
- Suitable agonist molecules specifically include agonist antibodies or antibody fragments, fragments or amino acid sequence variants of native polypeptides, peptides or proteins. In some aspects, activation in the presence of the agonist is observed in a dose-dependent manner.
- the measured signal (e.g., biological activity) is at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 100% higher than the signal measured with a negative control under comparable conditions. Also disclosed herein, are methods of identifying agonists suitable for use in the methods of the disclosure.
- binding assays such as enzyme-linked immuno-absorbent assay (ELISA), FORTE BIO® systems, and radioimmunoassay (RIA).
- ELISA enzyme-linked immuno-absorbent assay
- RIA radioimmunoassay
- binding assays determine the ability of an agonist to bind the polypeptide of interest (e.g., a receptor or ligand) and therefore indicate the ability of the agonist to promote, increase or activate the activity of the polypeptide.
- Efficacy of an agonist can also be determined using functional assays, such as the ability of an agonist to activate or promote the function of the polypeptide.
- a functional assay may comprise contacting a polypeptide with a candidate agonist molecule and measuring a detectable change in one or more biological activities normally associated with the polypeptide.
- the potency of an agonist is usually defined by its ECso value (concentration required to activate 50% of the agonist response). The lower the EC so value the greater the potency of the agonist and the lower the concentration that is required to activate the maximum biological response.
- alanine scanning refers to a technique used to determine the contribution of a specific wild-type residue to the stability or function(s) (e.g., binding affinity) of given protein or polypeptide.
- the technique involves the substitution of an alanine residue for a wild-type residue in a polypeptide, followed by an assessment of the stability or function(s) (e.g., binding affinity) of the alanine-substituted derivative or mutant polypeptide and comparison to the wild-type polypeptide.
- Techniques to substitute alanine for a wild-type residue in a polypeptide are known in the art.
- ameliorating refers to any therapeutically beneficial result in the treatment of a disease state, e.g., cancer, including prophylaxis, lessening in the severity or progression, remission, or cure thereof.
- amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, g- carboxyglutamate, and O-phosphoserine.
- Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function in a manner similar to a naturally occurring amino acid.
- amino acids can be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-EJB Biochemical Nomenclature Commission. Nucleotides, likewise, can be referred to by their commonly accepted single-letter codes.
- amino acid substitution refers to the replacement of at least one existing amino acid residue in a predetermined amino acid sequence (an amino acid sequence of a starting polypeptide) with a second, different “replacement” amino acid residue.
- amino acid insertion refers to the incorporation of at least one additional amino acid into a predetermined amino acid sequence.
- insertion will usually consist of the insertion of one or two amino acid residues
- larger “peptide insertions” can also be made, e.g. insertion of about three to about five or even up to about ten, fifteen, or twenty amino acid residues.
- the inserted residue(s) may be naturally occurring or non- naturally occurring as disclosed above.
- An “amino acid deletion” refers to the removal of at least one amino acid residue from a predetermined amino acid sequence.
- the term “amount” or “level” is used in the broadest sense and refers to a quantity, concentration or abundance of a substance (e.g., a metabolite, a small molecule, a protein, an mRNA, a marker).
- the terms “amount”, “level” and “concentration” are generally used interchangeably and generally refer to a detectable amount in a biological sample.
- “Elevated levels” or “increased levels” refers to an increase in the quantity, concentration or abundance of a substance within a sample relative to a control sample, such as from an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control.
- the elevated level of a substance (e.g., a drug) in a sample refers to an increase in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g., HPLC).
- Reduced levels refers to a decrease in the quantity, concentration or abundance of a substance (e.g., a drug) in an individual relative to a control, such as from an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control. In some aspects, a reduced level is little or no detectable quantity, concentration or abundance.
- the reduced level of a substance (e.g., a drug) in a sample refers to a decrease in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g, HPLC).
- the terms “level of expression” or “expression level” in general are used interchangeably and generally refer to a detectable amount of a protein, mRNA, or marker in a biological sample.
- a detectable amount or detectable level of a protein, mRNA or a marker is associated with a likelihood of a response to an agent, such as those described herein.
- “Expression” generally refers to the process by which information contained within a gene is converted into the structures (e.g., a protein marker, such as PD-L1) present and operating in the cell.
- expression may refer to transcription into a polynucleotide, translation into a polypeptide, or even polynucleotide and/or polypeptide modifications (e.g., posttranslational modification of a polypeptide). Fragments of the transcribed polynucleotide, the translated polypeptide, or polynucleotide and/or polypeptide modifications (e.g., posttranslational modification of a polypeptide) shall also be regarded as expressed whether they originate from a transcript generated by alternative splicing or a degraded transcript, or from a post-translational processing of the polypeptide, e.g., by proteolysis.
- “Expressed genes” include those that are transcribed into a polynucleotide as mRNA and then translated into a polypeptide, and also those that are transcribed into RNA but not translated into a polypeptide (for example, transfer and ribosomal RNAs).
- “Elevated expression,” “elevated expression levels,” or “elevated levels” refers to an increased expression or increased levels of a substance within a sample relative to a control sample, such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control.
- the elevated expression of a substance refers to an increase in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g., FACS).
- Reduced expression refers to a decrease expression or decreased levels of a substance (e.g., a protein marker) in an individual relative to a control, such as an individual or individuals who are not suffering from the disease or disorder (e.g., cancer) or an internal control. In some aspects, reduced expression is little or no expression.
- a substance e.g., a protein marker
- reduced expression is little or no expression.
- the reduced expression of a substance refers to a decrease in the amount of the substance of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% relative to the amount of the substance in a control sample, as determined by techniques known in the art (e.g, FACS).
- a substance e.g., a protein marker
- angiogenesis or "neovascularization” refers to the process by which new blood vessels develop from pre-existing vessels (Varner et al., (1999) Angiogen. 3:53-60; Mousa et al., (2000 ) Angiogen. Stint. Jnhih. 35:42-44; Kim et al., (2000) Amer. ,/. Path. 156:1345-1362; Kim et al, (2000) J Biol Chem. 275:33920-33928; Kumar et al. (2000) Angiogenesis: Prom Molecular to Integrative Pharm. 169-180).
- Endothelial cells from pre existing blood vessels or from circulating endothelial stem cells become activated to migrate, proliferate, and differentiate into structures with lumens, forming new blood vessels, in response to growth factor or hormonal cues, or hypoxic or ischemic conditions.
- endothelial stem cells become activated to migrate, proliferate, and differentiate into structures with lumens, forming new blood vessels, in response to growth factor or hormonal cues, or hypoxic or ischemic conditions.
- ischemia such as occurs in cancer, the need to increase oxygenation and delivery of nutrients apparently induces the secretion of angiogenic factors by the affected tissue; these factors stimulate new blood vessel formation.
- antagonist refers to an inhibitor of a target molecule and may be used synonymously herein with the term “inhibitor.”
- the term “antagonist” refers to any molecule that partially or fully blocks, inhibits, or neutralizes a biological activity of a native polypeptide disclosed herein.
- Suitable antagonist molecules specifically include antagonist antibodies or antibody fragments, fragments or amino acid sequence variants of native polypeptides, peptides or proteins. In some aspects, inhibition in the presence of the antagonist is observed in a dose-dependent manner.
- the measured signal (e.g., biological activity) is at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 100% lower than the signal measured with a negative control under comparable conditions. Also disclosed herein, are methods of identifying antagonists suitable for use in the methods of the disclosure.
- these methods include, but are not limited to, binding assays such as enzyme-linked immuno-absorbent assay (ELISA), ForteBio®sy stems, radioimmunoassay (RIA), Meso Scale Discovery assay (e.g., Meso Scale Discovery Electrochemiluminescence (MSD-ECL), and bead-based Luminex ® assay.
- binding assays such as enzyme-linked immuno-absorbent assay (ELISA), ForteBio®sy stems, radioimmunoassay (RIA), Meso Scale Discovery assay (e.g., Meso Scale Discovery Electrochemiluminescence (MSD-ECL), and bead-based Luminex ® assay.
- binding assays such as enzyme-linked immuno-absorbent assay (ELISA), ForteBio®sy stems, radioimmunoassay (RIA), Meso Scale Discovery assay (e.g., Meso Scale Discovery Electrochemiluminescence (MSD
- Efficacy of an antagonist can also be determined using functional assays, such as the ability of an antagonist to inhibit the function of the polypeptide or an agonist.
- a functional assay may comprise contacting a polypeptide with a candidate antagonist molecule and measuring a detectable change in one or more biological activities normally associated with the polypeptide.
- the potency of an antagonist is usually defined by its IC50 value (concentration required to inhibit 50% of the agonist response). The lower the IC50 value the greater the potency of the antagonist and the lower the concentration that is required to inhibit the maximum biological response.
- the phrase "antibody that antagonizes human IL-27, or an antigen binding portion thereof' refers to an antibody that antagonizes at least one art-recognized activity of human IL-27 (e.g., IL-27 biological activity and/or downstream pathway(s) mediated by IL-27 signaling or other IL-27-mediated function), for example, relating to a decrease (or reduction) in human IL-27 activity that is at least 5%, 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more. Additional examples of IL-27 biological activities and/or downstream pathway(s) mediated by IL-27 signaling or other IL-27-mediated function are described in additional detail below and elsewhere herein.
- anti-IL-27 antagonist antibody (interchangeably termed
- anti-IL-27 antibody refers to an antibody that specifically binds to IL-27 and inhibits IL-27 biological activity and/or downstream pathway(s) mediated by IL-27 signaling or other IL-27- mediated function.
- An anti-IL-27 antagonist antibody encompasses antibodies that block, antagonize, suppress, inhibit or reduce an IL-27 biological activity (e.g., ligand binding, enzymatic activity), including downstream pathways mediated by IL-27 signaling or function, such as receptor binding and/or elicitation of a cellular response to IL-27 or its metabolites.
- an anti-IL-27 antagonist antibody binds to human IL-27 and prevents, blocks, or inhibits binding of human IL-27 to its cognate or normal receptor (e.g., IL-27 receptor), or one or more receptor subunits (e.g., gpl30 and/or IL-27Ra (also known as WSX1/TCCR)).
- the anti-IL-27 antagonist antibody prevents, blocks, or inhibits the binding of human IL-27 to the gpl30.
- the anti-IL-27 antagonist antibody prevents, blocks, or inhibits the binding of human IL-27 to the IL-27Ra.
- the anti- IL-27 antagonist antibody prevents, blocks, or inhibits the dimerization of IL-27 monomers. In some aspects, the anti-IL-27 antibody does not specifically bind to the EBI3 monomer. In some aspects, the anti-IL-27 antibody specifically binds to the IL-27p28 monomer. In some aspects, the anti-IL-27 antibody specifically binds to a non-contiguous epitope comprising P28, but does not bind to the EBI3 monomer. In some aspects, the anti-IL-27 antibody inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell.
- the anti-IL-27 antibody inhibits or reduces inhibition of CD161 expression in a cell (e.g., ameliorates or relieves IL-27 mediated inhibition of CD161 expression in a cell). In some aspects, the anti-IL-27 antibody inhibits or reduces PD-L1 expression in a cell. In some aspects, the anti-IL-27 induces or enhances PD-1- mediated secretion of one or more cytokines from a cell. In some aspects, the anti-IL-27 antibody alters the expression of TIM-3 in a cell. In some aspects, an anti-IL-27 antagonist antibody binds to human IL-27 and stimulates or enhances an anti-tumor response.
- the anti-IL- 27 antagonist antibody binds to human IL-27 with an affinity of 15nM or less. In some aspects, the anti-IL-27 antagonist antibody binds to human IL-27 and comprises a wild type or mutant IgGl heavy chain constant region or a wild type or mutant IgG4 heavy chain constant region. Examples of anti-IL-27 antagonist antibodies are provided herein.
- antibody refers to a whole antibody comprising two light chain polypeptides and two heavy chain polypeptides. Whole antibodies include different antibody isotypes including IgM, IgG, IgA, IgD, and IgE antibodies.
- antibody includes a polyclonal antibody, a monoclonal antibody, a chimerized or chimeric antibody, a humanized antibody, a primatized antibody, a deimmunized antibody, and a fully human antibody.
- the antibody can be made in or derived from any of a variety of species, e.g., mammals such as humans, non-human primates (e.g., orangutan, baboons, or chimpanzees), horses, cattle, pigs, sheep, goats, dogs, cats, rabbits, guinea pigs, gerbils, hamsters, rats, and mice.
- the antibody can be a purified or a recombinant antibody.
- the term "antibody fragment,” "antigen-binding fragment,” or similar terms refer to a fragment of an antibody that retains the ability to bind to a target antigen (e.g., IL-27) and inhibit the activity of the target antigen.
- a target antigen e.g., IL-27
- Such fragments include, e.g., a single chain antibody, a single chain Fv fragment (scFv), an Fd fragment, an Fab fragment, an Fab’ fragment, or an F(ab’)2 fragment.
- An scFv fragment is a single polypeptide chain that includes both the heavy and light chain variable regions of the antibody from which the scFv is derived.
- intrabodies, minibodies, triabodies, and diabodies are also included in the definition of antibody and are compatible for use in the methods described herein. See, e.g., Todorovska et ak, (2001) J. Immunol. Methods 248(l):47-66; Hudson and Kortt, (1999) J Immunol.
- antibody fragment also includes, e.g., single domain antibodies such as camelized single domain antibodies. See, e.g., Muyldermans et ak, (2001) Trends Biochem. Sci. 26:230-235; Nuttall et ak, (2000) Curr. Pharm. Biotech. 1:253-263; Reichmann et al., (1999) J Immunol. Meth. 231:25-38; PCT application publication nos. WO 94/04678 and WO 94/25591; and U.S. patent no. 6,005,079, all of which are incorporated herein by reference in their entireties.
- an antigen-binding fragment includes the variable region of a heavy chain polypeptide and the variable region of a light chain polypeptide.
- an antigen-binding fragment described herein comprises the CDRs of the light chain and heavy chain polypeptide of an antibody.
- APC antigen presenting cell
- T cells recognize this complex using T cell receptor (TCR).
- APCs include, but are not limited to, B cells, dendritic cells (DCs), peripheral blood mononuclear cells (PBMC), monocytes (such as THP-1), B lymphoblastoid cells (such as C1R.A2, 1518 B-LCL) and monocyte-derived dendritic cells (DCs).
- DCs dendritic cells
- PBMC peripheral blood mononuclear cells
- monocytes such as THP-1
- B lymphoblastoid cells such as C1R.A2, 1518 B-LCL
- DCs monocyte-derived dendritic cells
- antigen presentation refers to the process by which APCs capture antigens and enables their recognition by T cells, e.g., as a component of an MHC -I and/or MHC- II conjugate.
- apoptosis refers to the process of programmed cell death that occurs in multicellular organisms (e.g. humans).
- the highly regulated biochemical and molecular events that result in apoptosis can lead to observable and characteristic morphological changes to a cell, including membrane blebbing, cell volume shrinkage, chromosomal DNA condensation and fragmentation, and mRNA decay.
- a common method to identify cells, including T cells, undergoing apoptosis is to expose cells to a fluorophore-conjugated protein (Annexin V). Annexin V is commonly used to detect apoptotic cells by its ability to bind to phosphatidylserine on the outer leaflet of the plasma membrane, which is an early indicator that the cell is undergoing the process of apoptosis.
- B cell refers to a type of white blood cell of the lymphocyte subtype.
- B cells function in the humoral immunity component of the adaptive immune system by secreting antibodies.
- B cells also present antigen and secrete cytokines.
- B cells unlike the other two classes of lymphocytes, T cells and natural killer cells, express B cell receptors (BCRs) on their cell membrane. BCRs allow the B cell to bind to a specific antigen, against which it will initiate an antibody response.
- binds to immobilized IL-27 refers to the ability of an antibody of the disclosure to bind to IL-27, for example, expressed on the surface of a cell or which is attached to a solid support.
- bispecific or bifunctional antibody refers to an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites.
- Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai & Lachmann, (1990) Clin. Exp. Immunol. 79:315- 321; Kostelny et al., (1992) J. Immunol. 148:1547-1553.
- bispecific antibodies are based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chain/light chain pairs have different specificities (Milstein and Cuello, (1983) Nature 305:537- 539).
- Antibody variable domains with the desired binding specificities can be fused to immunoglobulin constant domain sequences.
- the fusion of the heavy chain variable region is preferably with an immunoglobulin heavy-chain constant domain, including at least part of the hinge, CH2, and CH3 regions.
- Bispecific antibodies also include cross-linked or heteroconjugate antibodies. Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in U.S. Pat. No. 4,676,980, along with a number of cross-linking techniques. [0080] Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers. See, e.g., Kostelny et ak (1992) J Immunol 148(5): 1547- 1553.
- the leucine zipper peptides from the Fos and Jun proteins may be linked to the Fab' portions of two different antibodies by gene fusion.
- the antibody homodimers may be reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers.
- the "diabody” technology described by Hollinger et ak (1993) Proc Natl Acad Sci USA 90:6444-6448 has provided an alternative mechanism for making bispecific antibody fragments.
- the fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain.
- the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites.
- Another strategy for making bispecific antibody fragments by the use of single-chain Fv (scFv) dimers has also been reported. See, e.g., Gruber et al. (1994) J Immunol 152:5368.
- the antibodies can be "linear antibodies” as described in, e.g., Zapata et al. (1995) Protein Eng. 8(10): 1057-1062. Briefly, these antibodies comprise a pair of tandem Fd segments (VH-CH1-VH-CH1) which form a pair of antigen binding regions. Linear antibodies can be bispecific or monospecific.
- Antibodies with more than two valencies are contemplated and described in, e.g., Tutt et al. (1991) J Immunol 147:60.
- the disclosure also embraces variant forms of multi-specific antibodies such as the dual variable domain immunoglobulin (DVD-Ig) molecules described in Wu et al. (2007) Nat Biotechnol 25(11): 1290-1297.
- DVD-Ig molecules are designed such that two different light chain variable domains (VL) from two different parent antibodies are linked in tandem directly or via a short linker by recombinant DNA techniques, followed by the light chain constant domain.
- the heavy chain comprises two different heavy chain variable domains (VH) linked in tandem, followed by the constant domain CHI and Fc region.
- the bispecific antibody is a Fabs-in-Tandem immunoglobulin, in which the light chain variable region with a second specificity is fused to the heavy chain variable region of a whole antibody.
- Such antibodies are described in, e.g., International Patent Application Publication No. WO 2015/103072.
- cancer antigen refers to (i) tumor- specific antigens, (ii) tumor- associated antigens, (iii) cells that express tumor- specific antigens, (iv) cells that express tumor- associated antigens, (v) embryonic antigens on tumors, (vi) autologous tumor cells, (vii) tumor- specific membrane antigens, (viii) tumor- associated membrane antigens, (ix) growth factor receptors, (x) growth factor ligands, and (xi) any other type of antigen or antigen- presenting cell or material that is associated with a cancer.
- cancer-specific immune response refers to the immune response induced by the presence of tumors, cancer cells, or cancer antigens.
- the response includes the proliferation of cancer antigen specific lymphocytes.
- the response includes expression and upregulation of antibodies and T-cell receptors and the formation and release of lymphokines, chemokines, and cytokines. Both innate and acquired immune systems interact to initiate antigenic responses against the tumors, cancer cells, or cancer antigens.
- the cancer-specific immune response is a T cell response.
- carcinoma is art recognized and refers to malignancies of epithelial or endocrine tissues including respiratory system carcinomas, gastrointestinal system carcinomas, genitourinary system carcinomas, testicular carcinomas, breast carcinomas, prostatic carcinomas, endocrine system carcinomas, and melanomas.
- the anti-IL-27 antibodies described herein can be used to treat patients who have, who are suspected of having, or who may be at high risk for developing any type of cancer, including renal carcinoma or melanoma, or any viral disease.
- Exemplary carcinomas include those forming from tissue of the cervix, lung, prostate, breast, head and neck, colon and ovary.
- carcinosarcomas which include malignant tumors composed of carcinomatous and sarcomatous tissues.
- An "adenocarcinoma” refers to a carcinoma derived from glandular tissue or in which the tumor cells form recognizable glandular structures.
- CD112R refers to a member of poliovirus receptor-like proteins and is a co-inhibitory receptor for human T cells.
- CD112R is an inhibitory receptor primarily expressed by T cells and NK cells and competes for CD112 binding with the activating receptor CD226.
- the interaction of CD112 with CD112R is of higher affinity than with CD226 and thereby effectively regulates CD226 mediated cell activation.
- Anti-CD112R antagonists that block the interaction with CD112 limit inhibitory signaling directly downstream of CD112R while simultaneously promoting greater immune cell activation by increasing CD226 interactions with CD 112.
- CD112R inhibitor refers to an agent that disrupts, blocks or inhibits the biological function or activity of CD112R.
- CD137 refers to a member of the tumor necrosis factor (TNF) receptor superfamily.
- 4- IBB is a co-stimulatory immune checkpoint molecule, primarily for activated T cells. Crosslinking of CD137 enhances T cell proliferation, IL-2 secretion, survival and cytolytic activity.
- 4-1BB agonist refers to an agent that stimulates, induces or increases one or more function of 4-1BB.
- An exemplary 4-1BB agonist is Utomilumab (PF-05082566), a fully human IgG2 monoclonal antibody that targets this 4-1BB to stimulate T cells.
- CD161 refers to a member of the C- type lectin superfamily.
- CD161 is a marker of T cells and CD161 expression has been associated with T cell infiltration into the tumor microenvironment for a number of different cancer types. CD161 is further described in Fergusson et ah, (2014) Cell Reports 9(3): 1075-1088, which is incorporated herein by reference it its entirety.
- IL-27 or "interleukin 27” refers to the IL-27 cytokine.
- IL-27 is related to the IL-6/IL-12 cytokine families, and is a heterodimeric cytokine that comprises a first subunit known as Epstein-Barr Virus Induced Gene 3 (EBI3; also known as IL-27 subunit b and IL-27B) and a second subunit known as IL-27p28 (also known as IL30, IL-27 subunit a and IL-27A).
- EBI3 Epstein-Barr Virus Induced Gene 3
- IL-27p28 also known as IL30, IL-27 subunit a and IL-27A
- IL-27 is predominantly synthesized by activated antigen-presenting cells including monocytes, endothelial cells and dendritic cells (Jankowski et al. (2010) Arch Immunol. Ther. Exp. 58:417-425, Diakowski et al. (2013) Adv. Clin. Exp.
- IL-27 can have proinflammatory effects, many studies suggest an important role of IL-27 as an immunosuppressive agent (Shimizu et al. (2006) J. Immunol. 176:7317-7324, Hisada et al. (2004) Cancer Res. 64:1152-1156, Diakowski (2013) supra). Although it was initially described as a factor promoting the initiation of Thl responses, IL-27 was later found to play a major T-cell suppressive function by limiting Thl responses, inhibiting Th2 and Thl 7 cell differentiation, and regulating the development of Trl and other T regulatory cell populations (Dietrich et al. (2014) J. Immunol. 192:5382-5389). In addition to its role as an immunoregulator, IL-27 also regulates angiogenesis, hematopoiesis, and osteocalstogenesis (Id.).
- IL-27 signals through a heterodimeric type I cytokine receptor (the IL-27 receptor or IL-27R) that comprises a first subunit known as WSX1 (also known as IL-27 receptor subunit a, IL-27RA, T-Cell Cytokine Receptor Type 1 (TCCR), and Cytokine Receptor-Like 1 (CRLl)) and a second subunit known as gpl30 (also known as Interleukin-6 Signal Transducer (IL6ST), Interleukin-6 Receptor Subunit b (IL-6RB), and Oncostatin M Receptor).
- WSX1 also known as IL-27 receptor subunit a, IL-27RA, T-Cell Cytokine Receptor Type 1 (TCCR), and Cytokine Receptor-Like 1 (CRLl)
- gpl30 also known as Interleukin-6 Signal Transducer (IL6ST), Interleukin-6 Receptor Subunit b
- gpl30 is also a receptor subunit for the IL-6 family cytokines (Liu et al. (2008) Scan. J. Immunol. 68:22-299, Diakowski (2013) supra).
- IL-27 signaling through IL-27R activates multiple signaling cascades, including the JAK-STAT and p38 MAPK pathways.
- EBI3 is also believed to have biological functions independent of p28 or the IL-27 heterodimer.
- EBI3 also interacts with p35 to form the heterodimeric cytokine IL-35 (Yoshida et al. (2015) Annu. Rev Immunol. 33:417-43) and has been shown to be selectively overexpressed in certain cell types without a corresponding increase in p28 or IL-27 (Larousserie et al. (2005) Am. J. Pathol. 166(4): 1217-28).
- An amino acid sequence of an exemplary human p28 protein is provided in SEQ ID NO: 2 (NCBI Reference Sequence: NP 663634.2; N- mgqtagdlgwrlsllllplllvqagvwgfprppgrpqlslqelrreftvslhlarkllsevrgqahrfaeshlpgvnlyllplgeqlpdvsltf qawrrlsdperlcfisttlqpfhallgglgtqgrwtnmermqlwamrldlrdlqrhlrfqvlaagfnlpeeeeeeeeeeerkgllpgalg salqgpaqvswpqllstyrllhslelvlsravrellllskaghsvwplgfptlspqp-C).
- NP_004834.1 N- mrggrgapfwlwplpklallpllwvlfqrtrpqgsagplqcygvgplgdlncsweplgdlgapselhlqsqkyrsnktqtvavaagrs wvaipreqltmsdkllvwgtkagqplwppvfvnletqmkpnaprlgpdvdfseddpleatvhwapptwpshkvlicqfhyrrcqea awtllepelktipltpveiqdlelatgykvygrcrmekeedlwgewspilsfqtppsapkdvwvsgnlcgtpggeeplllwkapgpcv qvsykvwfwvggrelspegitcccslipsga
- SEQ ID NO: 4 An amino acid sequence of an exemplary human gpl30 protein is provided in SEQ ID NO: 4 (NCBI Reference Sequence: NP_002175.2; N- mltlqtwlvqalfiflttestgelldpcgyispespvvqlhsnftavcvlkekcmdyfhvnanyivwktnhftipkeqytiinrtassvtftd iaslniqltcniltfgqleqnvygitiisglppekpknlscivnegkkmrcewdggrethletnftlksewathkfadckakrdtptsctvd ystvyfvnievwveaenalgkvtsdhinfdpvykvkpnpphnlsvinseelssilkltwtnpsik
- an assay e.g., a competitive binding assay; a cross-blocking assay
- a test antigen-binding protein e.g., a test antibody
- inhibits e.g., reduces or blocks
- a reference antigen-binding protein e.g., a reference antibody
- a polypeptide or amino acid sequence "derived from” a designated polypeptide or protein refers to the origin of the polypeptide.
- the polypeptide or amino acid sequence which is derived from a particular sequence has an amino acid sequence that is essentially identical to that sequence or a portion thereof, wherein the portion consists of at least 10-20 amino acids, preferably at least 20-30 amino acids, more preferably at least 30-50 amino acids, or which is otherwise identifiable to one of ordinary skill in the art as having its origin in the sequence.
- Polypeptides derived from another peptide may have one or more mutations relative to the starting polypeptide, e.g., one or more amino acid residues which have been substituted with another amino acid residue or which has one or more amino acid residue insertions or deletions.
- a polypeptide can comprise an amino acid sequence which is not naturally occurring. Such variants necessarily have less than 100% sequence identity or similarity with the starting molecule. In certain aspects, the variant will have an amino acid sequence from about 75% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of the starting polypeptide, more preferably from about 80% to less than 100%, more preferably from about 85% to less than 100%, more preferably from about 90% to less than 100% (e.g., 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%) and most preferably from about 95% to less than 100%, e.g., over the length of the variant molecule.
- the antibodies of the disclosure are encoded by a nucleotide sequence.
- Nucleotide sequences of the disclosure can be useful for a number of applications, including: cloning, gene therapy, protein expression and purification, mutation introduction, DNA vaccination of a host in need thereof, antibody generation for, e.g., passive immunization, PCR, primer and probe generation, and the like.
- the antibodies suitable for use in the methods disclosed herein may be altered such that they vary in sequence from the naturally occurring or native sequences from which they were derived, while retaining the desirable activity of the native sequences.
- nucleotide or amino acid substitutions leading to conservative substitutions or changes at "non-essential" amino acid residues may be made.
- Mutations may be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis.
- the antibodies suitable for use in the methods disclosed herein may comprise conservative amino acid substitutions at one or more amino acid residues, e.g., at essential or non- essential amino acid residues.
- a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid
- a nonessential amino acid residue in a binding polypeptide is preferably replaced with another amino acid residue from the same side chain family.
- a string of amino acids can be replaced with a structurally similar string that differs in order and/or composition of side chain family members.
- mutations may be introduced randomly along all or part of a coding sequence, such as by saturation mutagenesis, and the resultant mutants can be incorporated into binding polypeptides of the disclosure and screened for their ability to bind to the desired target.
- antigen cross-presentation refers to presentation of exogenous protein antigens to T cells via MHC class I and class II molecules on APCs.
- cross-reacts refers to the ability of an antibody of the disclosure to bind to IL-27 from a different species.
- an antibody of the present disclosure which binds human IL-27 may also bind another species of IL-27.
- cross-reactivity is measured by detecting a specific reactivity with purified antigen in binding assays (e.g., SPR, ELISA) or binding to, or otherwise functionally interacting with, cells physiologically expressing IL-27.
- Methods for determining cross-reactivity include standard binding assays as described herein, for example, by BiacoreTM surface plasmon resonance (SPR) analysis using a BiacoreTM 2000 SPR instrument (Biacore AB, Uppsala, Sweden), or flow cytometric techniques.
- SPR surface plasmon resonance
- cytotoxic T lymphocyte (CTL) response refers to an immune response induced by cytotoxic T cells. CTL responses are mediated primarily by CD8 + T cells.
- DC dendritic cell
- BM bone marrow
- MHC major histocompatibility complex
- DCs are heterogeneous, e.g. myeloid and plasmacytoid DCs; although all DCs are capable of antigen uptake, processing and presentation to naive T cells, the DC subtypes have distinct markers and differ in location, migratory pathways, detailed immunological function and dependence on infections or inflammatory stimuli for their generation.
- Thl polarized T-helper 1
- dendritic cell activation refers to the transition from immature to mature dendritic cell; and the activated dendritic cells encompass mature dendritic cells and dendritic cells in the process of the transition, wherein the expression of CD80 and CD86 that induce costimulatory signals are elevated by the activating stimuli.
- Mature human dendritic cells are cells that are positive for the expression of CD40, CD80, CD86, and HLA-class II (e.g., HLA-DR).
- An immature dendritic cell can be distinguished from a mature dendritic cell, for example, based on markers selected from the group consisting of CD80 and CD86.
- An immature dendritic cell is weakly positive and preferably negative for these markers, while a mature dendritic cell is positive. Discrimination of mature dendritic cells is routinely performed by those skilled in the art, and the respective markers described above and methods for measuring their expression are also well known to those skilled in the art.
- ECso refers to the concentration of an antibody or an antigen-binding portion thereof, which induces a response, either in an in vitro or an in vivo assay, which is 50% of the maximal response, i.e., halfway between the maximal response and the baseline.
- the term "effective dose” or “effective dosage” is defined as an amount sufficient to achieve or at least partially achieve the desired effect.
- therapeutically effective dose is defined as an amount sufficient to cure or at least partially arrest the disease and its complications in a patient already suffering from the disease. Amounts effective for this use will depend upon the severity of the disorder being treated and the general state of the patient’s own immune system.
- epitope or “antigenic determinant” refers to a site on an antigen to which an immunoglobulin or antibody specifically binds.
- epitope mapping refers to a process or method of identifying the binding site, or epitope, of an antibody, or antigen binding fragment thereof, on its target protein antigen. Epitope mapping methods and techniques are provided herein. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein.
- Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
- An epitope typically includes at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation.
- Methods for determining what epitopes are bound by a given antibody i.e., epitope mapping
- epitope mapping include, for example, immunoblotting and immunoprecipitation assays, wherein overlapping or contiguous peptides from IL-27 are tested for reactivity with the given anti- IL-27 antibody.
- Methods of determining spatial conformation of epitopes include techniques in the art and those described herein, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance (see, e.g., Epitope Mapping Protocols inMethods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).
- antibodies that bind to an epitope on IL-27 which comprises all or a portion of an epitope recognized by the particular antibodies described herein (e.g., the same or an overlapping region or a region between or spanning the region).
- antibodies that bind the same epitope and/or antibodies that compete for binding to human IL-27 with the antibodies described herein are also encompassed by the present disclosure.
- Antibodies that recognize the same epitope or compete for binding can be identified using routine techniques. Such techniques include, for example, an immunoassay, which shows the ability of one antibody to block the binding of another antibody to a target antigen, i.e., a competitive binding assay.
- Competitive binding is determined in an assay in which the immunoglobulin under test inhibits specific binding of a reference antibody to a common antigen, such as IL-27.
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay see Stahli et al., Methods in Enzymology 9:242 (1983)
- solid phase direct biotin-avidin EIA see Kirkland et al., J. Immunol. 137:3614 (1986)
- solid phase direct labeled assay solid phase direct labeled sandwich assay
- solid phase direct labeled sandwich assay see Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988)
- solid phase direct label RIA using 1-125 label see Morel et al., Mol. Immunol.
- Other techniques include, for example, epitope mapping methods, such as, x-ray analyses of crystals of antigemantibody complexes which provides atomic resolution of the epitope and mass spectrometry combined with hydrogen/deuterium (H/D) exchange which studies the conformation and dynamics of antigemantibody interactions.
- Other methods monitor the binding of the antibody to antigen fragments or mutated variations of the antigen where loss of binding due to a modification of an amino acid residue within the antigen sequence is often considered an indication of an epitope component.
- computational combinatorial methods for epitope mapping can also be used. These methods rely on the ability of the antibody of interest to affinity isolate specific short peptides from combinatorial phage display peptide libraries. The peptides are then regarded as leads for the definition of the epitope corresponding to the antibody used to screen the peptide library.
- computational algorithms have also been developed which have been shown to map conformational discontinuous epitopes.
- Fc-mediated effector functions or “Fc effector functions” refer to the biological activities of an antibody other than the antibody’s primary function and purpose.
- the effector functions of a therapeutic agnostic antibody are the biological activities other than the activation of the target protein or pathway.
- antibody effect functions include Clq binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); lack of activation of platelets that express Fc receptor; and B cell activation. Many effector functions begin with Fc binding to an Fey receptor.
- the tumor antigen-targeting antibody has effector function, e.g., ADCC activity.
- a tumor antigen-targeting antibody described herein comprises a variant constant region having increased effector function (e.g. increased ability to mediate ADCC) relative to the unmodified form of the constant region.
- the term "Fc receptor” refers to a polypeptide found on the surface of immune effector cells, which is bound by the Fc region of an antibody.
- the Fc receptor is an Fey receptor.
- FcyRI CD64
- FcyRII CD32
- FycRIII CD 16
- IgG isotypes IgGl, IgG2, IgG3 and IgG4
- FcyRIIB is an inhibitory receptor, and therefore antibody binding to this receptor does not activate complement and cellular responses.
- FcyRI is a high affinity receptor that binds to IgG in monomeric form
- FcyRIIA and FcyRIIA are low affinity receptors that bind IgG only in multimeric form and have slightly lower affinity.
- the binding of an antibody to an Fc receptor and/or Clq is governed by specific residues or domains within the Fc regions. Binding also depends on residues located within the hinge region and within the CH2 portion of the antibody.
- the agonistic and/or therapeutic activity of the antibodies described herein is dependent on binding of the Fc region to the Fc receptor (e.g., FcyR).
- the agonistic and/or therapeutic activity of the antibodies described herein is enhanced by binding of the Fc region to the Fc receptor (e.g., FcyR).
- glycosylation pattern is defined as the pattern of carbohydrate units that are covalently attached to a protein, more specifically to an immunoglobulin protein.
- a glycosylation pattern of a heterologous antibody can be characterized as being substantially similar to glycosylation patterns which occur naturally on antibodies produced by the species of the nonhuman transgenic animal, when one of ordinary skill in the art would recognize the glycosylation pattern of the heterologous antibody as being more similar to said pattern of glycosylation in the species of the nonhuman transgenic animal than to the species from which the CH genes of the transgene were derived.
- human antibody includes antibodies having variable and constant regions (if present) of human germline immunoglobulin sequences.
- Human antibodies of the disclosure can include amino acid residues not encoded by human germline immunoglobulin sequences (e.g ., mutations introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo) (See, e.g., Lonberg et al., (1994 ) Nature 368(6474): 856-859); Lonberg, (1994) Handbook of Experimental Pharmacology 113:49-101; Lonberg & Huszar, (1995) Intern. Rev. Immunol. 13:65-93, and Harding & Lonberg, (1995 ) Ann.
- human antibody does not include antibodies in which CDR sequences derived from the germline of another mammalian species, such as a mouse, have been grafted onto human framework sequences (i.e. humanized antibodies).
- a heterologous antibody is defined in relation to the transgenic non-human organism producing such an antibody. This term refers to an antibody having an amino acid sequence or an encoding nucleic acid sequence corresponding to that found in an organism not consisting of the transgenic non-human animal, and generally from a species other than that of the transgenic non-human animal.
- inducing an immune response and “enhancing an immune response” are used interchangeably and refer to the stimulation of an immune response (i.e., either passive or adaptive) to a particular antigen.
- induce as used with respect to inducing CDC or ADCC refer to the stimulation of particular direct cell killing mechanisms.
- immunogenic cell death As used herein, the term “immunogenic cell death” (alternatively known as
- immunogenic apoptosis refers to a cell death modality associated with the activation of one or more signaling pathways that induces the pre-mortem expression and emission of damaged- associated molecular pattern (DAMPs) molecules (e.g., adenosine triphosphate, ATP) from the tumor cell, resulting in the increase of immunogenicity of the tumor cell and the death of the tumor cell in an immunogenic manner (e.g., by phagocytosis).
- DAMPs damaged- associated molecular pattern
- ATP adenosine triphosphate
- the terms “inhibits”, “reduces” or “blocks” are used interchangeably and encompass both partial and complete inhibition/blocking.
- the inhibition/blocking of IL-27 reduces or alters the normal level or type of activity that occurs without inhibition or blocking.
- Inhibition and blocking are also intended to include any measurable decrease in the binding affinity of IL-27 when in contact with an anti -IL-27 antibody as compared to IL-27 not in contact with an anti -IL-27 antibody, e.g, inhibits binding of IL-27 by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%.
- “reduces angiogenesis” refer to reducing the level of angiogenesis in a tissue to a quantity which is at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99% or less than the quantity in a corresponding control tissue, and most preferably is at the same level which is observed in a control tissue.
- the term "inhibits growth” is intended to include any measurable decrease in the growth of a cell, e.g., the inhibition of growth of a cell by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 99%, or 100%.
- a subject “in need of prevention,” “in need of treatment,” or “in need thereof,” refers to one, who by the judgment of an appropriate medical practitioner (e.g., a doctor, a nurse, or a nurse practitioner in the case of humans; a veterinarian in the case of non-human mammals), would reasonably benefit from a given treatment (such as treatment with a composition comprising an anti-IL-27 antibody).
- an appropriate medical practitioner e.g., a doctor, a nurse, or a nurse practitioner in the case of humans; a veterinarian in the case of non-human mammals
- in vivo refers to processes that occur in a living organism.
- isolated antibody is intended to refer to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g, an isolated antibody that specifically binds to human IL-27 is substantially free of antibodies that specifically bind antigens other than IL-27).
- An isolated antibody that specifically binds to an epitope may, however, have cross-reactivity to other IL-27 proteins from different species. However, the antibody continues to display specific binding to human IL-27 in a specific binding assay as described herein.
- an isolated antibody is typically substantially free of other cellular material and/or chemicals.
- a combination of "isolated" antibodies having different IL-27 specificities is combined in a well-defined composition.
- isolated nucleic acid molecule refers to nucleic acids encoding antibodies or antibody portions (e.g, VH, VL, CDR3) that bind to IL-27, is intended to refer to a nucleic acid molecule in which the nucleotide sequences encoding the antibody or antibody portion are free of other nucleotide sequences encoding antibodies or antibody portions that bind antigens other than IL-27, which other sequences may naturally flank the nucleic acid in human genomic DNA.
- a sequence selected from a sequence set forth in Table 1A corresponds to the nucleotide sequences comprising the heavy chain (VH) and light chain (VL) variable regions of anti-IL-27 antibody monoclonal antibodies described herein.
- isotype refers to the antibody class (e.g ., IgM or IgGl) that is encoded by heavy chain constant region genes.
- a human monoclonal antibody of the disclosure is of the IgGl isotype.
- a human monoclonal antibody of the disclosure is of the IgG2 isotype.
- a human monoclonal antibody of the disclosure is of the IgG3 isotype.
- a human monoclonal antibody of the disclosure is of the IgG4 isotype.
- antibody isotypes e.g., IgGl, IgG2, IgG3, IgG4, IgM, IgAl IgA2, IgD, and IgE
- IgGl immunoglobulin Gl
- IgG2, IgG3, IgG4, IgM immunoglobulin A2
- IgA2 immunoglobulin A2
- IgD immunoglobulin D
- isotype switching refers to the phenomenon by which the class, or isotype, of an antibody changes from one Ig class to one of the other Ig classes.
- KD or "KD” refers to the equilibrium dissociation constant of a binding reaction between an antibody and an antigen.
- the value of KD is a numeric representation of the ratio of the antibody off-rate constant (kd) to the antibody on-rate constant (ka).
- the value of KD is inversely related to the binding affinity of an antibody to an antigen. The smaller the KD value the greater the affinity of the antibody for its antigen. Affinity is the strength of binding of a single molecule to its ligand and is typically measured and reported by the equilibrium dissociation constant (KD), which is used to evaluate and rank order strengths of bimolecular interactions.
- kd or "kd” (alternatively “koff ' or “k 0ff ”) is intended to refer to the off-rate constant for the dissociation of an antibody from an antibody/antigen complex.
- the value of kd is a numeric representation of the fraction of complexes that decay or dissociate per second, and is expressed in units sec 1 .
- ka As used herein, the term “ka” or “k a “ (alternatively “kon” or “k 0n ”) is intended to refer to the on-rate constant for the association of an antibody with an antigen.
- the value of ka is a numeric representation of the number of antibody/antigen complexes formed per second in a 1 molar (1M) solution of antibody and antigen, and is expressed in units M ⁇ sec 1 .
- leukocyte refers to a type of white blood cell involved in defending the body against infective organisms and foreign substances. Leukocytes are produced in the bone marrow. There are 5 main types of white blood cells, subdivided between 2 main groups: polymorphonuclear leukocytes (neutrophils, eosinophils, basophils) and mononuclear leukocytes (monocytes and lymphocytes).
- lymphocytes refers to a type of leukocyte or white blood cell that is involved in the immune defenses of the body. There are two main types of lymphocytes: B-cells and T-cells.
- local administration refers to delivery that does not rely upon transport of the composition or agent to its intended target tissue or site via the vascular system.
- the composition may be delivered by injection or implantation of the composition or agent or by injection or implantation of a device containing the composition or agent.
- the composition or agent, or one or more components thereof may diffuse to the intended target tissue or site.
- MHC molecules refers to two types of molecules, MHC class I and MHC class II.
- MHC class I molecules present antigen to specific CD8+ T cells and MHC class II molecules present antigen to specific CD4+ T cells.
- Antigens delivered exogenously to APCs are processed primarily for association with MHC class II.
- antigens delivered endogenously to APCs are processed primarily for association with MHC class I.
- human monoclonal antibody refers to an antibody which displays a single binding specificity and affinity for a particular epitope.
- human monoclonal antibody refers to an antibody which displays a single binding specificity and which has variable and optional constant regions derived from human germline immunoglobulin sequences.
- human monoclonal antibodies are produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g. , a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
- the term "monocyte” refers to a type of leukocyte and can differentiate into macrophages and dendritic cells to effect an immune response.
- NK cell refers to a type of cytotoxic lymphocyte. These are large, usually granular, non-T, non-B lymphocytes, which kill certain tumor cells and play an important role in innate immunity to viruses and other intracellular pathogens, as well as in antibody-dependent cell-mediated cytotoxicity (ADCC).
- ADCC antibody-dependent cell-mediated cytotoxicity
- naturally occurring refers to the fact that an object can be found in nature.
- a polypeptide or polynucleotide sequence that is present in an organism (including viruses) that can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally occurring.
- nonswitched isotype refers to the isotypic class of heavy chain that is produced when no isotype switching has taken place; the CH gene encoding the nonswitched isotype is typically the first CH gene immediately downstream from the functionally rearranged VDJ gene.
- Isotype switching has been classified as classical or non-classical isotype switching.
- Classical isotype switching occurs by recombination events which involve at least one switch sequence region in the transgene.
- Non-classical isotype switching may occur by, for example, homologous recombination between human s m and human ⁇ m (d-associated deletion).
- Alternative non-classical switching mechanisms such as intertransgene and/or interchromosomal recombination, among others, may occur and effectuate isotype switching.
- nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double- stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions) and complementary sequences and as well as the sequence explicitly indicated.
- degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et ah, Nucleic Acid Res. 19:5081, 1991; Ohtsuka et ah, Biol. Chem. 260:2605-2608, 1985; and Cassol et al, 1992; Rossolini et al, Mol. Cell. Probes 8:91-98, 1994).
- arginine and leucine modifications at the second base can also be conservative.
- nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
- Polynucleotides used herein can be composed of any polyribonucleotide or polydeoxribonucleotide, which can be unmodified RNA or DNA or modified RNA or DNA.
- polynucleotides can be composed of single- and double-stranded DNA, DNA that is a mixture of single- and double- stranded regions, single- and double- stranded RNA, and RNA that is mixture of single- and double- stranded regions, hybrid molecules comprising DNA and RNA that can be single- stranded or, more typically, double-stranded or a mixture of single- and double- stranded regions.
- polynucleotide can be composed of triple-stranded regions comprising RNA or DNA or both RNA and DNA.
- a polynucleotide can also contain one or more modified bases or DNA or RNA backbones modified for stability or for other reasons.
- Modified bases include, for example, tritylated bases and unusual bases such as inosine.
- a variety of modifications can be made to DNA and RNA; thus, "polynucleotide” embraces chemically, enzymatically, or metabolically modified forms.
- a nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence.
- operably linked means that the DNA sequences being linked are contiguous and, where necessary to join two protein coding regions, contiguous and in reading frame.
- operably linked indicates that the sequences are capable of effecting switch recombination.
- parenteral administration refers to modes of administration other than enteral and topical administration, usually by injection, and include, without limitation, intravenous, intranasal, intraocular, intramuscular, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, transtracheal, subcutaneous, subcuticular, intraarticular, subcapsular, subarachnoid, intraspinal, epidural, intracerebral, intracranial, intracarotid and intrasternal injection and infusion.
- the term "patient” includes human and other mammalian subjects that receive either prophylactic or therapeutic treatment.
- the term "PD-1 antagonist” refers to any chemical compound or biological molecule that inhibits the PD-1 signaling pathway or that otherwise inhibits PD-1 function in a cell (e.g. an immune cell).
- a PD-1 antagonist blocks binding of PD- L1 to PD-1 and/or PD-L2 to PD-1.
- the PD-1 antagonist specifically binds PD-1.
- the PD-1 antagonist specifically binds PD-L1.
- percent identity in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection.
- sequence comparison algorithms e.g., BLASTP and BLASTN or other algorithms available to persons of skill
- the "percent identity” can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared.
- sequence comparison typically one sequence acts as a reference sequence to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et ak, infra).
- pharmaceutically acceptable refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues, organs, and/or bodily fluids of human beings and animals without excessive toxicity, irritation, allergic response, or other problems or complications commensurate with a reasonable benefit/risk ratio.
- a “pharmaceutically acceptable carrier” refers to, and includes, any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible.
- the compositions can include a pharmaceutically acceptable salt, e.g., an acid addition salt or a base addition salt (see, e.g., Berge et ah (1977) J Pharm Sci 66:1-19).
- the terms "polypeptide,” “peptide”, and “protein” are used interchangeably to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.
- the term "preventing” when used in relation to a condition refers to administration of a composition which reduces the frequency of, or delays the onset of, symptoms of a medical condition in a subject relative to a subject which does not receive the composition.
- the term “purified” or “isolated” as applied to any of the proteins refers to administration of a composition which reduces the frequency of, or delays the onset of, symptoms of a medical condition in a subject relative to a subject which does not receive the composition.
- antibodies or fragments described herein refers to a polypeptide that has been separated or purified from components (e.g., proteins or other naturally occurring biological or organic molecules) which naturally accompany it, e.g., other proteins, lipids, and nucleic acid in a prokaryote expressing the proteins.
- a polypeptide is purified when it constitutes at least 60 (e.g., at least 65, 70, 75, 80, 85, 90, 92, 95, 97, or 99) %, by weight, of the total protein in a sample.
- PD-1 Programmed Cell Death Protein 1
- PD-1 refers to the Programmed Cell Death Protein 1 polypeptide, an immune-inhibitory receptor belonging to the CD28 family and is encoded by the PDCD1 gene in humans.
- Alternative names or synonyms for PD-1 include: PDCD1, PD1, CD279 and SLEB2.
- PD-1 is expressed predominantly on previously activated T cells, B cells, and myeloid cells in vivo , and binds to two ligands, PD-L1 and PD-L2.
- PD-1 as used herein includes human PD-1 (hPD-1), variants, isoforms, and species homologs of hPD-1, and analogs having at least one common epitope with hPD-1.
- hPD-1 human PD-1
- variants variants
- isoforms and species homologs of hPD-1
- analogs having at least one common epitope with hPD-1 can be found under GenBank Accession No. AAC51773.
- the term "Programmed Death Ligand-1" or "PD-L1” is one of two cell surface glycoprotein ligands for PD-1 (the other being PD-L2) that downregulates T cell activation and cytokine secretion upon binding to PD-1.
- Alternative names and synonyms for PD- L1 include: PDCD1L1, PDL1, B7H1, B7-4, CD274 and B7-H.
- the term "PD-L1” as used herein includes human PD-L1 (hPD-Ll), variants, isoforms, and species homologs of hPD-Ll, and analogs having at least one common epitope with hPD-Ll. The complete hPD-Ll sequence can be found under GenBank Accession No. Q9NZQ7.
- PD-1 is known as an immune-inhibitory protein that negatively regulates TCR signals (Ishida, Y. et al. (1992) EMBO J. 11:3887-3895; Blank, C. et al. (Epub 2006 Dec. 29) Immunol. Immunother. 56(5):739-745).
- the interaction between PD-1 and PD-L1 can act as an immune checkpoint, which can lead to a decrease in T-cell receptor mediated proliferation (Dong et al. (2003) J. Mol. Med. 81:281-7; Blank et al. (2005) Cancer Immunol. Immunother. 54:307- 314; Konishi et al. (2004) Clin. Cancer Res. 10:5094-100).
- Immune suppression can be reversed by inhibiting the local interaction of PD-1 with PD-L1 or PD-L2; the effect is additive when the interaction of PD-1 with PD-L2 is blocked as well (Iwai et al. (2002) Proc. Nat'l. Acad. Sci. USA 99:12293-7; Brown et al. (2003) J. Immunol. 170:1257-66).
- tumor survival and proliferation is sustained by tumor- mediated immune checkpoint modulation.
- This modulation can result in the disruption of anti cancer immune system functions.
- immune checkpoint receptors ligands such as PD-L1 or PD-L2
- tumor cells can downregulate immune system activity in the tumor microenvironment and promote cancer immune evasion particularly by suppressing T cells.
- PD-L1 is abundantly expressed by a variety of human cancers (Dong et al., (2002) Nat Med 8:787-789).
- the receptor for PD-L1, PD-1 is expressed on lymphocytes (e.g., activated T cells) and is normally involved in down-regulating the immune system and promoting self-tolerance, particularly by suppressing T cells.
- lymphocytes e.g., activated T cells
- PD-1 receptors expressed on T cells bind to cognate PD-L1 ligands on tumor cells, the resulting T cell suppression contributes to an impaired immune response against the tumor (e.g., a decrease in tumor infiltrating lymphocytes or the establishment of immune evasion by cancer cells).
- PD-1 expression on tumor lymphocytes was found to mark dysfunctional T cells in breast cancer (Kitano et al., (2017) ESMO Open 2(2):e000150) and melanoma (Kleffel et al., (2015) Cell 162(6): 1242- 1256).
- PD-1 antagonists such as those that affect the function of the PD-1/PD-L1/PD-L2 signaling axis and/or disrupt the interaction between PD-1 and PD-L1 and/or PD-L2, for example, have been developed and represent a novel class of anti-tumor inhibitors that function via modulation of immune cell-tumor cell interaction.
- the term "rearranged” refers to a configuration of a heavy chain or light chain immunoglobulin locus wherein a V segment is positioned immediately adjacent to a D- J or J segment in a conformation encoding essentially a complete VH or VL domain, respectively.
- a rearranged immunoglobulin gene locus can be identified by comparison to germline DNA; a rearranged locus will have at least one recombined heptamer/nonamer homology element.
- recombinant host cell (or simply “host cell”) is intended to refer to a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- the term "recombinant human antibody” includes all human antibodies that are prepared, expressed, created or isolated by recombinant means, such as (a) antibodies isolated from an animal (e.g ., a mouse) that is transgenic or transchromosomal for human immunoglobulin genes or a hybridoma prepared therefrom, (b) antibodies isolated from a host cell transformed to express the antibody, e.g., from a transfectoma, (c) antibodies isolated from a recombinant, combinatorial human antibody library, and (d) antibodies prepared, expressed, created or isolated by any other means that involve splicing of human immunoglobulin gene sequences to other DNA sequences.
- variable and constant regions that utilize particular human germline immunoglobulin sequences are encoded by the germline genes, but include subsequent rearrangements and mutations which occur, for example, during antibody maturation.
- the variable region contains the antigen binding domain, which is encoded by various genes that rearrange to form an antibody specific for a foreign antigen.
- the variable region can be further modified by multiple single amino acid changes (referred to as somatic mutation or hypermutation) to increase the affinity of the antibody to the foreign antigen.
- the constant region will change in further response to an antigen (i.e., isotype switch).
- the rearranged and somatically mutated nucleic acid molecules that encode the light chain and heavy chain immunoglobulin polypeptides in response to an antigen may not have sequence identity with the original nucleic acid molecules, but instead will be substantially identical or similar ( i.e ., have at least 80% identity).
- reference antibody (used interchangeably with “reference mAh”) or “reference antigen-binding protein” refers to an antibody, or an antigen-binding fragment thereof, that binds to a specific epitope on IL-27 and is used to establish a relationship between itself and one or more distinct antibodies, wherein the relationship is the binding of the reference antibody and the one or more distinct antibodies to the same epitope on IL-27.
- the term connotes an anti-IL-27 antibody that is useful in a test or assay, such as those described herein, (e.g., a competitive binding assay), as a competitor, wherein the assay is useful for the discovery, identification or development, of one or more distinct antibodies that bind to the same epitope.
- a test or assay such as those described herein, (e.g., a competitive binding assay), as a competitor, wherein the assay is useful for the discovery, identification or development, of one or more distinct antibodies that bind to the same epitope.
- the terms “specific binding,” “selective binding,” “selectively binds,” and “specifically binds,” refer to antibody binding to an epitope on a predetermined antigen.
- the antibody binds with an equilibrium dissociation constant (KD) of approximately less than 10 6 M, such as approximately less than 10 7 , 10 8 M, 10 9 M or 10 10 M or even lower when determined by surface plasmon resonance (SPR) technology in a BIACORE 2000 instrument using recombinant human IL-27 as the analyte and the antibody as the ligand and binds to the predetermined antigen with an affinity that is at least two-fold greater than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely- related antigen.
- KD equilibrium dissociation constant
- an antibody that specifically binds to IL-27 binds with an equilibrium dissociation constant (KD) of approximately less than 100 nM (10 7 M), optionally approximately less than 50 nM (5 x 10 8 M), optionally approximately less than 15 nM (1.5 x 10 8 M), optionally approximately less than 10 nM (10 8 M), optionally approximately less than 5 nM (5 x 10 9 M), optionally approximately less than 1 nM (10 9 M), optionally approximately less than 0.1 nM (10 10 M), optionally approximately less than 0.01 nM (10 u M), or even lower, when determined by surface plasmon resonance (SPR) technology in a BIACORE 2000 instrument using recombinant human IL-27 as the analyte and the antibody as the ligand, where binding to the predetermined antigen occurs with an affinity that is at least two-fold greater than the antibody’s affinity for binding to a non-specific antigen (e.g, BSA, casein) other than the predetermined antigen or
- KD
- STAT molecules are phosphorylated by receptor associated kinases, that cause activation and dimerization by forming homo- or heterodimers which translocate to the nucleus to work as transcription factors.
- STAT1 can be activated (i.e., phosphorylated) in response to signaling via several ligands, including IL-27.
- IL-27 signaling through the IL-27R results in phosphorylation of STAT1 (pSTATl).
- STAT1 has a key role in gene expression involved in survival of the cell, viability or pathogen response.
- Methods to determine STAT1 phosphorylation as a result of IL-27 signaling include, but are not limited to, flow cytometric analysis of cells labeled with antibodies that specifically recognize phosphorylated STAT1 (see e.g., Tochizawa et ah, (2006) J Immunol Methods 313(l-2):29-37).
- STAT3 phosphorylation refers to the phosphorylation of the Signal Transducer and Activator of Transcription 3 (STAT3) polypeptide, a transcription factor encoded by the STAT3 gene in humans.
- STAT3 mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis.
- Methods to determine STAT3 phosphorylation as a result of IL-27 signaling include, but are not limited to, analysis of cells or cell extracts labeled with antibodies that specifically recognize phosphorylated STAT3 (see e.g., Fursov et ah, (2011) Assay Drug Dev Technol 9(4):420-429).
- switch sequence refers to those DNA sequences responsible for switch recombination.
- a "switch donor” sequence typically a m switch region, will be 5' (i.e., upstream) of the construct region to be deleted during the switch recombination.
- the "switch acceptor” region will be between the construct region to be deleted and the replacement constant region (e.g., g, e, etc.). As there is no specific site where recombination always occurs, the final gene sequence will typically not be predictable from the construct.
- the term "subject” includes any human or non-human animal.
- the methods and compositions of the present disclosure can be used to treat a subject with an immune disorder.
- non-human animal includes all vertebrates, e.g, mammals and non-mammals, such as non-human primates, sheep, dog, cow, chickens, amphibians, reptiles, etc.
- nucleic acids For nucleic acids, the term "substantial homology" indicates that two nucleic acids, or designated sequences thereof, when optimally aligned and compared, are identical, with appropriate nucleotide insertions or deletions, in at least about 80% of the nucleotides, usually at least about 90% to 95%, and more preferably at least about 98% to 99.5% of the nucleotides. Alternatively, substantial homology exists when the segments will hybridize under selective hybridization conditions, to the complement of the strand.
- the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm, as described in the non-limiting examples below.
- the percent identity between two nucleotide sequences can be determined using the
- GAP program in the GCG software package (available at http://www.gcg.com), using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 80 and a length weight of 1, 2, 3, 4, 5, or 6.
- the percent identity between two nucleotide or amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (CABIOS, 4:11-17 (1989)) which has been incorporated into the ALIGN program (version 2.0), using a PAM120 weight residue table, a gap length penalty of 12 and a gap penalty of 4.
- the percent identity between two amino acid sequences can be determined using the Needleman and Wunsch ( J . Mol. Biol.
- the nucleic acid and protein sequences of the present disclosure can further be used as a "query sequence" to perform a search against public databases to, for example, identify related sequences.
- Such searches can be performed using the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. (1990) J. Mol. Biol. 215:403-10.
- Gapped BLAST can be utilized as described in Altschul et al. , (1997) Nucleic Acids Res. 25(17):3389-3402.
- the default parameters of the respective programs e.g ., XBLAST and NBLAST
- the nucleic acids may be present in whole cells, in a cell lysate, or in a partially purified or substantially pure form.
- a nucleic acid is "isolated” or “rendered substantially pure” when purified away from other cellular components or other contaminants, e.g ., other cellular nucleic acids or proteins, by standard techniques, including alkaline/SDS treatment, CsCl banding, column chromatography, agarose gel electrophoresis and others well known in the art. See , F. Ausubel, et al ., ed. Current Protocols in Molecular Biology, Greene Publishing and Wiley Interscience, New York (1987).
- nucleic acid compositions of the present disclosure while often in a native sequence (except for modified restriction sites and the like), from either cDNA, genomic or mixtures thereof may be mutated, in accordance with standard techniques to provide gene sequences. For coding sequences, these mutations, may affect amino acid sequence as desired.
- DNA sequences substantially homologous to or derived from native V, D, J, constant, switches and other such sequences described herein are contemplated (where "derived" indicates that a sequence is identical or modified from another sequence).
- Stimulator of Interferon Genes a protein that functions both as a direct cytosolic DNA sensor and as an adaptor protein.
- STING is encoded by the TMEM173 gene. STING plays an important role in innate immunity. STING induces type I interferon production when cells are infected with intracellular pathogens, such as viruses, mycobacteria and intracellular parasites. Type I interferon, mediated by STING, protects infected cells and nearby cells from local infection by binding to the same cell that secretes it and nearby cells.
- An exemplary amino acid sequence for STING is provided by the NCBI Genbank database under the accession number NP_001288667.
- T cell refers to a type of white blood cell that can be distinguised from other white blood cells by the presence of a T cell receptor on the cell surface.
- T helper cells a.k.a.
- TH cells or CD4 + T cells and subtypes, including THI, TH2, TH3, TH17, TH9, and TFH cells, cytotoxic T cells (a.k.a Tc cells, CD8 + T cells, cytotoxic T lymphocytes, T-killer cells, killer T cells), memory T cells and subtypes, including central memory T cells (TCM cells), effector memory T cells (TEM and TEMRA cells), and resident memory T cells (TRM cells), regulatory T cells (a.k.a.
- T re g cells or suppressor T cells and subtypes, including CD4 + FOXP3 + Treg cells, CD4 + FOXP3 Treg cells, Trl cells, Th3 cells, and Tregl7 cells, natural killer T cells (a.k.a. NKT cells), mucosal associated invariant T cells (MAITs), and gamma delta T cells (gd T cells), including Vy9/V52 T cells.
- CD4 + FOXP3 + Treg cells CD4 + FOXP3 + Treg cells
- Trl cells Trl cells, Th3 cells, and Tregl7 cells
- natural killer T cells a.k.a. NKT cells
- MAITs mucosal associated invariant T cells
- gd T cells gamma delta T cells
- Vy9/V52 T cells gamma delta T cells
- T cell-mediated response refers to any response mediated by T cells, including, but not limited to, effector T cells (e.g ., CD8 + cells) and helper T cells (e.g ., CD4 + cells). T cell mediated responses include, for example, T cell cytotoxicity and proliferation.
- therapeutically effective amount or “therapeutically effective dose,” or similar terms used herein are intended to mean an amount of an agent (e.g., an anti-IL-27 antibody or an antigen-binding fragment thereof) that will elicit the desired biological or medical response (e.g., an improvement in one or more symptoms of a cancer).
- TAM receptor refers to the TAM receptor protein tyrosine kinases (TYR03, AXL and MER). TAM receptors are involved in the regulation of immune system homeostasis. In a cancer setting, TAM receptors have a dual regulatory role, controlling the initiation and progression of tumor development and, at the same time, the associated anti-tumor responses of diverse immune cells. Further description of TAM receptors is found in Paolino and Penninger (2016) Cancers 8(97): doi:10.3390/cancers8100097). As used herein, the term “TAM receptor inhibitor” or “TAM inhibitor” refers to an agent that inhibits, blocks or reduces the function or activity of a TAM receptor.
- TIGIT or "T-cell immunoreceptor with Ig and ITIM domains” refers to any native TIGIT from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
- TIGIT is also known in the art as DKFZp667A205, FLJ39873, V-set and immunoglobulin domain-containing protein 9, V-set and transmembrane domain-containing protein 3, VSIG9, VSTM3, and WUCAM.
- the term also encompasses naturally occurring variants of TIGIT, e.g., splice variants or allelic variants.
- the amino acid sequence of an exemplary human TIGIT may be found under UniProt Accession Number Q495 A1.
- treatment refers to therapeutic or preventative measures described herein.
- the methods of “treatment” employ administration to a subject, in need of such treatment, a human antibody of the present disclosure, for example, a subject in need of an enhanced immune response against a particular antigen or a subject who ultimately may acquire such a disorder, in order to prevent, cure, delay, reduce the severity of, or ameliorate one or more symptoms of the disorder or recurring disorder, or in order to prolong the survival of a subject beyond that expected in the absence of such treatment.
- tumor microenvironment refers to the cellular environment or milieu in which the tumor or neoplasm exists, including surrounding blood vessels as well as non-cancerous cells including, but not limited to, immune cells, fibroblasts, bone marrow-derived inflammatory cells, and lymphocytes. Signaling molecules and the extracellular matrix also comprise the TME.
- the tumor and the surrounding microenvironment are closely related and interact constantly. Tumors can influence the microenvironment by releasing extracellular signals, promoting tumor angiogenesis and inducing peripheral immune tolerance, while the immune cells in the microenvironment can affect the growth and evolution of tumor cells.
- the term "unrearranged" or “germline configuration” refers to the configuration wherein the V segment is not recombined so as to be immediately adjacent to a D or J segment.
- vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- viral vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g ., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and vector may be used interchangeably as the plasmid is the most commonly used form of vector.
- the present disclosure is intended to include such other forms of expression vectors, such as viral vectors (e.g, replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
- Some aspects of the present disclosure are directed to methods of inhibiting or reducing STAT1 and/or STAT3 phosphorylation in a cell, the method comprising contacting the cell with an isolated antibody, or antigen binding fragment, provided by the disclosure, wherein the antibody, or antigen binding portion thereof, inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell.
- Some aspects of the present disclosure are directed to methods of inhibiting or reducing inhibition of CD161 expression in a cell, the method comprising contacting the cell with an isolated antibody, or antigen binding fragment, provided by the disclosure, wherein the antibody, or antigen binding portion thereof, inhibits or reduces inhibition of CD161 expression in a cell.
- Some aspects of the present disclosure are directed to methods of inhibiting or reducing PD-L1 expression in a cell, the method comprising contacting the cell with an isolated antibody, or antigen binding fragment, provided by the disclosure, wherein the antibody, or antigen binding portion thereof, inhibits or reduces PD-L1 expression in a cell.
- Some aspects of the present disclosure are directed to methods of altering TIM-3 expression in a cell, the method comprising contacting the cell with an isolated antibody, or antigen binding fragment, provided by the disclosure, wherein the antibody, or antigen binding portion thereof, alters TIM-3 expression.
- Some aspects of the present disclosure are directed to methods of inducing or enhancing secretion of one or more cytokines from a cell, the method comprising contacting the cell with the isolated antibody, or antigen binding fragment, provided by the disclosure, wherein the antibody, or antigen binding portion thereof, induces or enhances PD-1 mediated secretion of one or more cytokines from a cell.
- the antibody or an antigen binding portion thereof is administered at a dose of at least about 0.003 mg/kg to at least about 20 mg/kg.
- the antibody or antigen binding portion thereof specifically binds to an epitope comprising one or more amino acids of (i) amino acids 37 to 56 corresponding to SEQ ID NO: 2 (IL-27p28), (ii) amino acids 142 to 164 corresponding to SEQ ID NO: 2 (IL-27p28), or (iii) both (i) and (ii).
- the antibody or an antigen binding portion thereof is administered at a dose that is sufficient to maintain IC90 of pSTATl inhibition level, i.e., above about 0.7 ug/mL for the duration of the treatment, e.g., 28 days, 56 days, or 84 days.
- the antibody or antigen binding portion thereof is administered at a dose of at least about 0.006 mg/kg to at least about 20 mg/kg, at least about 0.009 mg/kg to at least about 20 mg/kg, at least about 0.01 mg/kg to at least about 20 mg/kg, at least about 0.03 mg/kg to at least about 20 mg/kg, at least about 0.06 mg/kg to at least about 20 mg/kg, at least about 0.09 mg/kg to at least about 20 mg/kg, at least about 0.1 mg/kg to at least about 20 mg/kg, at least about 0.3 mg/kg to at least about 20 mg/kg, at least about 0.6 mg/kg to at least about 20 mg/kg, at least about 0.9 mg/kg to at least about 20 mg/kg, at least about 1 mg/kg to at least about 20 mg/kg, at least about 1 mg/kg to at least about 20 mg/kg, at least about 3 mg/kg to at least about 20 mg/kg, at least about 6 mg/kg to at least about 20 mg/kg, at least about
- the antibody or antigen binding portion thereof is administered at a dose of at least about 0.006 mg/kg to at least about 10 mg/kg, at least about 0.009 mg/kg to at least about 10 mg/kg, at least about 0.01 mg/kg to at least about 10 mg/kg, at least about 0.03 mg/kg to at least about 10 mg/kg, at least about 0.06 mg/kg to at least about 10 mg/kg, at least about 0.09 mg/kg to at least about 10 mg/kg, at least about 0.1 mg/kg to at least about 10 mg/kg, at least about 0.3 mg/kg to at least about 10 mg/kg, at least about 0.6 mg/kg to at least about 10 mg/kg, at least about 0.9 mg/kg to at least about 10 mg/kg, at least about 1 mg/kg to at least about 10 mg/kg, at least about 1 mg/kg to at least about 9 mg/kg, at least about 3 mg/kg to at least about 9 mg/kg, at least about 1 mg/kg to at least about 6 mg/kg,
- the antibody or antigen binding portion thereof is administered at a dose of at least about 0.003 mg/kg, at least about 0.006 mg/kg, at least about 0.009 mg/kg, at least about 0.01 mg/kg, at least about 0.03 mg/kg, at least about 0.06 mg/kg, at least about 0.09 mg/kg, at least about 0.1 mg/kg, at least about 0.3 mg/kg, at least about 0.6 mg/kg, at least about 0.9 mg/kg, at least about 1.0 mg/kg, at least about 2 mg/kg, at least about 3 mg/kg, at least about 4 mg/kg, at least about 5 mg/kg, at least about 6 mg/kg, at least about 7 mg/kg, at least about 8 mg/kg, at least about 9, or at least about 10 mg/kg.
- the antibody or antigen binding portion thereof is administered at a dose of at least about 11 mg/kg, at least about 12 mg/kg, at least about 13 mg/kg, at least about 14 mg/kg, at least about 15 mg/kg, at least about 16 mg/kg, at least about 17 mg/kg, at least about 18 mg/kg, at least about 19, or at least about 20 mg/kg.
- the antibody or antigen binding portion thereof is administered at a dose of at least about 0.003 mg/kg.
- the antibody or antigen binding portion thereof is administered at a dose of at least about 0.006 mg/kg.
- the antibody or antigen binding portion thereof is administered at a dose of at least about 0.009 mg/kg.
- the antibody or antigen binding portion thereof is administered at a dose of at least about 0.01 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 0.03 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 0.06 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 0.09 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 0.1 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 0.3 mg/kg.
- the antibody or antigen binding portion thereof is administered at a dose of at least about 0.6 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 0.9 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 1.0 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 2 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 3 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 4 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 5 mg/kg.
- the antibody or antigen binding portion thereof is administered at a dose of at least about 6 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 7 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 8 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 9. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 10 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 11 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 12 mg/kg.
- the antibody or antigen binding portion thereof is administered at a dose of at least about 13 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 14 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 15 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 16 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 17 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 18 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 19 mg/kg. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of at least about 20 mg/kg.
- the antibody or antigen binding portion thereof is administered once about every week, once about every two weeks, once about every three weeks, once about every four weeks, once about every 6 weeks, once about every 8 weeks, or once about every 12 weeks. In some aspects, the antibody or antigen binding portion thereof is administered once about every four weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 0.3 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 1 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 2 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 3 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 4 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 5 mg/kg once about every week.
- the antibody or antigen binding portion thereof is administered at a dose of about 6 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 7 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 8 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 9 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 10 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 11 mg/kg once about every week.
- the antibody or antigen binding portion thereof is administered at a dose of about 12 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 13 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 14 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 15 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 16 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 17 mg/kg once about every week.
- the antibody or antigen binding portion thereof is administered at a dose of about 18 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 19 mg/kg once about every week. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 20 mg/kg once about every week.
- the antibody or antigen binding portion thereof is administered at a dose of about 0.3 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 1 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 2 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 3 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 4 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 5 mg/kg once about every two weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 6 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 7 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 8 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 9 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 10 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 11 mg/kg once about every two weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 12 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 13 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 14 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 15 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 16 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 17 mg/kg once about every two weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 18 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 19 mg/kg once about every two weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 20 mg/kg once about every two weeks. [0192] In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 0.3 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 1 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 2 mg/kg once about every three weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 3 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 4 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 5 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 6 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 7 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 8 mg/kg once about every three weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 9 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 10 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 11 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 12 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 13 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 14 mg/kg once about every three weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 15 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 16 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 17 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 18 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 19 mg/kg once about every three weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 20 mg/kg once about every three weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 0.3 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 1 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 2 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 3 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 4 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 5 mg/kg once about every four weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 6 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 7 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 8 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 9 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 10 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 11 mg/kg once about every four weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 12 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 13 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 14 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 15 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 16 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 17 mg/kg once about every four weeks.
- the antibody or antigen binding portion thereof is administered at a dose of about 18 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 19 mg/kg once about every four weeks. In some aspects, the antibody or antigen binding portion thereof is administered at a dose of about 20 mg/kg once about every four weeks.
- the cancer is selected from Kaposi's sarcoma, leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, myeloblasts promyelocyte myelomonocytic monocytic erythroleukemia, chronic leukemia, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt’s lymphoma and marginal zone B cell lymphoma, Polycythemia vera Lymphoma, Hodgkin's disease, non-Hodgkin's disease, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, solid tumors, sarcomas, and carcinomas, fibrosarcoma, myxosarcoma, liposarcoma, chrondrosarcoma, osteogenic sarcoma, osteosarcoma, chord
- the cancer is chosen from lung cancer (e.g., non-small cell lung cancer), sarcoma, testicular cancer, ovarian cancer, pancreas cancer, breast cancer (e.g., triple-negative breast cancer), melanoma, head and neck cancer (e.g., squamous head and neck cancer), colorectal cancer, bladder cancer, endometrial cancer, prostate cancer, thyroid cancer, hepatocellular carcinoma, gastric cancer, brain cancer, lymphoma (e.g., DL-BCL), leukemia (e.g., AML) or renal cancer (e.g., renal cell carcinoma, e.g., clear cell RCC and/or non-clear cell RCC).
- lung cancer e.g., non-small cell lung cancer
- sarcoma testicular cancer
- ovarian cancer pancreas cancer
- breast cancer e.g., triple-negative breast cancer
- melanoma melanoma
- head and neck cancer e.g
- the methods can be performed in conjunction with other therapies for cancer.
- the composition can be administered to a subject at the same time, prior to, or after, radiation, surgery, targeted or cytotoxic chemotherapy, chemoradiotherapy, hormone therapy, immunotherapy, gene therapy, cell transplant therapy, precision medicine, genome editing therapy, or other pharmacotherapy.
- compositions disclosed herein are administered to a subject, e.g., a human subj ect, using a variety of methods that depend, in part, on the route of administration.
- the route can be, e.g., intravenous injection or infusion (IV), subcutaneous injection (SC), intraperitoneal (IP) injection, intramuscular injection (IM), or intrathecal injection (IT).
- IV intravenous injection or infusion
- SC subcutaneous injection
- IP intraperitoneal
- IM intramuscular injection
- IT intrathecal injection
- the injection can be in a bolus or a continuous infusion.
- Administration can be achieved by, e.g., local infusion, injection, or by means of an implant.
- the implant can be of a porous, non-porous, or gelatinous material, including membranes, such as silastic membranes, or fibers.
- the implant can be configured for sustained or periodic release of the composition to the subject. See, e.g., U.S. Patent Application Publication No. 20080241223; U.S. Patent Nos. 5,501,856; 4,863,457; and 3,710,795; EP488401; and EP 430539, the disclosures of each of which are incorporated herein by reference in their entirety.
- composition can be delivered to the subject by way of an implantable device based on, e.g., diffusive, erodible, or convective systems, e.g., osmotic pumps, biodegradable implants, electrodiffusion systems, electroosmosis systems, vapor pressure pumps, electrolytic pumps, effervescent pumps, piezoelectric pumps, erosion-based systems, or electromechanical systems.
- an anti-IL-27 antibody or antigen-binding fragment thereof is therapeutically delivered to a subject by way of local administration.
- the route of administration is in accord with known methods, e.g. orally, through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intracerebroventricular, intramuscular, subcutaneously, intra-ocular, intraarterial, intraportal, or intralesional routes; by sustained release systems or by implantation devices.
- the compositions can be administered by bolus injection or continuously by infusion, or by implantation device.
- individual elements of the combination therapy may be administered by different routes.
- the composition can be administered locally via implantation of a membrane, sponge or another appropriate material onto which the desired molecule has been absorbed or encapsulated.
- the device can be implanted into any suitable tissue or organ, and delivery of the desired molecule can be via diffusion, timed-release bolus, or continuous administration.
- it can be desirable to use a pharmaceutical composition comprising an anti-IL-27 antibody in an ex vivo manner. In such instances, cells, tissues and/or organs that have been removed from the patient are exposed to a pharmaceutical composition comprising an anti-IL-27 antibody after which the cells, tissues and/or organs are subsequently implanted back into the patient.
- an anti-IL-27 antibody can be delivered by implanting certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptides.
- such cells can be animal or human cells, and can be autologous, heterologous, or xenogeneic.
- the cells can be immortalized.
- the cells in order to decrease the chance of an immunological response, the cells can be encapsulated to avoid infiltration of surrounding tissues.
- the encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow the release of the protein product(s) but prevent the destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.
- the subject exhibits increased expression of one or more biomarkers selected from the group consisting of Eotaxin-1 (CCL11), TARC (CCL17), VEGF-A, IL-7, IL-8, MCP-1, MCP-4, and any combination thereof; wherein the increased expression of the one or more biomarkers is relative to the expression of the one or more biomarker prior to the administration.
- the subject exhibits increased expression of Eotaxin-1 (CCL11), wherein the increased expression of Eotaxin-1 (CCL11) is relative to the expression of Eotaxin-1 (CCL11) prior to the administration.
- the subject following administration antibody or antigen binding portion thereof, the subject exhibits increased expression of TARC (CCL17), wherein the increased expression of TARC (CCL17) is relative to the expression of TARC (CCL17) prior to the administration.
- the subject following administration antibody or antigen binding portion thereof, the subject exhibits increased expression of VEGF-A, wherein the increased expression of VEGF-A is relative to the expression of VEGF-A prior to the administration.
- the subject following administration antibody or antigen binding portion thereof, the subject exhibits increased expression of IL-7, wherein the increased expression of IL-
- the subject following administration antibody or antigen binding portion thereof, the subject exhibits increased expression of IL-8, wherein the increased expression of IL-
- the subject following administration antibody or antigen binding portion thereof, the subject exhibits increased expression of MCP-1, wherein the increased expression of MCP-1 is relative to the expression of MCP-1 prior to the administration.
- the subject following administration antibody or antigen binding portion thereof, the subject exhibits increased expression of MCP-4, wherein the increased expression of MCP-4 is relative to the expression of MCP-4 prior to the administration.
- Certain aspects of the present disclosure are directed to methods of administering antibodies, and antigen binding portions thereof, that specifically bind to IL-27p28 and antagonize IL-27, in particular human IL-27.
- the antibody or antigen binding portion thereof inhibits or reduces
- the antibody or antigen binding portion thereof inhibits or reduces pSTATl signaling (e.g ., IL-27 mediated pSTATl signaling).
- the antibody or antigen binding portion thereof inhibits or reduces pSTATl signaling (e.g ., IL-27 mediated pSTATl signaling) by at least about 25%, at least about 50%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, relative to pSTATl signaling (e.g., IL-27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g, an anti-IL-27 antibody disclosed herein).
- pSTATl signaling e.g IL-27 mediated pSTATl signaling
- the antibody or antigen binding portion thereof inhibits or reduces PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) by at least about 90% relative to PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g, an anti-IL-27 antibody disclosed herein).
- PSTATl signaling e.g., IL-27 mediated pSTATl signaling
- the antibody or antigen binding portion thereof e.g., an anti-IL-27 antibody disclosed herein.
- the antibody or antigen binding portion thereof inhibits or reduces PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) by at least about 91% relative to PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g, an anti-IL-27 antibody disclosed herein).
- PSTATl signaling e.g., IL-27 mediated pSTATl signaling
- the antibody or antigen binding portion thereof e.g., an anti-IL-27 antibody disclosed herein.
- the antibody or antigen binding portion thereof inhibits or reduces PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) by at least about 92% relative to PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g, an anti-IL-27 antibody disclosed herein).
- PSTATl signaling e.g., IL-27 mediated pSTATl signaling
- the antibody or antigen binding portion thereof e.g., an anti-IL-27 antibody disclosed herein.
- the antibody or antigen binding portion thereof inhibits or reduces PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) by at least about 93% relative to PSTATl signaling (e.g., IL- 27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g, an anti-IL-27 antibody disclosed herein).
- PSTATl signaling e.g., IL-27 mediated pSTATl signaling
- IL- 27 mediated pSTATl signaling e.g., an anti-IL-27 antibody disclosed herein
- the antibody or antigen binding portion thereof inhibits or reduces PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) by at least about 94% relative to PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g, an anti- IL-27 antibody disclosed herein).
- PSTATl signaling e.g., IL-27 mediated pSTATl signaling
- the antibody or antigen binding portion thereof e.g., an anti- IL-27 antibody disclosed herein.
- the antibody or antigen binding portion thereof inhibits or reduces PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) by at least about 95% relative to PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g, an anti-IL-27 antibody disclosed herein).
- PSTATl signaling e.g., IL-27 mediated pSTATl signaling
- the antibody or antigen binding portion thereof e.g., an anti-IL-27 antibody disclosed herein.
- the antibody or antigen binding portion thereof inhibits or reduces PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) by at least about 96% relative to PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g, an anti-IL-27 antibody disclosed herein).
- PSTATl signaling e.g., IL-27 mediated pSTATl signaling
- the antibody or antigen binding portion thereof e.g., an anti-IL-27 antibody disclosed herein.
- the antibody or antigen binding portion thereof inhibits or reduces PSTAT1 signaling (e.g., IL-27 mediated pSTATl signaling) by at least about 97% relative to PSTAT1 signaling (e.g., IL-27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g., an anti-IL-27 antibody disclosed herein).
- PSTAT1 signaling e.g., IL-27 mediated pSTATl signaling
- the antibody or antigen binding portion thereof e.g., an anti-IL-27 antibody disclosed herein.
- the antibody or antigen binding portion thereof inhibits or reduces PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) by at least about 98% relative to PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g, an anti- IL-27 antibody disclosed herein).
- PSTATl signaling e.g., IL-27 mediated pSTATl signaling
- the antibody or antigen binding portion thereof inhibits or reduces PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) by at least about 99% relative to PSTATl signaling (e.g., IL-27 mediated pSTATl signaling) prior to administration of the antibody or antigen binding portion thereof (e.g, an anti-IL-27 antibody disclosed herein).
- PSTATl signaling e.g., IL-27 mediated pSTATl signaling
- the antibody or antigen binding portion thereof inhibits or reduces inhibition of CD161 expression in a cell in the subject.
- the antibody or antigen binding portion thereof inhibits or reduces PD-L1 expression in a cell in the subject.
- the antibody or antigen binding portion thereof induces or enhances PD-1 mediated secretion of one or more cytokines from a cell in the subject. In some aspects, the antibody or antigen binding portion thereof alters TIM-3 expression in a cell in the subject. In some aspects, the cell is a tumor cell or an immune cell.
- the disclosure provides an isolated antibody that specifically binds to and antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof specifically binds to the epitopes disclosed herein and exhibits at least one or more of the following properties: (i) binds to human IL-27 with an equilibrium dissociation constant (KD) of 15 nM or less; (ii) blocks binding of IL-27 to IL-27 receptor; (iii) inhibits or reduces STAT1 and/or STAT3 phosphorylation in a cell; (iv) inhibits or reduces IL-27 mediated inhibition of CD161 expression in a cell; (v) inhibits or reduces IL-27 mediated PD-L1 expression in a cell; (vi) induces or enhances PD-1 mediated secretion of one or more cytokines from a cell; (vii) alters TIM-3 expression in a cell; and (viii)
- the antibody or antigen binding portion thereof specifically binds to an epitope comprising one or more amino acids of (i) amino acids 37 to 56 corresponding to SEQ ID NO: 2 (IL-27p28), (ii) amino acids 142 to 164 corresponding to SEQ ID NO: 2 (IL-27p28), or (iii) both (i) and (ii).
- an isolated antibody of the disclosure that antagonizes human IL-27, or an antigen binding portion thereof, specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, or Glul64 of SEQ ID NO: 2 (IL-27p28).
- Some aspects of the present disclosure are directed to a method of treating a cancer in a subject in need thereof comprising administering to the subject an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof specifically binds to an epitope comprising one or more amino acids of (i) amino acids 37 to 56 corresponding to SEQ ID NO: 2 (IL-27p28), (ii) amino acids 142 to 164 corresponding to SEQ ID NO: 2 (IL-27p28), or (iii) both (i) and (ii); wherein the antibody or antigen binding portion thereof is administered at a dose of at least about 0.003 mg/kg to at least about 10 mg/kg; wherein the antibody or the antigen binding portion thereof comprises a heavy chain CDR3 comprising the sequence set forth in SEQ ID NO: 121 or 124.
- the antibody or the antigen binding portion thereof comprises a heavy chain CDR3 comprising the sequence set forth in SEQ ID NO: 121. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain CDR3 comprising the sequence set forth in SEQ ID NO: 124. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain CDR2 comprising the sequence set forth in SEQ ID NO: 120 or 123. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain CDR2 comprising the sequence set forth in SEQ ID NO: 120. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain CDR2 comprising the sequence set forth in SEQ ID NO: 123.
- the antibody or the antigen binding portion thereof comprises a heavy chain CDR1 comprising the sequence set forth in SEQ ID NO: 119 or 122. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain CDR1 comprising the sequence set forth in SEQ ID NO: 119. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain CDR1 comprising the sequence set forth in SEQ ID NO: 122. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain CDR3 comprising the sequence set forth in SEQ ID NO: 129 or 132. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain CDR3 comprising the sequence set forth in SEQ ID NO: 129.
- the antibody or the antigen binding portion thereof comprises a light chain CDR3 comprising the sequence set forth in SEQ ID NO: 132. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain CDR2 comprising the sequence set forth in SEQ ID NO: 128 or 131. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain CDR2 comprising the sequence set forth in SEQ ID NO: 128. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain CDR2 comprising the sequence set forth in SEQ ID NO: 131. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain CDR1 comprising the sequence set forth in SEQ ID NO: 127 or 130.
- the antibody or the antigen binding portion thereof comprises a light chain CDR1 comprising the sequence set forth in SEQ ID NO: 127. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain CDR1 comprising the sequence set forth in SEQ ID NO: 130.
- the antibody or the antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120, and a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 121.
- the antibody or the antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, and a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124.
- the antibody or the antigen binding portion thereof comprises: a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 127, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 128, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 129.
- the antibody or the antigen binding portion thereof comprises: a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- the antibody or the antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 121, a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 127, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 128, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 129.
- the method comprises administering a dose of at least about 0.003 mg/kg to at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 121, a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 127, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 128, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 129.
- the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set
- the method comprises administering a dose of at least about 1 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 121, a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 127, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 128, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 129.
- the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120,
- the method comprises administering a dose of at least about 3 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 121, a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 127, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 128, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 129.
- the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120,
- the method comprises administering a dose of at least about 6 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 121, a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 127, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 128, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 129.
- the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120,
- the method comprises administering a dose of at least about 10 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 121, a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 127, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 128, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 129.
- the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120,
- the method comprises administering a dose of at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 121, a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 127, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 128, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 129.
- the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 119, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 120,
- the antibody or the antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124 a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- the method comprises administering a dose of at least about 0.003 mg/kg to at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124 a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122
- a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123
- the method comprises administering a dose of at least about 0.003 mg/kg to at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124 a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122
- a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123
- the method comprises administering a dose of at least about 1 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124 a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122
- a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123
- a heavy chain CDR3 compris
- the method comprises administering a dose of at least about 3 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124 a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122
- a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123
- a heavy chain CDR3 compris
- the method comprises administering a dose of at least about 6 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124 a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122
- a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123
- a heavy chain CDR3 compris
- the method comprises administering a dose of at least about 10 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124 a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122
- a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123
- a heavy chain CDR3 compris
- the method comprises administering a dose of at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises: a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122, a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123, a heavy chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 124 a light chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 130, a light chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 131, and a light chain CDR3 comprising the amino acid sequence set forth in SEQ ID NO: 132.
- a heavy chain CDR1 comprising the amino acid sequence set forth in SEQ ID NO: 122
- a heavy chain CDR2 comprising the amino acid sequence set forth in SEQ ID NO: 123
- a heavy chain CDR3 compris
- the antibody or the antigen binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence that has at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 125. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 125.
- the antibody or the antigen binding portion thereof comprises a light chain variable region comprising an amino acid sequence that has at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 133.
- the antibody or the antigen binding portion thereof comprises a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 133.
- the antibody or the antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 125 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 133.
- the method comprises administering a dose of at least about 0.003 mg/kg to at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 125 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 133.
- the method comprises administering a dose of at least about 1 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 125 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 133.
- the method comprises administering a dose of at least about 3 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 125 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 133.
- the method comprises administering a dose of at least about 6 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 125 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 133.
- the method comprises administering a dose of at least about 10 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 125 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 133.
- the method comprises administering a dose of at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 125 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 133.
- the antibody or the antigen binding portion thereof comprises a heavy chain comprising an amino acid sequence that has at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 135.
- the antibody or the antigen binding portion thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 135.
- the antibody or the antigen binding portion thereof comprises a heavy chain comprising an amino acid sequence that has at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 139. In some aspects, the antibody or the antigen binding portion thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 139.
- the antibody or the antigen binding portion thereof comprises a light chain comprising an amino acid sequence that has at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to the amino acid sequence set forth in SEQ ID NO: 137. In some aspects, the antibody or the antigen binding portion thereof comprises a light chain comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the antibody or the antigen binding portion thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 135 and a light chain comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 0.003 mg/kg to at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 135 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 1 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 135 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 3 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 135 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 6 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 135 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 10 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 135 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 135 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the antibody or the antigen binding portion thereof comprises a heavy chain comprising the amino acid sequence set forth in SEQ ID NO: 139 and a light chain comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 0.003 mg/kg to at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 139 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 1 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 139 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 3 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 139 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 6 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 139 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 10 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 139 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the method comprises administering a dose of at least about 20 mg/kg of an antibody that antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof comprises a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 139 and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 137.
- the antibody or antigen-bninding portion thereof comprises an amino acid sequence set forth in Table 1 A.
- the antibody, or antigen binding portion thereof comprises an Fc sequence set forth in Table IB.
- the antibody, or antigen binding portion thereof comprises a heavy chain, wherein the heavy chain comprises an Fc region having an amino acid at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% sequence identity to the sequence set forth in SEQ ID NO: 5, 6, 7, or 8.
- the antibody, or antigen binding portion thereof comprises a heavy chain, wherein the heavy chain comprises an Fc region comprising the amino acid sequence set forth in SEQ ID NO: 5.
- the antibody, or antigen binding portion thereof comprises a heavy chain, wherein the heavy chain comprises an Fc region comprising the amino acid sequence set forth in SEQ ID NO: 6. In some aspects, the antibody, or antigen binding portion thereof, comprises a heavy chain, wherein the heavy chain comprises an Fc region comprising the amino acid sequence set forth in SEQ ID NO: 7. In some aspects, the antibody, or antigen binding portion thereof, comprises a heavy chain, wherein the heavy chain comprises an Fc region comprising the amino acid sequence set forth in SEQ ID NO: 8.
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Aspl46 and Argl49 of SEQ ID NO: 2 (IL- 27p28). In some aspects, an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Aspl46 and Phel53 of SEQ ID NO: 2 (IL-27p28). In some aspects, an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Argl49 and Phel53 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Aspl46, Argl49, and/orPhel53 of SEQ ID NO: 2 (IL-27p28). In some aspects, an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Aspl46, Argl49, and Phel53 of SEQ ID NO: 2 (IL-27p28). In some aspects, the epitope comprises Aspl46, Argl49, Hisl50, andPhel53 of SEQ ID NO: 2 (IL-27p28).
- the epitope comprises Aspl46, Argl49, Phel53, and Leul56 of SEQ ID NO: 2 (IL-27p28). In some aspects, the epitope comprises Aspl46, Argl49, Hisl50, Phel53, and Leul56 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising at least one, at least two, at least three, at least four, at least five, or at least six amino acids of IL-27p28 selected from Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Leu 142, Asp 146, Argl49, His 150, Phel53, Leu 156, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- the epitope comprises Gln37, Leu38, Glu42, Aspl46, Argl49, Hisl50, Phel53, and Leul56 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Gln37, Leu38, Glu42, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising at least one, at least two, at least three, at least four, at least five, or at least six, at least seven, at least eight, or at least nine amino acids of IL-27p28 selected from Glu46, Val49, Ser50, Leu 142, Asp 146, Argl49, Hisl50, Phel53, Leul56, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, and Glul64of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising at least one, at least two, at least three, at least four, at least five, or at least six, at least seven, at least eight, or at least nine amino acids of IL-27p28 selected from Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu 142, Asp 146, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL- 27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Asp 146, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope consisting of or consisting essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu 142, Asp 146, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL- 27p28) and at least one residues selected from the group consisting of: Leu53, Lys56, Aspl43, Leu 147, Argl52, Alal57, Glyl59, Phel60, or Asnl61 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope comprising Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu 142, Asp 146, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL- 27p28) and at least one residues selected from the group consisting of: Leu53, Lys56, Aspl43, Argl45, Leu 147, Argl52, Alal57, Glyl59, Phel60, Asnl61, or Prol63 of SEQ ID NO: 2 (IL- 27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope consisting or consisting essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- an antibody, or antigen binding portion thereof, of the present disclosure specifically binds to an epitope consisting or consisting essentially of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28).
- the disclosure provides an isolated antibody that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL- 27p28) and antagonizes human IL-27, or an antigen binding portion thereof, wherein the antibody or antigen binding portion thereof exhibits at least one or more of the following properties: (i) binds to human IL-27 with an equilibrium dissociation constant (KD) of 15 nM or less; (ii) blocks binding of IL-27 to IL-27 receptor; (iii) inhibits or reduce
- the isolated antibody, or antigen binding portion thereof binds to an epitope of one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leu 142, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alai 57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (human IL- 27p28) with an equilibrium dissociation constant (KD) of 15 nM or less.
- KD equilibrium dissociation constant
- the isolated antibody, or antigen binding portion thereof binds to recombinant human IL-27p28. In some aspects, the isolated antibody, or antigen binding portion thereof, binds to murine IL-27p28.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT1 phosphorylation in a cell. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces STAT3 phosphorylation in a cell. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces STAT1 and STAT3 phosphorylation in a cell.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT1 phosphorylation in a cell by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99%, relative to the STAT1 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT1 phosphorylation in a cell by at least about 50%, relative to the STAT1 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces STAT1 phosphorylation in a cell by at least about 60%, relative to the STAT1 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT1 phosphorylation in a cell by at least about 70%, relative to the STAT1 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces STAT1 phosphorylation in a cell by at least about 75%, relative to the STAT1 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT1 phosphorylation in a cell by at least about 80%, relative to the STAT1 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces STAT1 phosphorylation in a cell by at least about 85%, relative to the STAT1 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT1 phosphorylation in a cell by at least about 90%, relative to the STAT1 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces STAT1 phosphorylation in a cell by at least about 95%, relative to the STAT1 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof. In some aspects, the isolated antibody, or antigen binding portion thereof, eliminates STAT1 phosphorylation in the cell.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT3 phosphorylation in a cell by at least about 5%, at least about 10%, at least about
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT3 phosphorylation in a cell by at least about 50%, relative to the STAT3 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT3 phosphorylation in a cell by at least about 60%, relative to the STAT3 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces STAT3 phosphorylation in a cell by at least about 70%, relative to the STAT3 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT3 phosphorylation in a cell by at least about 75%, relative to the STAT3 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces STAT3 phosphorylation in a cell by at least about 80%, relative to the STAT3 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT3 phosphorylation in a cell by at least about 85%, relative to the STAT3 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof. In some aspects, the isolated antibody, or antigen binding portion thereof, inhibits or reduces STAT3 phosphorylation in a cell by at least about 90%, relative to the STAT3 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces STAT3 phosphorylation in a cell by at least about 95%, relative to the STAT3 phosphorylation in the cell prior to contacting the cell with the antibody, or antigen binding portion thereof. In some aspects, the isolated antibody, or antigen binding portion thereof, eliminates STAT3 phosphorylation in the cell.
- the cell is an immune cell. In some aspects, the cell is a cancer cell.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces inhibition of CD161 expression in a cell (e.g. ameliorates or relieves the inhibition of CD161 expression in a cell).
- the cell is an immune cell.
- the isolated antibody, or antigen binding portion thereof inhibits or reduces PD-L1 expression in a cell. In some aspects, PD-L1 expression is inhibited or reduced. In some aspects, TIM-3 expression is altered. In some aspects, both PD-L1 expression and TIM-3 expression is altered. In some aspects, the cell is an immune cell. In some aspects, the antibodies are monoclonal antibodies. [0243] In some aspects, the isolated antibody, or antigen binding portion thereof, induces or enhances the PD- 1 -mediated secretion of one or more cytokines from a cell. In some aspects, the one or more cytokines is TNFa. In some aspects, the one or more cytokine is IL-6.
- the one or more cytokine is TNFa and IL-6.
- the cell is an immune cell.
- the isolated antibody, or antigen binding portion thereof is selected from the group consisting of an IgGl, an IgG2, an IgG3, an IgG4, an IgM, an IgAl an IgA2, an IgD, and an IgE antibody.
- the antibody is an IgGl antibody or an IgG4 antibody.
- the antibody comprises a wild type IgGl heavy chain constant region.
- the antibody comprises a wild type IgG4 heavy chain constant region.
- the antibody comprises an Fc domain comprising at least one mutation.
- the antibody comprises a mutant IgGl heavy chain constant region. In some aspects, the antibody comprises a mutant IgG4 heavy chain constant region. In some aspects, the mutant IgG4 heavy chain constant region comprises any one of the substitutions S228P, L235E, L235A, or a combination thereof, according to EU numbering.
- the disclosure provides an isolated antibody, or antigen binding portion thereof, that binds to substantially the same epitope on IL-27 as the antibody, or antigen binding portion thereof, according to any one of the aforementioned aspects.
- the disclosure provides an isolated antibody, or antigen binding portion thereof, that binds to at least one of the amino acid residues selected from the group consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Asp 146, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28) bound by the antibody, or antigen binding portion thereof, according to any one of the aforementioned aspects.
- the disclosure provides an isolated antibody, or antigen binding portion thereof, wherein a mutation of the epitope (Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leu 156, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL- 27p28)) bound by the antibody or antigen binding portion thereof inhibits, reduces, or blocks binding to both the antibody or antigen binding portion thereof and to the antibody or antigen binding portion thereof according to any one of the aforementioned aspects.
- a mutation of the epitope (Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein light chain CDR1 consists of N-XXXXXLFSSNXKXYXX-C.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein light chain CDR3 consists of N-XXXASAXXX-C.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein heavy chain CDR2 consists of N-XXSSSXSYXYXXXXXX-C.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein heavy chain CDR3 consists of N- XXXXGRTSYTATXHNXXXX-C, wherein X is any amino acids.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein light chain CDR1 consists of N-XXXXXXLFSSNXKXYXX-C and light chain CDR3 consists of N-XXXASAXXX-C.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein heavy chain CDR2 consists of N-XXSSSXSYXYXXXXXX-C and heavy chain CDR3 consists of N- XXXXGRTSYTATXHNXXXX-C, wherein X is any amino acids.
- the antibody, or antigen binding portion thereof comprises heavy chain CDR1, heavy chain CDR2, heavy chain CDR3, light chain CDR1, light chain CDR2, and light chain CDR3, wherein light chain CDR1 consists of N-XXXXXXLFSSNXKXYXX-C, light chain CDR3 consists of N-XXXASAXXX-C, heavy chain CDR2 consists of N- XXSSSXSYXYXXXXXXX-C, and heavy chain CDR3 consists of N- XXXXGRTSYTATXHNXXXX-C, wherein X is any amino acids.
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of: (i) heavy chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 9, 10 and 11, respectively, and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 17, 18 and 19, respectively;
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of: (i) heavy chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 12, 13 and 14, respectively, and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 20, 21 and 22, respectively;
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise heavy and light chain CDRs selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not consist of N-GFTF[S/A/R] [S/R] [T/Y] [G/S]
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not consist of N-GFTF[S/A/R] [S/R] [T/Y] [G/S]-C (SEQ ID NO: 144) and/or the heavy chain CDR2 does not consist of N-ISSS[S/G][S/A]YI-C (SEQ ID NO: 146).
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not consist of N-GFTF[S/A/R] [S/R] [T/Y] [G/S]-C
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not comprise N-FTF[S/A/R][S/R][T/Y][G/S]M
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not comprise N-FTF[S/A/R][S/R][T/Y][G/S]MN-C (SEQ ID NO: 148) and/or the heavy chain CDR2 does not comprise N-[G/S]ISSS[S/G][S/A]YI[L/Y]YADSV
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain CDR1, a heavy chain CDR2, a heavy chain CDR3, a light chain CDR1, a light chain CDR2, and a light chain CDR3 and wherein the heavy chain CDR1 does not comprise N-FTF[S/A/R][S/R][T/Y][G/S]MN-
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leu 147, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise:
- heavy chain CDR1 consisting of N-GFTFXXXX-C (SEQ ID NO: 145), heavy chain CDR2 consisting of N-ISSSXXYI-C (SEQ ID NO: 147), and heavy chain CDR3 sequence set forth in SEQ ID NO: 121; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 127, 128 and 129, respectively; or
- heavy chain CDR1 consisting of N-FTFXXXXMN-C (SEQ ID NO: 150), heavy chain CDR2 consisting of N-XISSSXXYIXYADSVKG-C (SEQ ID NO: 151), and heavy chain CDR3 sequence set forth in SEQ ID NO: 124; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 130, 131 and 132, respectively.
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leul42, Aspl46, Argl49, Hisl50, Phel53, Leul56, Leul62, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise:
- heavy chain CDR1 consisting of N-GFTFXXXX-C (SEQ ID NO: 145), heavy chain CDR2 consisting of N-ISSSXXYI-C (SEQ ID NO: 147), and heavy chain CDR3 sequence set forth in SEQ ID NO: 121; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 127, 128 and 129, respectively; or
- heavy chain CDR1 consisting of N-FTFXXXXMN-C (SEQ ID NO: 150), heavy chain CDR2 consisting of N-XISSSXXYIXYADSVKG-C (SEQ ID NO: 151), and heavy chain CDR3 sequence set forth in SEQ ID NO: 124; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 130, 131 and 132, respectively.
- the present disclosure provides an isolated antibody or antigen binding portion thereof that specifically binds to an epitope comprising or consisting of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Aspl43, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glu 164 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof does not comprise:
- heavy chain CDR1 consisting of N-GFTFXXXX-C (SEQ ID NO: 145), heavy chain CDR2 consisting of N-ISSSXXYI-C (SEQ ID NO: 147), and heavy chain CDR3 sequence set forth in SEQ ID NO: 121; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 127, 128 and 129, respectively; or
- heavy chain CDR1 consisting of N-FTFXXXXMN-C (SEQ ID NO: 150), heavy chain CDR2 consisting of N-XISSSXXYIXYADSVKG-C (SEQ ID NO: 151), and heavy chain CDR3 sequence set forth in SEQ ID NO: 124; and light chain CDR1, CDR2 and CDR3 sequences set forth in SEQ ID NOs: 130, 131 and 132, respectively.
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises heavy and light chain variable regions, wherein the heavy chain variable region does not comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 37, 59, 81, 103, and 125; and wherein the light chain variable region does not comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 37
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises heavy and light chain variable regions, wherein the heavy chain variable region and the light chain variable region are not amino acid sequences selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises heavy and light chain variable regions, wherein the heavy chain variable region does not comprise an amino acid sequence which is at least 90% identical to the amino acid sequence selected from the group consisting of SEQ ID NOs: 15, 37, 59, 81, 103, and 125; and wherein the light chain variable region does not comprise an epitope comprising one or
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises heavy and light chain variable regions, wherein the heavy chain variable region and the light chain variable region do not comprise amino acid sequences at least 90% identical to the amino acid sequences selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain and a light chain, wherein the heavy chain does not comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 25,47, 69, 91, 113, and 135; and wherein the light chain does not comprise an amino acid sequence selected from the group consisting of SEQ
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy and a light chain, wherein the heavy chain does not comprise an amino acid sequence which is at least 90% identical to the amino acid sequence selected from the group consisting of SEQ ID NOs: 25,47, 69, 91, 113, and 135; and wherein the light chain does not comprise an amino acid
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain and a light chain, wherein the heavy chain does not comprise an amino acid sequence selected from the group consisting of SEQ ID NOs: 29, 51, 73, 95, 117, and 139; and wherein the light chain does not comprise an amino acid sequence selected from the group consisting of SEQ ID NOs:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy and a light chain, wherein the heavy chain does not comprise an amino acid sequence which is at least 90% identical to the amino acid sequence selected from the group consisting of SEQ ID NOs: 29, 51, 73, 95, 117, and 139; and wherein the light chain does not comprise an amino acid sequence
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain and a light chain, and wherein the heavy chain and the light chain do not comprise amino acid sequences selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy chain and a light chain and wherein the heavy chain and the light chain do not comprise amino acid sequences at least 90% identical to the amino acid sequences selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leu 162, Pro 163, and Glul64 of SEQ ID NO: 2 (IL-27p28), wherein the antibody or antigen binding portion thereof comprises a heavy and a light chain and wherein the heavy chain and the light chain do not comprise amino acid sequences selected from the group consisting of:
- the present disclosure provides an isolated antibody or antigen binding portion thereof that antagonizes IL-27 and specifically binds to an epitope comprising one or more amino acids of Gln37, Leu38, Glu42, Glu46, Val49, Ser50, Leu53, Lys56, Leul42, Asp 143, Argl45, Aspl46, Leul47, Argl49, Hisl50, Argl52, Phel53, Leul56, Alal57, Glyl59, Phel60, Asnl61, Leul62, Prol63, and Glul64 of SEQ ID NO: 2 (IL27-p28), wherein the antibody or antigen binding portion thereof comprises a heavy and a light chain and wherein the heavy chain and the light chain do not comprise amino acid sequences at least 90% identical to the amino acid sequences selected from the group consisting of: (i) SEQ ID NO: 29 and 27, respectively; (ii) SEQ ID NO: 51 and 49, respectively; (ii) SEQ ID NO
- the antibody, or antigen-binding portion thereof, useful in the methods and compositions disclosed herein is present in a pharmaceutical composition.
- some aspects of the present disclosure are directed to a pharmaceutical composition comprising an anti-IL-27 antibody with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant.
- acceptable formulation materials preferably are nontoxic to recipients at the dosages and concentrations employed.
- the formulation material(s) are for s.c. and/or I.V. administration.
- the pharmaceutical composition comprises formulation materials for modifying, maintaining or preserving, for example, the pH, osmolality, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
- suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen- sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxypropyl-beta- cyclodextrin); fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents
- the formulation comprises PBS; 20 mM NaOAC, pH 5.2, 50 mM NaCl; and/or 10 mM NAOAC, pH 5.2, 9% Sucrose.
- the optimal pharmaceutical composition will be determined by one skilled in the art depending upon, for example, the intended route of administration, delivery format and desired dosage. See, for example, Remington's Pharmaceutical Sciences, supra. In certain aspects, such compositions influence the physical state, stability, rate of in vivo release and/or rate of in vivo clearance of the anti-IL-27 antibody. - I l l -
- the primary vehicle or carrier in a pharmaceutical composition is either aqueous or non-aqueous in nature.
- a suitable vehicle or carrier is water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration.
- the saline comprises isotonic phosphate-buffered saline.
- neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles.
- pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about pH 4.0-5.5.
- the pharmaceutical compositon further comprises sorbitol or a suitable substitute therefore.
- a composition comprising an anti-IL-27 antibody is prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution.
- a composition comprising an anti-IL-27 antibody is formulated as a lyophilizate using appropriate excipients such as sucrose.
- the pharmaceutical composition is selected for parenteral delivery.
- the compositions is selected for inhalation or for delivery through the digestive tract, such as orally. The preparation of such pharmaceutically acceptable compositions is within the ability of one skilled in the art.
- the formulation components are present in concentrations that are acceptable to the site of administration.
- buffers are used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8.
- a therapeutic composition when parenteral administration is contemplated, is in the form of a pyrogen-free, parenterally acceptable aqueous solution comprising an anti-IL-27 antibody, in a pharmaceutically acceptable vehicle.
- a vehicle for parenteral injection is sterile distilled water in which an anti-IL-27 antibody is formulated as a sterile, isotonic solution, and properly preserved.
- the preparation involves the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that can provide for the controlled or sustained release of the product which can then be delivered via a depot injection.
- hyaluronic acid is also used. Hyaluronic acid, when present, can have the effect of promoting sustained duration in the circulation.
- implantable drug delivery devices are used to introduce the desired molecule.
- a pharmaceutical composition is formulated for inhalation.
- an anti-IL-27 antibody is formulated as a dry powder for inhalation.
- an inhalation solution comprising an anti-IL-27 antibody is formulated with a propellant for aerosol delivery.
- solutions are nebulized. Pulmonary administration is further described in PCT application No. PCT/US94/001875, which describes pulmonary delivery of chemically modified proteins.
- the pharmaceutical composition disclosed herein is formulated for oral administration.
- the pharmaceutical composition is administered orally.
- an anti-IL-27 antibody that is administered in this fashion is formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
- a capsule is designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre systemic degradation is minimized.
- at least one additional agent is included to facilitate absorption of an anti-IL-27 antibody.
- diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders are also employed.
- a pharmaceutical composition involves an effective quantity of an anti-IL-27 antibody in a mixture with non-toxic excipients which are suitable for the manufacture of tablets.
- suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
- sustained-release preparations can include semipermeable polymer matrices in the form of shaped articles, e.g. films, or microcapsules.
- Sustained release matrices can include polyesters, hydrogels, polylactides (U.S. Pat. No. 3,773,919 and EP 058,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al., Biopolymers, 22:547-556 (1983)), poly (2-hydroxyethyl-methacrylate) (Langer et al., J. Biomed. Mater. Res., 15: 167-277 (1981) and Langer, Chem.
- sustained release compositions can also include liposomes, which can be prepared by any of several methods known in the art. See, e.g., Eppstein et al, Proc. Natl. Acad. Sci. USA, 82:3688-3692 (1985); EP 036,676; EP 088,046 and EP 143,949.
- the pharmaceutical composition to be used for in vivo administration typically is sterile. In certain aspects, this is accomplished by filtration through sterile filtration membranes. In certain aspects, where the composition is lyophilized, sterilization using this method is conducted either prior to or following lyophilization and reconstitution. In certain aspects, the composition for parenteral administration is stored in lyophilized form or in a solution. In certain aspects, parenteral compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- the pharmaceutical composition once the pharmaceutical composition has been formulated, it is stored in sterile vials as a solution, suspension, gel, emulsion, solid, or as a dehydrated or lyophilized powder. In certain aspects, such formulations are stored either in a ready-to-use form or in a form (e.g., lyophilized) that is reconstituted prior to administration.
- kits are provided for producing a single-dose administration unit.
- the kit comprises both a first container having a dried protein and a second container having an aqueous formulation.
- kits comprising single and multi-chambered pre-filled syringes (e.g., liquid syringes and lyosyringes) are included.
- an anti-IL-27 antibody, or antigen binding portion thereof, provided by the disclosure can be combined with one or more additional therapeutics or treatments, e.g., another therapeutic or treatment for a cancer.
- the anti-IL-27 antibody, or antigen binding portion thereof can be administered to a subject (e.g., a human patient) in combination with one or more additional therapeutics, wherein the combination provides a therapeutic benefit to a subject who has, or is at risk of developing, cancer.
- an anti-IL-27 antibody, or antigen binding portion thereof, and the one or more additional therapeutics are administered at the same time (e.g., simultaneously).
- the anti-IL-27 antibody, or antigen binding portion thereof is administered first in time and the one or more additional therapeutics are administered second in time (e.g., sequentially).
- the one or more additional therapeutics are administered first in time and the anti-IL-27 antibody is administered second in time.
- An anti-IL-27 antibody or an antigen-binding fragment thereof described herein can replace or augment a previously or currently administered therapy.
- administration of the one or more additional therapeutics can cease or diminish, e.g., be administered at lower levels.
- administration of the previous therapy can be maintained.
- a previous therapy will be maintained until the level of the anti-IL-27 antibody reaches a level sufficient to provide a therapeutic effect.
- the disclosure provides a method of treating cancer in a subject, the method comprising administering to the subject an effective amount of an isolated antibody, or antigen binding portion thereof, that specifically binds to and antagonizes IL-27, provided by the disclosure, in combination with one or more additional therapeutic agents or procedure, wherein the second therapeutic agent or procedure is selected from the group consisting of: a chemotherapy, a targeted anti-cancer therapy, an oncolytic drug, a cytotoxic agent, an immune-based therapy, a cytokine, surgical procedure, a radiation procedure, an activator of a costimulatory molecule, an inhibitor of an inhibitory molecule, a vaccine, or a cellular immunotherapy, a biologic agent, or a combination thereof.
- the second therapeutic agent or procedure is selected from the group consisting of: a chemotherapy, a targeted anti-cancer therapy, an oncolytic drug, a cytotoxic agent, an immune-based therapy, a cytokine, surgical procedure, a radiation procedure, an activator of a costimul
- the one or more additional therapeutic agents is a PD-1 antagonist, a TIM-3 inhibitor, a LAG-3 inhibitor, a TIGIT inhibitor, a CD112R inhibitor, a TAM inhibitor, a STING agonist, a 4- IBB agonist, or a combination thereof.
- the one or more additional therapeutic agents is a CD39 antagonist, a CD73 antagonist, a CCR8 antagonist, or a combination thereof.
- the anti-CD73 is any anti-CD73 antibody disclosed in, e.g. , U.S. Publication No. 2019/0031766 Al, which is incorporated by reference herein in its entirety.
- the anti-CD39 is any anti-CD39 antibody disclosed in, e.g., Int'l Publication No. WO 2019/178269 A2, which is incorporated by reference herein in its entirety.
- the one or more additional therapeutic agents is a PD-1 antagonist.
- the PD-1 antagonist is selected from the group consisting of: PDR001, nivolumab, pembrolizumab, pidilizumab, tislelizumab, zimberelimuab, MEDI0680, REGN2810, TSR-042, PF-06801591, and AMP-224.
- the one or more additional therapeutic agents is a PD-L1 inhibitor.
- the PD-L1 inhibitor is selected from the group consisting of: FAZ053, Atezolizumab, Avelumab, Durvalumab, and BMS-936559.
- the disclosure provides a method of enhancing one or more activities of an anti-PD-1 antibody (e.g., enhances PD- 1 -mediated cytokine secretion; enhances anti-PD-1 mediated TNFa secretion; enhances anti-PD-1 mediated IL-6 secretion from a cell exposed to anti-PD-1 antibodies), the method comprising exposing a cell to an antibody, or antigen binding portion thereof, provided by the disclosure, concurrently with or sequentially to an anti-PD-1 antibody, thereby to enhance one or more activities of the anti -PD 1 antibody.
- an anti-PD-1 antibody e.g., enhances PD- 1 -mediated cytokine secretion; enhances anti-PD-1 mediated TNFa secretion; enhances anti-PD-1 mediated IL-6 secretion from a cell exposed to anti-PD-1 antibodies
- the one or more additional therapeutic agents is Sunitinib
- the one or more additional therapeutic agents is a TIM-3 inhibitor, optionally wherein the TIM-3 inhibitor is MGB453 or TSR-022.
- the one or more additional therapeutic agents is a LAG-3 inhibitor, optionally wherein the LAG-3 inhibitor is selected from the group consisting of LAG525, BMS- 986016, and TSR-033.
- the one or more additional therapeutic agents is a TIGIT inhibitor.
- the one or more additional therapeutic agents is a CD112R inhibitor. In some aspects, the one or more additional therapeutic agents is a TAM (Axl, Mer, Tyro) inhibitor. In some aspects, the one or more additional therapeutic agents is a STING agonist. In some aspects, the one or more additional therapeutic agents is a 4- IBB agonist.
- the one or more additional therapeutic agents is a tyrosine kinase inhibitor, an agent targeting the adenosine axis (for example a CD39 antagonist, a CD73 antagonist or a A2AR, A2BR or dual A2AR/A2BR antagonist), a CCR8 antagonist, a CTLA4 antagonist, a VEG-F inhibitor or a combination thereof.
- the methods disclosed herein comprise administering an antibody or an antigen-binding portion thereof that specifically binds to to IL-27 and a chemotherapeutic agent.
- Chemotherapeutic agents suitable for combination and/or co-administration with compositions of the present disclosure include, for example: taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxyanthrancindione, mitoxantrone, mithramycin, actinomycin D, 1 -dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
- Further agents include, for example, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioTEPA, chlorambucil, melphalan, carmustine (BSNU), lomustine (CCNU), cyclophosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, cis-dichlordiamine platinum (II)(DDP), procarbazine, altretamine, cisplatin, carboplatin, oxaliplatin, nedaplatin, satraplatin, or triplatin tetranitrate), anthracycline (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dact
- the methods disclosed herein comprise administering an antibody or an antigen-binding portion thereof that specifically binds to to IL-27 and one or more PD-1 antagonist.
- the one or more PD-1 antagonist specifically binds to human PD-1 or PD-L1 and inhibits PD-1/PD-L1 biological activity and/or downstream pathway(s) and/or cellular processed mediated by human PD-1/PD-L1 signaling or other human PD- 1/PD-Ll -mediated functions.
- PD-1 antagonists that directly or allosterically block, antagonize, suppress, inhibit or reduce PD-1/PD-L1 biological activity, including downstream pathways and/or cellular processes mediated by PD-1/PD-L1 signaling, such as receptor binding and/or elicitation of a cellular response to PD-1/PD-L1. Also provided herein are PD-1 antagonists that reduce the quantity or amount of human PD-1 or PD-L1 produced by a cell or subject.
- the disclosure provides a PD-1 antagonist that binds human PD-1 and prevents, inhibits or reduces PD-L1 binding to PD-1.
- the PD-1 antagonist binds to the mRNA encoding PD-1 or PD-L1 and prevents translation.
- the PD-1 antagonist binds to the mRNA encoding PD-1 or PD-L1 and causes degradation and/or turnover.
- the PD-1 antagonist inhibits PD-1 signaling or function.
- the PD-1 antagonist blocks binding of PD-1 to PD-L1, PD-L2, or to both PD-L1 and PD- L2.
- the PD-1 antagonist blocks binding of PD-1 to PD-L1. In some aspects, the PD-1 antagonist blocks binding of PD-1 to PD-L2. In some aspects, the PD-1 antagonist blocks the binding of PD-1 to PD-L1 and PD-L2. In some aspects, the PD-1 antagonist specifically binds PD-1. In some aspects, the PD-1 antagonist specifically binds PD-L1. In some aspects, the PD-1 antagonist specifically binds PD-L2.
- the PD-1 antagonist inhibits the binding of PD-1 to its cognate ligand. In some aspects, the PD-1 antagonist inhibits the binding of PD-1 to PD-L1, PD-1 to PD- L2, or PD-1 to both PD-L1 and PD-L2. In some aspects, the PD-1 antagonist does not inhibit the binding of PD-1 to its cognate ligand.
- the PD-1 antagonist is an isolated antibody (mAh), or antigen binding fragment thereof, which specifically binds to PD-1 or PD-L1. In some aspects, the PD-1 antagonist is an antibody or antigen binding fragment thereof that specifically binds to human PD- 1. In some aspects, the PD-1 antagonist is an antibody or antigen binding fragment thereof that specifically binds to human PD-L1. In some aspects, the PD-1 antagonist is an antibody or antigen binding fragment that binds to human PD-L1 and inhibits the binding of PD-L1 to PD-1. In some aspects, the PD-1 antagonist is an antibody or antigen binding fragment that binds to human PD-1 and inhibits the binding of PD-L1 to PD-1.
- anti-human PD- 1 antibodies, or antigen binding fragments thereof, that may comprise the PD-1 antagonist in any of the compositions, methods, and uses provided by the disclosure include, but are not limited to: KEYTRUDA ® (pembrolizumab, MK-3475, h409All; see US8952136, US8354509, US8900587, and EP2170959, all of which are included herein by reference in their entirety; Merck), OPDIVO ® (nivolumab, BMS-936558, MDX-1106, ONO-4538; see US7595048, US8728474, US9073994, US9067999, EP1537878, US8008449, US8779105, and EP2161336, all of which are included herein by reference in their entirety; Bristol Myers Squibb), MEDI0680 (AMP-514), BGB-A317 and BGB-108 (BeiGene), 244C8 and 388D4 (see W
- the PD-1 antagonist is pembrolizumab. In some aspects, the PD-1 antagonist is nivolumab. In some aspects, the methods disclosed herein comprise administering an antibody or an antigen-binding portion thereof that specifically binds to to IL-27 and pembrolizumab. In some aspects, the methods disclosed herein comprise administering an antibody or an antigen-binding portion thereof that specifically binds to to IL-27 and nivolumab.
- Examples of anti -human PD-L1 antibodies, or antigen binding fragments thereof, that may comprise the PD-1 antagonist in any of the compositions, methods, and uses provided by the disclosure include, but are not limited to: BAVENCIO ® (avelumab, MSB0010718C, see WO20 13/79174, which is incorporated herein by reference in its entirety; Merck/Pfizer), IMFINZI ® (durvalumab, MEDI4736), TECENTRIQ ® (atezolizumab, MPDL3280A, RG7446; see W02010/077634, which is incorporated herein by reference in its entirety; Roche), MDX-1105 (BMS-936559, 12A4; seeUS7943743 and WO2013/173223, both of which are incorporated herein by reference in their entirety; Medarex/BMS), and FAZ053 (Novartis). Accordingly, in some aspects the PD-1 antagonist is avelumab. In some aspects the
- the PD-1 antagonist is an immunoadhesin that specifically bind to human PD-1 or human PD-L1, e.g., a fusion protein containing the extracellular or PD-1 binding portion of PD-L1 or PD-L2 fused to a constant region such as an Fc region of an immunoglobulin molecule.
- immunoadhesion molecules that specifically bind to PD-1 are described in W02010/027827 and WO2011/066342, both of which are incorporated herein by reference in their entirety.
- the PD-1 antagonist is AMP -224 (also known as B7-DCIg), which is a PD-L2-FC fusion protein that specifically binds to human PD-1.
- the PD-1/PD-L1 antagonist is a small molecule, a nucleic acid, a peptide, a peptide mimetic, a protein, a carbohydrate, a carbohydrate derivative, or a glycopolymer.
- Exemplary small molecule PD-1 inhibitors are described in Zhan et al., (2016) Drug Discov Today 21(6):1027-1036.
- the methods disclosed herein comprise administering an antibody or an antigen-binding portion thereof that specifically binds to to IL-27 and a TIM-3 inhibitor.
- the TIM-3 inhibitor may be an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or an oligopeptide.
- the TIM-3 inhibitor is chosen from MGB453 (Novartis), TSR-022 (Tesaro), or LY3321367 (Eli Lilly).
- the anti-IL-27 antibody, or antigen binding portion thereof is administered in combination with MGB453.
- the anti-IL-27 antibody, or antigen binding portion thereof is administered in combination with TSR-022.
- the methods disclosed herein comprise administering an antibody or an antigen-binding portion thereof that specifically binds to to IL-27 and a LAG-3 inhibitor.
- the LAG-3 inhibitor is an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, an oligopeptide, or any combination thereof.
- the LAG-3 inhibitor is chosen from LAG525 (Novartis), BMS-986016 (Bristol-Myers Squibb), TSR-033 (Tesaro), MK-4280 (Merck & Co), or REGN3767 (Regeneron).
- the methods disclosed herein comprise administering an antibody or an antigen-binding portion thereof that specifically binds to to IL-27 and a TIGIT inhibitor. In some aspects, the methods disclosed herein comprise administering an antibody or an antigen binding portion thereof that specifically binds to to IL-27 and a kinase inhibitor (e.g., a tyrosine kinase inhibitor (TKI)). In some aspects, the methods disclosed herein comprise administering an antibody or an antigen-binding portion thereof that specifically binds to to IL-27 and a CD112R inhibitor.
- a kinase inhibitor e.g., a tyrosine kinase inhibitor (TKI)
- the methods disclosed herein comprise administering an antibody or an antigen-binding portion thereof that specifically binds to to IL-27 and a TAM receptor inhibitor. In some aspects, the methods disclosed herein comprise administering an antibody or an antigen- binding portion thereof that specifically binds to to IL-27 and a STING agonist and/or a 4- IBB agonist.
- an anti-IL-27 antibody, or antigen binding portion thereof, provided by the disclosure is combined (e.g., administered in combination) with a tyrosine kinase inhibitor, an agent targeting the adenosine axis (for example a CD39 antagonist, a CD73 antagonist or a A2AR, A2BR or dual A2AR/A2BR antagonist), a CCR8 antagonist, a CTLA4 antagonist, a VEG-F inhibitor or a combination thereof.
- a tyrosine kinase inhibitor for example a CD39 antagonist, a CD73 antagonist or a A2AR, A2BR or dual A2AR/A2BR antagonist
- a CCR8 antagonist for example a CD39 antagonist, a CD73 antagonist or a A2AR, A2BR or dual A2AR/A2BR antagonist
- CTLA4 antagonist for example a CD39 antagonist, a CD73 antagonist or a A2AR, A2BR or dual A2AR/A2BR antagonist
- the methods disclosed herein comprise administering an antibody or an antigen-binding portion thereof that specifically binds to to IL-27 and a cell therapy.
- the cell therapy comprises a modified immune cell therapy.
- the cell therapy comprises a chimeric antigen receptor (CAR) modified immune cell therapy, e.g., CAR T therapy.
- the cell therapy comprises an engineered T cell receptor (TCR) immune cell therapy.
- the cell therapy comprises an allogeneic tumor infiltrating lymphocyte (TIL) therapy.
- the disclosure also features methods for producing any of the anti-IL-27 antibodies or antigen-binding fragments thereof described herein.
- methods for preparing an antibody described herein can include immunizing a subject (e.g., a non-human mammal) with an appropriate immunogen. Suitable immunogens for generating any of the antibodies described herein are set forth herein.
- a skilled artisan can immunize a suitable subject (e.g., a non-human mammal such as a rat, a mouse, a gerbil, a hamster, a dog, a cat, a pig, a goat, a horse, or a non-human primate) with IL-27.
- a suitable subject e.g., a non-human mammal such as a rat, a mouse, a gerbil, a hamster, a dog, a cat, a pig, a goat, a horse, or a non-human primate
- a full-length human IL-27p28 monomer polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 2 is used as the immunogen.
- a suitable subject e.g., a non-human mammal
- the immunogen can be administered to a subject (e.g., a non-human mammal) with an adjuvant.
- Adjuvants useful in producing an antibody in a subject include, but are not limited to, protein adjuvants; bacterial adjuvants, e.g., whole bacteria (BCG, Corynebacterium parvum or Salmonella minnesota ) and bacterial components including cell wall skeleton, trehalose dimycolate, monophosphoryl lipid A, methanol extractable residue (MER) of tubercle bacillus, complete or incomplete Freund’s adjuvant; viral adjuvants; chemical adjuvants, e.g., aluminum hydroxide, and iodoacetate and cholesteryl hemi succinate.
- protein adjuvants e.g., whole bacteria (BCG, Corynebacterium parvum or Salmonella minnesota ) and bacterial components including cell wall skeleton, trehalose dimycolate, monophosphoryl lipid A, methanol extractable residue (MER) of tubercle bacillus, complete or incomplete Freund’s adjuvant
- the methods include preparing a hybridoma cell line that secretes a monoclonal antibody that binds to the immunogen.
- a suitable mammal such as a laboratory mouse is immunized with an IL-27 polypeptide as described above.
- Antibody- producing cells e.g., B cells of the spleen
- B cells of the spleen of the immunized mammal can be isolated two to four days after at least one booster immunization of the immunogen and then grown briefly in culture before fusion with cells of a suitable myeloma cell line.
- the cells can be fused in the presence of a fusion promoter such as, e.g., vaccinia virus or polyethylene glycol.
- the hybrid cells obtained in the fusion are cloned, and cell clones secreting the desired antibodies are selected.
- spleen cells of Balb/c mice immunized with a suitable immunogen can be fused with cells of the myeloma cell line PAI or the myeloma cell line Sp2/0-Ag 14.
- suitable culture medium which is supplemented with a selection medium, for example HAT medium, at regular intervals in order to prevent normal myeloma cells from overgrowing the desired hybridoma cells.
- the obtained hybrid cells are then screened for secretion of the desired antibodies, e.g., an antibody that binds to human IL-27 and
- the desired antibodies e.g., an antibody that binds to human IL-27 and
- a skilled artisan can identify an anti-IL-27 antibody from a non-immune biased library as described in, e.g., U.S. patent no. 6,300,064 (to Knappik et al.; Morphosys AG) and Schoonbroodt et al. (2005) Nucleic Acids Res 33(9):e81.
- the methods described herein can involve, or be used in conjunction with, e.g., phage display technologies, bacterial display, yeast surface display, eukaryotic viral display, mammalian cell display, and cell-free (e.g., ribosomal display) antibody screening techniques (see, e.g., Etz et al. (2001 ) J Bacteriol 183:6924-6935: Georgias (2000) Curr Opin Biotechnol 11_:450-454; Klemm et al. (2000) Microbiology 146:3025-3032: Kieke et al. (1997) Protein Eng 10:1303-1310: Yeung et al.
- phage display technologies e.g., phage display technologies, bacterial display, yeast surface display, eukaryotic viral display, mammalian cell display, and cell-free (e.g., ribosomal display) antibody screening techniques
- Etz et al. 2001
- phage display methods functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them.
- phage can be utilized to display antigen-binding domains of antibodies, such as Fab, Fv, or disulfide-bond stabilized Fv antibody fragments, expressed from a repertoire or combinatorial antibody library (e.g., human or murine).
- Phage used in these methods are typically filamentous phage such as fd and Ml 3.
- the antigen binding domains are expressed as a recombinantly fused protein to any of the phage coat proteins pill, pVIII, orpIX.
- phage display methods that can be used to make the immunoglobulins, or fragments thereof, described herein include those disclosed in Brinkman et al. (1995 J Immunol Methods 182:41-50: Ames et al. (1995) J Immunol Methods 184:177-186: Kettleborough et al. (1994) Eur J Immunol 24:952-958; Persic et al. (1997) Gene 187:9-18: Burton et al. (1994) Advances in Immunology 57:191-280; and PCT publication nos.
- WO 90/02809 WO 91/10737, WO 92/01047, WO 92/18619, WO 93/11236, WO 95/15982, and WO 95/20401.
- Suitable methods are also described in, e.g., U.S. patent nos. 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969,108.
- the phage display antibody libraries can be generated using mRNA collected from B cells from the immunized mammals.
- a splenic cell sample comprising B cells can be isolated from mice immunized with IL-27 polypeptide as described above.
- mRNA can be isolated from the cells and converted to cDNA using standard molecular biology techniques. See, e.g., Sambrook et al. (1989) "Molecular Cloning: A Laboratory Manual, 2 nd Edition," Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.; Harlow and Lane (1988), supra ; Benny K. C. Lo (2004), supra ; and Borrebaek (1995), supra.
- the cDNA coding for the variable regions of the heavy chain and light chain polypeptides of immunoglobulins are used to construct the phage display library. Methods for generating such a library are described in, e.g., Merz et al. (1995) J Neurosci Methods 62(l-2):213-9: Di Niro et al. (2005) Biochem J 388(Pt 31:889-894: and Engberg et al. (1995) Methods Mol Biol 51:355-376.
- a combination of selection and screening can be employed to identify an antibody of interest from, e.g., a population of hybridoma-derived antibodies or a phage display antibody library.
- Suitable methods are known in the art and are described in, e.g., Hoogenboom (1997) Trends in Biotechnology 15:62-70; Brinkman et al. (1995), supra ; Ames et al. (1995), supra ; Kettleborough et al. (1994), supra ; Persic et al. (1997), supra ; and Burton et al. (1994), supra.
- a plurality of phagemid vectors each encoding a fusion protein of a bacteriophage coat protein (e.g., pill, pVIII, or pIX of M13 phage) and a different antigen combining region are produced using standard molecular biology techniques and then introduced into a population of bacteria (e.g., E. coli).
- Expression of the bacteriophage in bacteria can, in some aspects, require use of a helper phage. In some aspects, no helper phage is required (see, e.g., Chasteen et al., (2006) Nucleic Acids Res 34(21):el45).
- Phage produced from the bacteria are recovered and then contacted to, e.g., a target antigen bound to a solid support (immobilized). Phage may also be contacted to antigen in solution, and the complex is subsequently bound to a solid support.
- a subpopulation of antibodies screened using the above methods can be characterized for their specificity and binding affinity for a particular antigen (e.g., human IL- 27p28) using any immunological or biochemical based method known in the art.
- a particular antigen e.g., human IL- 27p28
- specific binding of an antibody to IL-27p28 may be determined for example using immunological or biochemical based methods such as, but not limited to, an ELISA assay, SPR assays, immunoprecipitation assay, affinity chromatography, and equilibrium dialysis as described above.
- Immunoassays which can be used to analyze immuno-specific binding and cross-reactivity of the antibodies include, but are not limited to, competitive and non-competitive assay systems using techniques such as Western blots, RIA, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays. Such assays are routine and well known in the art.
- nucleic acids encoding the CDRs can be chemically synthesized as described in, e.g., Shiraishi et al. (2007) Nucleic Acids Symposium Series 5101:129- 130 and U.S. Patent No. 6,995,259.
- nucleic acid sequence encoding an acceptor antibody the region of the nucleic acid sequence encoding the CDRs can be replaced with the chemically synthesized nucleic acids using standard molecular biology techniques.
- the 5’ and 3’ ends of the chemically synthesized nucleic acids can be synthesized to comprise sticky end restriction enzyme sites for use in cloning the nucleic acids into the nucleic acid encoding the variable region of the donor antibody.
- the anti-IL-27 antibodies described herein comprise an altered heavy chain constant region that has reduced (or no) effector function relative to its corresponding unaltered constant region. Effector functions involving the constant region of the anti-IL-27 antibody may be modulated by altering properties of the constant or Fc region.
- Altered effector functions include, for example, a modulation in one or more of the following activities: antibody- dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), apoptosis, binding to one or more Fc-receptors, and pro-inflammatory responses.
- ADCC antibody- dependent cellular cytotoxicity
- CDC complement-dependent cytotoxicity
- apoptosis binding to one or more Fc-receptors
- Fc-receptors Fc-receptors
- pro-inflammatory responses include, for example, a modulation in one or more of the following activities: antibody- dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), apoptosis, binding to one or more Fc-receptors, and pro-inflammatory responses.
- Modulation refers to an increase, decrease, or elimination of an effector function activity exhibited by a subject antibody containing an altered constant region as compared to the activity of the unaltered form of the constant region.
- modulation includes
- the anti-IL-27 antibodies described herein comprise an IgG4 heavy chain constant region.
- the IgG4 heavy chain constant region is a wild type IgG4 heavy chain constant region.
- the IgG4 constant region comprises a mutation, e.g., one or both of S228P and L235E or L235A, e.g., according to EU numbering (Kabat, E. A., et al., supra).
- the anti-IL-27 antibodies described herein comprise an IgGl constant region.
- the IgGl heavy chain constant region is a wild type IgGl heavy chain constant region.
- the IgGl heavy chain constant region comprises a mutation.
- An altered constant region with altered FcR binding affinity and/or ADCC activity and/or altered CDC activity is a polypeptide which has either an enhanced or diminished FcR binding activity and/or ADCC activity and/or CDC activity compared to the unaltered form of the constant region.
- An altered constant region which displays increased binding to an FcR binds at least one FcR with greater affinity than the unaltered polypeptide.
- An altered constant region which displays decreased binding to an FcR binds at least one FcR with lower affinity than the unaltered form of the constant region.
- Such variants which display decreased binding to an FcR may possess little or no appreciable binding to an FcR, e.g., 0 to 50% (e.g., less than 50, 49, 48,
- an altered constant region that displays modulated ADCC and/or CDC activity may exhibit either increased or reduced ADCC and/or CDC activity compared to the unaltered constant region.
- the anti-IL-27 antibody comprising an altered constant region can exhibit approximately 0 to 50% (e.g., less than 50, 49, 48, 47, 46, 45, 44, 43,
- An anti-IL-27 antibody described herein comprising an altered constant region displaying reduced ADCC and/or CDC may exhibit reduced or no ADCC and/or CDC activity.
- an anti-IL-27 antibody described herein exhibits reduced or no effector function.
- an anti-IL-27 antibody comprises a hybrid constant region, or a portion thereof, such as a G2/G4 hybrid constant region (see e.g., Burton et al. (1992) Advlmmun 5L1-18; Canfield et al. (1991) J Exp Med 173:1483-1491; and Mueller et al. (1997) Mol Immunol 34(61:441-452). See above.
- an anti-IL-27 antibody may contain an altered constant region exhibiting enhanced or reduced complement dependent cytotoxicity (CDC).
- Modulated CDC activity may be achieved by introducing one or more amino acid substitutions, insertions, or deletions in an Fc region of the antibody. See, e.g., U.S. patent no. 6,194,551. Alternatively, or additionally, cysteine residue(s) may be introduced in the Fc region, thereby allowing interchain disulfide bond formation in this region.
- the homodimeric antibody thus generated may have improved or reduced internalization capability and/or increased or decreased complement- mediated cell killing. See, e.g., Caron et al.
- the antibodies or antigen-binding fragments thereof described herein can be produced using a variety of techniques known in the art of molecular biology and protein chemistry.
- a nucleic acid encoding one or both of the heavy and light chain polypeptides of an antibody can be inserted into an expression vector that contains transcriptional and translational regulatory sequences, which include, e.g., promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, transcription terminator signals, polyadenylation signals, and enhancer or activator sequences.
- the regulatory sequences include a promoter and transcriptional start and stop sequences.
- the expression vector can include more than one replication system such that it can be maintained in two different organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification.
- Several possible vector systems are available for the expression of cloned heavy chain and light chain polypeptides from nucleic acids in mammalian cells.
- One class of vectors relies upon the integration of the desired gene sequences into the host cell genome.
- Cells which have stably integrated DNA can be selected by simultaneously introducing drug resistance genes such as E. coli gpt (Mulligan and Berg (1981) Proc Natl Acad Sci USA 78:2072) or Tn5 neo (Southern and Berg (1982) Mol Appl Genet 1:327).
- the selectable marker gene can be either linked to the DNA gene sequences to be expressed or introduced into the same cell by co-transfection (Wigler et al. (1979) Cell 16:77).
- a second class of vectors utilizes DNA elements which confer autonomously replicating capabilities to an extrachromosomal plasmid.
- These vectors can be derived from animal viruses, such as bovine papillomavirus (Sarver et al. (1982) Proc Natl Acad Sci USA , 79:7147), cytomegalovirus, polyoma virus (Deans et al. (1984) Proc Natl Acad Sci USA 8k 1292), or SV40 virus (Lusky and Botchan (1981) Nature 293:79).
- the expression vectors can be introduced into cells in a manner suitable for subsequent expression of the nucleic acid.
- the method of introduction is largely dictated by the targeted cell type, discussed below. Exemplary methods include CaPCri precipitation, liposome fusion, cationic liposomes, electroporation, viral infection, dextran-mediated transfection, polybrene-mediated transfection, protoplast fusion, and direct microinjection.
- Appropriate host cells for the expression of antibodies or antigen-binding fragments thereof include yeast, bacteria, insect, plant, and mammalian cells. Of particular interest are bacteria such as E. coli , fungi such as Saccharomyces cerevisiae and Pichia pas tor is, insect cells such as SF9, mammalian cell lines (e.g., human cell lines), as well as primary cell lines.
- an antibody or fragment thereof can be expressed in, and purified from, transgenic animals (e.g., transgenic mammals).
- transgenic animals e.g., transgenic mammals
- an antibody can be produced in transgenic non-human mammals (e.g., rodents) and isolated from milk as described in, e.g., Houdebine (2002) Curr Opin Biotechnol 13(61:625-629: van Kuik-Romeijn et al. (2000) Transgenic Res 9(2): 155-159; and Pollock et al. (1999) J Immunol Methods 231(1-2): 147-157.
- the antibodies and fragments thereof can be produced from the cells by culturing a host cell transformed with the expression vector containing nucleic acid encoding the antibodies or fragments, under conditions, and for an amount of time, sufficient to allow expression of the proteins.
- Such conditions for protein expression will vary with the choice of the expression vector and the host cell and will be easily ascertained by one skilled in the art through routine experimentation.
- antibodies expressed in E. coli can be refolded from inclusion bodies (see, e.g., Hou et al.
- an antibody or fragment thereof can be isolated or purified in a variety of ways known to those skilled in the art depending on what other components are present in the sample.
- Standard purification methods include electrophoretic, molecular, immunological, and chromatographic techniques, including ion exchange, hydrophobic, affinity, and reverse-phase HPLC chromatography.
- an antibody can be purified using a standard anti-antibody column (e.g., a protein-A or protein-G column). Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. See, e.g., Scopes (1994) "Protein Purification, 3 rd edition," Springer- Verlag, New York City, New York. The degree of purification necessary will vary depending on the desired use. In some instances, no purification of the expressed antibody or fragments thereof will be necessary.
- Methods for determining the yield or purity of a purified antibody or fragment thereof include, e.g., Bradford assay, UV spectroscopy, Biuret protein assay, Lowry protein assay, amido black protein assay, high pressure liquid chromatography (HPLC), mass spectrometry (MS), and gel electrophoretic methods (e.g., using a protein stain such as Coomassie Blue or colloidal silver stain).
- the antibodies or antigen-binding fragments thereof can be modified following their expression and purification.
- the modifications can be covalent or non-covalent modifications.
- Such modifications can be introduced into the antibodies or fragments by, e.g., reacting targeted amino acid residues of the polypeptide with an organic derivatizing agent that is capable of reacting with selected side chains or terminal residues.
- Suitable sites for modification can be chosen using any of a variety of criteria including, e.g., structural analysis or amino acid sequence analysis of the antibodies or fragments.
- the antibodies or antigen-binding fragments thereof can be conjugated to a heterologous moiety.
- the heterologous moiety can be, e.g., a heterologous polypeptide, a therapeutic agent (e.g., a toxin or a drug), or a detectable label such as, but not limited to, a radioactive label, an enzymatic label, a fluorescent label, a heavy metal label, a luminescent label, or an affinity tag such as biotin or streptavidin.
- Suitable heterologous polypeptides include, e.g., an antigenic tag (FLAG (DYKDDDDK (SEQ ID NO: 141)), polyhistidine (6-His; HHHHHH (SEQ ID NO: 142), hemagglutinin (HA; YPYDVPDYA (SEQ ID NO: 143)), glutathione-S-transferase (GST), or maltose-binding protein (MBP)) for use in purifying the antibodies or fragments.
- FLAG DYKDDDDK
- polyhistidine 6-His
- HHHHHHHH SEQ ID NO: 142
- hemagglutinin HA
- YPYDVPDYA SEQ ID NO: 143
- GST glutathione-S-transferase
- MBP maltose-binding protein
- Heterologous polypeptides also include polypeptides (e.g., enzymes) that are useful as diagnostic or detectable markers, for example, luciferase, a fluorescent protein (e.g., green fluorescent protein (GFP)), or chloramphenicol acetyl transferase (CAT).
- Suitable radioactive labels include, e.g., 32 P, 33 P, 14 C, 125 I, 131 I, 35 S, and 3 H.
- Suitable fluorescent labels include, without limitation, fluorescein, fluorescein isothiocyanate (FITC), green fluorescent protein (GFP), DyLightTM 488, phycoerythrin (PE), propidium iodide (PI), PerCP, PE-Alexa Fluor® 700, Cy5, allophycocyanin, and Cy7.
- Luminescent labels include, e.g., any of a variety of luminescent lanthanide (e.g., europium or terbium) chelates.
- suitable europium chelates include the europium chelate of diethylene triamine pentaacetic acid (DTP A) or tetraazacyclododecane-l,4,7,10-tetraacetic acid (DOTA).
- Enzymatic labels include, e.g., alkaline phosphatase, CAT, luciferase, and horseradish peroxidase.
- Two proteins can be cross-linked using any of a number of known chemical cross linkers.
- cross linkers are those which link two amino acid residues via a linkage that includes a "hindered" disulfide bond.
- a disulfide bond within the cross-linking unit is protected (by hindering groups on either side of the disulfide bond) from reduction by the action, for example, of reduced glutathione or the enzyme disulfide reductase.
- SMPT 4-succinimidyloxycarbonyl-a-methyl- a(2-pyridyldithio) toluene
- crosslinkers include, without limitation, reagents which link two amino groups (e.g., N-5-azido-2- nitrobenzoyloxysuccinimide), two sulfhydryl groups (e.g., 1,4-bis-maleimidobutane), an amino group and a sulfhydryl group (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester), an amino group and a carboxyl group (e.g., 4-[p-azidosalicylamido]butylamine), and an amino group and a guanidinium group that is present in the side chain of arginine (e.g., p-azidophenyl glyoxal monohydrate).
- reagents which link two amino groups e.g., N-5-azido-2- nitrobenzoyloxysuccinimide
- two sulfhydryl groups e.g.
- a radioactive label can be directly conjugated to the amino acid backbone of the antibody.
- the radioactive label can be included as part of a larger molecule (e.g., 125 I in meta-[ 125 I]iodophenyl-N-hydroxysuccinimide ([ 125 I]mIPNHS) which binds to free amino groups to form meta-iodophenyl (mIP) derivatives of relevant proteins (see, e.g., Rogers et al. (1997) J Nucl Med 28:1221-1229) or chelate (e.g., to DOTA or DTP A) which is in turn bound to the protein backbone.
- a larger molecule e.g., 125 I in meta-[ 125 I]iodophenyl-N-hydroxysuccinimide ([ 125 I]mIPNHS) which binds to free amino groups to form meta-iodophenyl (mIP) derivatives of relevant proteins (see, e.g
- fluorophore to a protein (e.g., an antibody) are known in the art of protein chemistry.
- fluorophores can be conjugated to free amino groups (e.g., of lysines) or sulfhydryl groups (e.g., cysteines) of proteins using succinimidyl (NHS) ester or tetrafluorophenyl (TFP) ester moieties attached to the fluorophores.
- the fluorophores can be conjugated to a heterobifunctional cross-linker moiety such as sulfo-SMCC.
- Suitable conjugation methods involve incubating an antibody protein, or fragment thereof, with the fluorophore under conditions that facilitate binding of the fluorophore to the protein. See, e.g., Welch and Redvanly (2003) “Handbook of Radiopharmaceuticals: Radiochemistry and Applications,” John Wiley and Sons (ISBN 0471495603).
- the antibodies or fragments can be modified, e.g., with a moiety that improves the stabilization and/or retention of the antibodies in circulation, e.g., in blood, serum, or other tissues.
- the antibody or fragment can be PEGylated as described in, e.g., Lee et al. (1999) Bioconjug Chem 10(6): 973-8; Kinstler et al. (2002) Advanced Drug Deliveries Reviews 54:477-485; and Roberts et al. (2002) Advanced Drug Delivery Reviews 54:459-476 or HESylated (Fresenius Kabi, Germany; see, e.g., Pavisic et al.
- the stabilization moiety can improve the stability, or retention of, the antibody (or fragment) by at least 1.5 (e.g., at least 2, 5, 10, 15, 20, 25, 30, 40, or 50 or more) fold.
- the antibodies or antigen-binding fragments thereof described herein can be glycosylated.
- an antibody or antigen-binding fragment thereof described herein can be subjected to enzymatic or chemical treatment, or produced from a cell, such that the antibody or fragment has reduced or absent glycosylation. Methods for producing antibodies with reduced glycosylation are known in the art and described in, e.g., U.S. patent no. 6,933,368; Wright et al. (1991) EMBO J 10(10):2717-2723; and Co et al. (1993) Mol Immunol 30:1361.
- compositions described herein can be used in a number of diagnostic and therapeutic applications.
- detectably labeled antigen-binding molecules can be used in assays to detect the presence or amount of the target antigens in a sample (e.g., a biological sample).
- the compositions can be used in in vitro assays for studying inhibition of target antigen function.
- the compositions can be used as positive controls in assays designed to identify additional novel compounds that inhibit complement activity or otherwise are useful for treating a complement-associated disorder.
- a IL-27-inhibiting composition can be used as a positive control in an assay to identify additional compounds (e.g., small molecules, aptamers, or antibodies) that reduce or abrogate IL-27 production.
- additional compounds e.g., small molecules, aptamers, or antibodies
- the compositions can also be used in therapeutic methods as elaborated on below.
- the disclosure provides a method of detecting IL-27 in a biological sample or in a subject, comprising (i) contacting the sample or the subject (and optionally, a reference sample or subject) with any antibody described herein under conditions that allow interaction of the antibody molecule and IL-27 to occur, and (ii) detecting formation of a complex between the antibody molecule and the sample or the subject (and optionally, the reference sample or subject).
- kits can include an anti-IL-27 antibody as disclosed herein, and instructions for use.
- the kits may comprise, in a suitable container, an anti-IL-27 antibody, one or more controls, and various buffers, reagents, enzymes and other standard ingredients well known in the art.
- the disclosure provides a kit comprising an anti-IL-27 antibody or antigen-binding portion as disclosed herein, and instructions for use in stimulating an immune response in a subject, or treating cancer in a subject, optionally with instructions for use in combination with one or more additional therapeutic agents or procedure as disclosed herein.
- the container can include at least one vial, well, test tube, flask, bottle, syringe, or other container means, into which an anti-IL-27 antibody may be placed, and in some instances, suitably aliquoted.
- the kit can contain additional containers into which this component may be placed.
- the kits can also include a means for containing an anti-IL-27 antibody and any other reagent containers in close confinement for commercial sale.
- Such containers may include injection or blow-molded plastic containers into which the desired vials are retained.
- Containers and/or kits can include labeling with instructions for use and/or warnings.
- a number of sub-selections of anti-IL-27 antibodies of the instant disclosure share sequence homology across their CDR regions, providing a diversity of variant CDR sequences that have been validated as retaining functionality. It is expressly contemplated herein that the following consensus CDR sequences are fully supported by - and are therefore within the scope of - the instant disclosure.
- anti-IL-27 Abl anti-IL-27 Ab3, anti-IL-27 Ab4, anti-IL-27 Ab5, anti-IL-27
- a consensus heavy chain CDR1 (IMGT) sequence for these homologous antibodies is therefore N-GFTF[S/A/R][S/R][T/Y][G/S]-C (SEQ ID NO: 144) and, accordingly, more generally contemplated herein as a consensus heavy chain CDR1 (IMGT) sequence is N- GFTFXXXX-C (SEQ ID NO: 145), where X is any amino acid residue.
- a consensus heavy chain CDR2 (IMGT) sequence for these homologous antibodies is therefore N-ISSS[S/G][S/A]YI-C (SEQ ID NO: 146) and, accordingly, more generally contemplated herein as a consensus heavy chain CDR2 (IMGT) sequence is N-ISSSXXYI-C (SEQ ID NO: 147), where X is any amino acid residue.
- FTFRSYGMN 9 (SSQ ID NO: 34) 16 FTFRSYGMN 9 (SSQ ID NO: 122)
- Consensus heavy chain CDR1 (NT) and CDR2 (NT) sequences for these homologous antibodies are therefore N-FTF[S/A/R][S/R][T/Y][G/S]MN-C (SEQ ID NO: 148) and N-[G/S]ISSS[S/G][S/A]YI[L/Y]YADSVKG-C (SEQ ID NO: 149), respectively.
- consensus heavy chain CDR1 (NT) and CDR2 (NT) sequences N-FTFXXXXMN-C (SEQ ID NO: 150) and N- XISSSXXYIXYADSVKG-C (SEQ ID NO: 151), respectively, where X is any amino acid residue.
- IMGT or NT Heavy chain CDR3
- IMGT or NT light chain CDRs CDR1
- CDR2 (IMGT or NT) and CDR3 (IMGT or NT) were fully conserved between anti-IL-27 Abl, anti-IL-27 Ab3, anti-IL-27 Ab4, anti-IL-27 Ab5, anti-IL-27 Ab6, and anti-IL-27 Ab7.
- Part A consists of the anti-IL-27 monotherapy dose- escalation portion of the study and will enroll approximately 42 patients with advanced solid tumors. This dose escalation part will employ an Accelerated Phase (single patient) for Dose Levels 1-3, followed by a Standard Phase (3+3) for Dose Levels 4-8.
- Part B will enroll patients with advanced or metastatic ccRCC (any clear cell component in the histologic definition) or HCC into indication-specific monotherapy expansion cohorts, to further examine the safety, efficacy, tolerability, PK, and pharmacodynamics of the anti-IL-27 antibody as a monotherapy using a 2-stage design.
- Stage 1 of each expansion cohort will enroll approximately 17 patients. If ⁇ 1 of the 17 patients in Stage 1 has a confirmed radiographic response (complete response [CR] or partial response [PR]), then approximately 23 additional patients will be enrolled in Stage 2.
- Approximately 12 patients (out of approximately 40 patients) in each of the indication-specific cohorts will be required to have a soft tissue metastasis or primary tumor that is accessible for biopsy.
- the total number of patients enrolled in Part B will be approximately 80 (approximately 40 in each expansion cohort).
- the starting dose of the anti-IL-27 antibody monotherapy will be 0.003 mg/kg given
- Table 2 Proposed dose levels for monotherapy dose escalation.
- Escalation of dose levels may continue after completion of Dose Level 8 at the recommendation of the Safety Review Committee (SRC) at no more than 50% dose increases.
- SRC Safety Review Committee
- Monotherapy dose escalation will begin with an Accelerated Phase, whereby 1 patient each will be enrolled in Dose Levels 1-3 and DLTs and AEs will be monitored during the first cycle of study treatment (a cycle is defined as 4 weeks [28 days] from Day 1).
- a cycle is defined as 4 weeks [28 days] from Day 1).
- dose escalation would have converted to Standard Phase at that dose level.
- any dose level in the Accelerated Phase been converted to the Standard Phase, all subsequent dose levels would have been evaluated in Standard Phase for the remainder of dose escalation.
- no DLTs were observed at Dose Levels 1-3, no conversion from Acclerated Phase to Standard Phase was required.
- ⁇ 2 DLTs occur at Dose Level 1 (0.003 mg/kg)
- a Dose Level -1 may be considered.
- dose escalation will transition to a traditional 3+3 design at Dose Level 4 (0.3 mg/kg), whereby 3 patients will be treated at a dose level and monitored for DLTs during the first cycle of study drug. If a DLT occurs in the first 3 patients, an additional 3 patients will be treated at that same dose level. If no DLTs occur in these additional 3 patients (ie, ⁇ 2 DLTs per 6 patients), dose escalation may proceed to the next dose level.
- a RP2D will be determined by the SRC for the anti-IL-27 antibody monotherapy.
- the RP2D will be based upon cumulative safety, PK, and pharmacodynamic data. If 2 or more patients at a dose level experience a DLT (out of 6 in total enrolled), this dose level is above the RP2D.
- the SRC may recommend investigating intermediate doses or alternative schedules to optimize RP2D determination.
- the anti-IL-27 antibody will be administered as monotherapy in a q4 week schedule; 1 cycle of treatment will include 1 dose of the anti-IL-27 antibody.
- the SRC will monitor the safety, PK, and pharmacodynamics of the anti-IL-27 antibody during the study, and may recommend altering the dosing paradigm (e.g., dose level and/or schedule).
- patients may have their dose escalated to a higher dose or change to a different dosing schedule if they have received their current dose level for at least 3 cycles, if no toxicities > Grade 1 on their current dose level are reported, and if they have not had a dose reduction. If any treatment-related ⁇ Grade 3 toxicity occurs at any level, no intrapatient dose escalation will be allowed at that level for any patient. Patients may only have their dose escalated or moved to an alternative dosing schedule at a dose level that has already been evaluated and is at or below the RP2D for the anti-IL-27 antibody monotherapy. There is no limit to how many dose levels a patient can be escalated (if below RP2D) as long as they meet the above criteria. Toxicities that occur during the first cycle of a higher dose for such a patient would not be considered DLTs.
- Dose-limiting toxicities will be evaluated during the first treatment cycle (28 days) using NCI-CTCAE version 5.0 or higher and defined for Part A and Part C of the study. Patients must have received at least 50% of the prescribed dose of the anti-IL-27 antibody and have not discontinued study therapy in the first 28 days (Cycle 1) for reasons other than drug-related adverse events to be evaluable for DLTs. Patients unevaluable for DLTs will be replaced.
- Toxicities (regardless of Grade) considered clearly related to disease progression, intercurrent illness, or concomitant medications are not considered DLTs.
- the Part B monotherapy expansion cohorts will evaluate the safety, efficacy, tolerability, PK, and pharmacodynamics of the anti-IL-27 antibody monotherapy at the RP2D in patients with ccRCC (any clear cell component in the histologic definition), HCC and non-small cell lung cancer (NSCLC) in indication-specific cohorts using a 2-stage design.
- Stage 1 of each expansion cohort will enroll approximately 17 patients. If ⁇ 1 of the 17 patients in Stage 1 has a confirmed radiographic response (CR or PR), then approximately 23 additional patients will be enrolled in Stage 2.
- Approximately 12 patients (out of approximately 40 patients) in each of the indication-specific cohorts will be required to have a soft tissue metastasis or primary tumor that is accessible for biopsy.
- the total number of patients enrolled in Part B will be approximately 120 (approximately 40 in each expansion cohort).
- HCC in Part B must have at least 1 measurable target lesion according to modified RECIST (mRECIST) meeting the following criteria.
- Lesion(s) should be suitable for repeat measurement.
- Hepatic target lesion(s) should be at least ⁇ 1.0 cm (for typical, ie, arterial enhancing lesions, this should be of the viable tumor, whereas for atypical lesions, the longest diameter should be used).
- Nonhepatic target lesion(s) can include the following:
- LN Lymph node
- VEGF-targeted agent for toxicity or intolerability.
- patients in Part B with HCC demonstrated PD during or after the most recent treatment regimen.
- Prior treatment history must include progression during or after treatment with a VEGF-targeted agent.
- Patients who did not progress on but discontinued the VEGF-targeted agent for toxicity or intolerability are permitted.
- For Part B patients in the tumor biopsy subsets only must have tumor tissue that is accessible for pretreatment and on-treatment tumor biopsy in the opinion of the Investigator and be willing to undergo pretreatment and on-treatment biopsies per protocol. Washout period from the last dose of previous anticancer therapy (chemotherapy, biologic, or other investigational agent) to the initiation of study drug must be > 5 times the half-life of the agent or > 21 days (whichever is shorter).
- the washout period for palliative radiotherapy to non-central nervous system disease is 7 days. Resolution of non-immune related AEs secondary to prior anticancer therapy (excluding alopecia and peripheral neuropathy) to ⁇ Grade 1 per NCI-CTCAE version 5.0 or higher, and complete resolution of immune-related AEs secondary to prior checkpoint inhibitor therapy.
- Adequate hematologic function defined as absolute neutrophil count (ANC) ⁇ 1.0 x 10 9 L, hemoglobin ⁇ 9.0 g/dL, and platelet count ⁇ 100 x 10 9 L.
- ANC absolute neutrophil count
- platelet count ⁇ 75 x 10 9 L without transfusion.
- ECG Eastern Cooperative Oncology Group
- Ejection fraction ⁇ 50% as measured by echocardiogram or multigated acquisition scan at Screening.
- WCBP childbearing potential
- Patients are to be excluded from the study if they meet any of the following criteria: Previously received an anti-IL-27 antibody or anti-IL-27 targeted therapy. For patients in Part B with renal cell carcinoma (RCC), non-clear cell RCC histology. For patients in Part B, received > 4 prior systemic regimens for Stage IV disease. For patients with HCC, known fibrolamellar or mixed hepatocellular cholangiocarcinoma. For patients with HCC, moderate or severe ascites. Receiving chronic anti-coagulation therapy (eg, warfarin, enoxaparin) that cannot be safely discontinued temporarily for the required biopsies (only if in the applicable tumor biopsy subset).
- chronic anti-coagulation therapy eg, warfarin, enoxaparin
- HBV DNA 500 IU/mL during the Screening Period with willingness to continue antiviral treatment during length of study.
- the patient must be on anti-HBV treatment (per local standard of care; eg, entecavir) for a minimum of 14 days prior to study entry.
- Co-infection is defined as HCV RNA positive and hepatitis B surface antigen (HBsAg) positive.
- HBsAg hepatitis B surface antigen
- HBcAb hepatitis B core antibody
- thyroxine e.g. thyroxine, physiologic corticosteroids [ ⁇ 10 mg/day of prednisone or its equivalent], or insulin
- thyroxine e.g. thyroxine, physiologic corticosteroids [ ⁇ 10 mg/day of prednisone or its equivalent], or insulin
- thyroxine e.g. thyroxine, physiologic corticosteroids [ ⁇ 10 mg/day of prednisone or its equivalent], or insulin
- patients with a history of autoimmune disease may be eligible following discussion with the Medical Monitor.
- Another malignancy other than those with negligible risk of death, including but not limited to non-melanoma skin cancer, low risk localized or cured prostate cancer, ductal carcinoma in situ, or carcinoma in situ of the cervix, within 2 years before Screening.
- Unstable or severe uncontrolled medical condition eg, unstable cardiac function, unstable pulmonary condition including pneumonitis and/or interstitial lung disease, uncontrolled diabetes, symptomatic fistula
- any important medical illness or abnormal laboratory finding that would, in the Investigator’s judgment, increase the risk to the patient associated with his or her participation in the study.
- Samples will be collected for biomarker analysis to investigate the biological effects of anti-IL-27 at the molecular and cellular level, as well as to evaluate how changes in the markers and immune cell populations may relate to exposure and clinical outcomes.
- the goal of the biomarker assessments is to provide supportive data for the clinical trial. There may be circumstances when a decision is made to stop a collection, not perform, or discontinue an analysis due to either practical or strategic reasons (eg, inadequate sample number, sample quality issues precluding analysis, etc). Therefore, sample collection and/or analysis may be omitted at the discretion of the Sponsor.
- Additional biomarker samples may be requested (when feasible) at the time of any unusual safety event (ie, an AE different in type and severity from that which is expected in the setting of anti-IL-27 use), or if a sample is found to be compromised.
- any unusual safety event ie, an AE different in type and severity from that which is expected in the setting of anti-IL-27 use
- biomarker samples may be analyzed: blood (whole blood and
- PBMCs for immunophenotyping and immune monitoring (to monitor the effects of treatment on various peripheral blood immune cell populations; subsets may include, but are not limited to, monocytes, neutrophils, myeloid-derived suppressor cells, and T/NK/myeloid-cell populations); blood serum for cytokine/chemokine/soluble factors (for profiling of potential predictive and pharmacodynamic biomarkers of response and/or resistance to anti-IL-27; serum levels of soluble factors associated with cancer and immunological function will be assessed. Examples include but are not limited to: EBI3, IL-27, TNF ⁇ , MIP-l ⁇ (CCL3), IFN ⁇ , IL-10, and IL-6.
- the primary end points were rate of dose limiting toxi cities (DLTs), safety, and tolerability with overarching objective of RP2D determination.
- Key secondary end points included objective response rate (ORR) based on investigator review per RECIST vl.l and iRECIST (if HCC, by mRECIST), pharmacokinetics, pharmacodynamic assessments (phosphorylated signal transducer and activator of transcription- 1 (pSTATl) levels in immune cell subsets), and serum concentrations of EBI3. Exploratory analyses planned to identity potential biomarkers of response and resistance.
- the safety analysis set included all patients who received any amount of study medication.
- the response evaluable analysis set included all patients with measurable disease at baseline who received at least one dose of anti-IL- 27 Ab 1 and had one post-baseline response assessment or who discontinued study treatment within 6 weeks ( ⁇ 2 weeks) of first dose.
- For the primary pharmacodynamic marker fresh whole blood samples were analyzed by flow cytometry to monitor inhibition of pSTATl.
- Mean time on study is 8 weeks (range 1-50), as measured by the days from the first dose to the last visit, including safety follow-up visits (FIG. 2).
- Five patients were escalated to higher doses on study, as depicted by changing of the lane color at the time of dose increase.
- Disease assessment was performed at week 8 and then every 12 weeks thereafter.
- approximately 40% experienced clinical benefit in the form of disease stabilization or partial response with 50% of disease stabilization persisting beyond 16 weeks.
- One patient (6%) exhibited a partial response
- 7 patients (39%) exhibited stable disease
- 10 patients (55%) exhibited progressive disease, as measured by RECISTvl.l (FIG. 3).
- One patient with RCC who received prior anti -PD- 1 has prolonged stable disease for > 9 months.
- one patient with NSCLC treated at 10 mg/kg experienced a rapid partial response evident at the first response assessment at 8 weeks, which was confirmed at 12 weeks.
- One particular patient is a 64-year-old man with squamous cell NSCLC with metastases to the mediastinal nodes, lung, pleura and adrenal gland, who is receiving anti-IL-27 antibody Abl at 10 mg/kg intravenously once every four weeks.
- the patient was previously treated with adjuvant gemcitabine/cisplatin, first line carboplatin/nab-paclitaxel/pembrolizumab (with a PD-L1 expression 10%), and second line docetaxel, with no response to any therapy and progressively symptomatic prior to anti-IL-27 antibody Abl initiation.
- Anti-IL-27 Ab 1 is well -tolerated at all tested doses to date in patients with advanced solid tumors.
- Preliminary results of IL-27 pathway blockade with a first-in-class therapeutic study of anti-IL-27 Abl shows evidence of single-agent activity even in heavily pre-treated patients, including a confirmed partial response in a patient with squamous cell NSCLC whose disease was resistant to three prior regimens including chemotherapy and PD-1 blockade, and multiple patients have experienced disease stabilization.
- PK are linear and dose-proportional with maximal target inhibition of downstream IL-27-mediated pSTATl maintained throughout the dosing interval.
- Mean time on study for Part A is 9 weeks (range 1-71), as measured by the days from the first dose to the last visit, including safety follow-up visits (FIG. 7).
- Six patients were escalated to higher doses on study, as depicted by changing of the lane color at the time of dose increase.
- Disease assessment was performed at week 8 and then every 12 weeks thereafter.
- approximately 40% experienced clinical benefit in the form of disease stabilization or partial response with 28% of disease stabilization persisting beyond 16 weeks.
- One patient (3.7%) exhibited a confirmed partial response, 10 patients (37%) exhibited stable disease, and 16 patients (59%) exhibited progressive disease, as measured by RECISTvl.l (FIGs. 8A-8B).
- ADA low-titer anti-drug antibodies
- Anti-IL-27 Abl is detected by anti-human IgGl antibody conjugated to horseradish peroxidase (HRP) (Southern Biotech, Lot# G4015- Q168B). KPL SureBlueTM peroxidase is used as a substrate for HRP. The reaction is stopped by IN Hydrochloric acid. The color intensity is proportional to the quantity of anti-IL-27 Abl.
- HRP horseradish peroxidase
- a 10 ⁇ g vial of recombinant human IL-27 (R&D Systems# 2526-IL) was reconstituted to 100 ⁇ g/mL by adding 100 ⁇ L PBS + 0.1 % BSA (made from 10% BSA Sigma #A1595).
- a working stock of the recombinant hIL-27 (rhIL-27) was prepared by dilution to 2 ⁇ g/mL in endotoxin free PBS. After the 30-minute incubation, 50 ⁇ L of 2 ⁇ g/mL rhIL-27 was added to anti-IL-27 antibody-spiked and stimulated tubes. 50 ⁇ L PBS was added to unstimulated tube. The tubes were mixed and incubated for 30 minutes at 37°C.
- Lyse/Fix reagent (BD #558049) was diluted 1:5 in sterile water (Hyclone #SH3052902) and warmed to 37°C in a water bath. 5 mL diluted Lyse/Fix reagent was added to each tube and the tubes were mixed well by inversion. The tubes were incubated for 15 min at 37°C. After the 15-minute incubation, the tubes were centrifuged for 5 minutes at 1500 RPM at room temperature and supernatant was discarded by decanting. 5 mL of endotoxin-free PBS was added per tube and samples were mixed by pipetting up and down. The tubes were centrifuged for 5 minutes at 1500 RPM at room temperature and supernatant was discarded by careful aspiration.
- CD4 + T cells, human PBMCs, and the IL-27RA-expressing lung cancer cell line NCI-H2228 by microarray or single cell RNA-sequencing.
- the resulting IL-27 signature genes were interrogated by gene enrichment analysis, including single cell RNA-seq analysis of the tumor microenvironment, from patients with NSCLC.
- IL-27 induced a robust gene expression program in human immune cells that included several inhibitory receptors and canonical interferon regulated genes such as guanylate- binding proteins (GBPs) and interferon regulatory factors (IRFs).
- GBPs guanylate- binding proteins
- IRFs interferon regulatory factors
- GSEA Gene set enrichment analysis
- interferon signature analysis showed a striking overlap with those genes regulated by interferon-beta, a cytokine known to drive immune suppression associated with chronic viral infection that is used therapeutically for controlling inflammation associated with the autoimmune disease multiple sclerosis.
- interferon regulated pathways have recently emerged as a mechanism of resistance to immune checkpoint blockade in cancer. Exploration of the IL-27 gene signature in published datasets showed enrichment in macrophage populations associated with progressive disease in patients with NSCLC.
- IL-27RA is also expressed on tumor cells from NSCLC patients with progressive disease as well as lung cancer cell lines in which IL-27 can upregulate PD-L1, IDOl and other canonical interferon regulated genes.
- Blood serum samples were collected from patients enrolled on the anti-IL-27 Abl clinical trial (see Example 2) at the following scheduled visits and timepoints: C1D1 pre-dose and 6 hours post-dose; C1D8; C2D1 pre-dose and 6 hours post-dose; and pre-dose for C3D1 and every subsequent treatment cycle.
- Serum protein expression was measured based on electrochemiluminescence (ECL) detection assays using commercially available multiplex chemokine and cytokine kits from Meso Scale Diagnostics (MSD; Rockville, MD, USA) across the following 4 panels: V-PLEX Plus Chemokine Panel 1 (human) Kit, V-PLEX Plus Proinflammatory Panel 1 (human Kit), V-PLEX Plus Cytokine Panel 1 (human) Kit, and V-PLEX PLUS TH17 Panel 1 (human) Kit.
- ECL electrochemiluminescence
- Circulating levels of IL-27 relative to fold-change over baseline levels were examined in patients from each SRF388 monotherapy dose cohort (0.003 mg/kg, 0.03 mg/kg, 0.1 mg/kg, 0.3 mg/kg, 1.0 mg/kg, 3 mg/kg, 10 mg/kg, and 20 mg/kg).
- IL-27 fold-change over baseline levels trend upward for most patients but does not appear to be a dose- dependent phenomon (FIG. 15).
- IL-27 is a heterodimeric immunoregulatory cytokine that consists of 2 subunits: p28 and Epstein-Barr virus-induced gene 3 (EBI3). IL-27 signals through a heterodimeric receptor composed of glycoprotein 130 (gpl30) and the IL-27 receptor subunit alpha, IL-27RA (WSX-1), which activates the JAK-STAT pathway to limit the duration and intensity of T cell-mediated immunity. IL-27 signaling through the JAK-STAT pathway results in altered immunoregulatory receptor expression and decreased proinflammatory cytokine secretion. The present example characterizes the immunoregulatory impact of IL-27 signaling by gene expression profiling.
- PBMCs were isolated from healthy donors and stimulated in vitro for 3 days with anti-CD3 antibody (0.25 ⁇ g/mL, clone UCHT1) in the presence or absence of recombinant human IL-27 (100 ng/ml), recombinant human EBI3 (100 ng/ml), or recombinant human IL-25 (100 ng/ml) in 96-well plates.
- CD4 + CD8 T cells were isolated by fluorescence activated cell sorting followed by RNA purification and processing for hybridization to HuGene LOST arrays.
- GSEA gene set enrichment analysis
- CD4+ T cells were isolated from activated PBMC cultures after treatment with rhIL-27, rhEBI3, or rhIL-35 cytokines at 100 ng/ml.
- the IL-27 heterodimer (FIG. 20 A), but neither EBI3 alone (FIG. 20B) nor IL-35 (FIG. 20C), elicits robust gene expression changes in human CD4+ T cells from PBMCs.
- Table 8 Enrichment of interferon-regulated genes.
- RNA-sequencing analysis of human PBMCs identifies several immune cell populations exhibiting upregulation of interferon-stimulated genes (ISGs) after IL-27 stimulation (FIG. 22A).
- PBMCs were isolated from healthy donors then pooled and stimulated in vitro for 16 hours with anti-CD3 antibody (0.25 ⁇ g/mL, clone UCHT1) in the presence or absence of recombinant human IL-27 (100 ng/ml).
- Cells were then processed (lOx Genomics), RNA was sequenced (Illumina, San Diego, CA), data was processed (Seurat), and subsequently visualized and analyzed (BBrowser, BioTuring, San Diego, CA).
- IL-27 Differential gene expression was determined using the Venice algorithm within the differential expression module.
- Gene expression changes by IL-27 were determined in total PBMCs and also in defined cell subsets including NK cells, CD4+ T cells, B cells, monocytes, CD8+ T cells, and Treg cells.
- IL-27-mediated gene expression changes were identified in the total PBMC population and included many interferon- stimulated genes (FIG. 22B). Further, IL-27 upregulates ISGs in NK cells (FIG. 22C), monocytes (FIG. 22F), CD4+ T cells (FIG. 22D), CD8+ T cells (FIG. 22G), B cells (FIG. 22E), and Treg cells (FIG. 22H).
- Interferon gene expression signatures from PBMCs stimulated with IFNa2, IFNbl, and IFNg were used to compare to the IL-27 gene signature identified from the scRNA-seq PBMC data set described in example 2.
- the IL-27 signature is enriched for IFNb stimulated genes.
- Values in Tables 9A-9F represent the differential gene expression from total PBMCs in IL-27 stimulated vs control conditions.
- Table 9A Common IFN ⁇ 2, INF ⁇ 1, and IFN ⁇ Genes
- PBMCs from healthy donors were stimulated in vitro with anti-CD3 antibody (0.25 ⁇ g/mL) for 4 days in the absence (control) or presence of anti-PD-1 antibody (Pembrolizumab, 1 ⁇ g/mL) and various cytokines. Supernatants were then collected and tested for the presence of IL- 17A (FIG. 23 A) or IFN-g (FIG. 23B) by MSD. Both IL-27 and IFNb inhibited cytokine production after anti -PD- 1 blockade.
- NSCLC patients with progressive disease show an enrichment of a macrophage population that expresses several ISGs and IL-27.
- Graphical abstract from Maynard et al. (NCBI BioProject #PRJNA591860, which is incorporated by reference herein in its entirety) highlights the macrophage population (MF2) with high expression of IDOl and GBP5 shows increased prevalence in patients with progressive disease (PD) compared to those with residual disease (RD) and treatment naive (TN) patients.
- PD progressive disease
- RD residual disease
- TN treatment naive
- MF2 signature Several genes from the MF2 signature (green highlights, Maynard et al. Table S4) are enriched in IL-27 positive macrophages compared to IL-27 negative macrophages. Macrophages from patients with progressive disease have more IL-27 transcript expression compared to those with RD or TN patients. IL-27 transcript is increased in macrophages from primary tumor and metastatic sites compared to macrophages from normal lung tissue. IL-27 transcript in macrophages is increased in patients with stage IV disease. The MF2 signature was also highlighted on an independent gene expression profile (Swaminathan et al 2013, GSE44955) comparing IL-27 cultured macrophages vs control condition. This data shows that most MF2 signature genes can be upregulated in macrophages by IL-27.
- NSCLC tumor microenvironment TME
- MF2 macrophage subpopulation
- FIG. 24A NSCLC tumor microenvironment
- MF2 signature is highly enriched in IL27 + macrophages as compared to IL27 macrophages (FIG. 24B).
- IL-27 is increased in macrophages from patients with progressive disease (FIG. 24C); in macrophages from metastatic and primary tumors compared to normal tissue (FIG. 24D); and in macrophages from patients with Stage IV disease (FIG. 24D).
- the MF2 siganture is upregulated in macrophages by IL27 (FIG. 24F, gray data points).
- IL-27-positive macrophages were detected in the tumor microenvironment (TME) of lung adenocarcinoma (FIG. 24G; AdenoCa) and lung squamous cell carcinoma (FIG. 24H; SCC) by immunohistochemistry (IHC).
- IHC on formalin-fixed, paraffin-embedded (FFPE) tissue samples of NSCLC was performed by staining tissue microarrays (TMAs) from US Biomax (Derwood, MD) with an affinity purified goat polyclonal antibody against recombinant human IL- 27 (p28 and EBI3) from R&D Systems at 10 microg/mL.
- BioProject #PRJNA591860 shows expression in several cell types in the NSCLC tumor microenvironment including some tumor cells (FIG. 25A). IL27RA expression was observed across various cell types within the NSCLC tumor microenvironment, including higher expression in dendritic cells, T cells, and tumor cells (FIG. 25B). For tumor tissue, the expression of IL27RA was higher in patients with progressive disease compared to those with residual disease or patients that are treatment naive (FIG. 25C).
- NCI-H2228 (FIG. 26A). Culturing NCI-H2228 cells in vitro with various concentrations of recombinant human IL-27 leads to the dose dependent increase in STAT1 phosphorylation (downstream of IL-27RA signaling) and PD-L1 expression by flow cytometry (FIGs. 26B-26C). NCI-H2228 cells were also cultured in vitro in the presence or absence of recombinant human IL-27 (100 ng/ml) for 48hrs followed by RNA purification and processing for hybridization to HuGene LOST arrays. Raw microarray data were normalized and differential gene expression was determined by comparing IL-27 treatment (y-axis) to control conditions (x-axis) (FIG. 26D). IL-27 upregulated several ISGs including IDOl and GBP5.
- PD-1 blockade Interferon-regulated pathways have recently emerged as a mechanism of resistance to immune checkpoint blockade in cancer. Exploration of the IL-27 gene signature in published datasets showed enrichment in macrophage populations associated with progressive disease in patients with NSCLC. While many of the properties of IL-27-mediated immune regulation have focused on hematopoietic cells, there is demonstrated IL-27RA expression on tumor cells from NSCLC patients with progressive disease. IL-27RA is also expressed on lung cancer cell lines in which IL-27 can upregulate PD-L1, IDOl, and other canonical interferon-regulated genes. [0435] These studies elucidate the transcriptional networks that are engaged after IL-27 signaling in immune and cancer cells and highlight the parallels with interferon-associated immune regulation.
Landscapes
- Chemical & Material Sciences (AREA)
- Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Immunology (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020237041204A KR20240005809A (ko) | 2021-05-07 | 2022-05-06 | 항-il-27 항체 및 이의 용도 |
| AU2022270170A AU2022270170A1 (en) | 2021-05-07 | 2022-05-06 | Anti-il-27 antibodies and uses thereof |
| JP2023564682A JP2024516970A (ja) | 2021-05-07 | 2022-05-06 | 抗il-27抗体及びその使用 |
| CA3215856A CA3215856A1 (en) | 2021-05-07 | 2022-05-06 | Anti-il-27 antibodies and uses thereof |
| IL308198A IL308198A (en) | 2021-05-07 | 2022-05-06 | Anti-IL-27 antibodies and uses thereof |
| MX2023013149A MX2023013149A (es) | 2021-05-07 | 2022-05-06 | Anticuerpos anti-il-27 y usos de estos. |
| EP22727555.9A EP4334348A1 (en) | 2021-05-07 | 2022-05-06 | Anti-il-27 antibodies and uses thereof |
| CN202280030336.5A CN118076635A (zh) | 2021-05-07 | 2022-05-06 | 抗il-27抗体和其用途 |
| JOJO/P/2023/0282A JOP20230282A1 (ar) | 2021-05-07 | 2023-11-05 | أجسام مضادة لـ il-27 واستخداماتها |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163185989P | 2021-05-07 | 2021-05-07 | |
| US63/185,989 | 2021-05-07 | ||
| US202163203688P | 2021-07-28 | 2021-07-28 | |
| US63/203,688 | 2021-07-28 | ||
| US202163277035P | 2021-11-08 | 2021-11-08 | |
| US63/277,035 | 2021-11-08 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022236134A1 true WO2022236134A1 (en) | 2022-11-10 |
Family
ID=81928149
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/028189 Ceased WO2022236134A1 (en) | 2021-05-07 | 2022-05-06 | Anti-il-27 antibodies and uses thereof |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US12577299B2 (https=) |
| EP (1) | EP4334348A1 (https=) |
| JP (1) | JP2024516970A (https=) |
| KR (1) | KR20240005809A (https=) |
| AU (1) | AU2022270170A1 (https=) |
| CA (1) | CA3215856A1 (https=) |
| IL (1) | IL308198A (https=) |
| JO (1) | JOP20230282A1 (https=) |
| MX (1) | MX2023013149A (https=) |
| TW (1) | TW202304981A (https=) |
| WO (1) | WO2022236134A1 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024110405A1 (en) * | 2022-11-22 | 2024-05-30 | Institut National de la Santé et de la Recherche Médicale | Use of il-27 antagonists for the treatment of ebv-driven b lymphoproliferative diseases |
Citations (57)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3710795A (en) | 1970-09-29 | 1973-01-16 | Alza Corp | Drug-delivery device with stretched, rate-controlling membrane |
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4863457A (en) | 1986-11-24 | 1989-09-05 | Lee David A | Drug delivery device |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| EP0430539A2 (en) | 1989-11-22 | 1991-06-05 | Visionex, Inc. | Ocular implants |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| EP0488401A1 (en) | 1990-11-30 | 1992-06-03 | Senju Pharmaceutical Co., Ltd. | A controlled-release pharmaceutical preparation for intra-ocular implant |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| WO1994025591A1 (en) | 1993-04-29 | 1994-11-10 | Unilever N.V. | PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE) |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| WO1996027011A1 (en) | 1995-03-01 | 1996-09-06 | Genentech, Inc. | A method for making heteromultimeric polypeptides |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US6001329A (en) | 1996-05-06 | 1999-12-14 | Uab Research Foundation | Radiolabeled fusion toxins for cancer therapy |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6300064B1 (en) | 1995-08-18 | 2001-10-09 | Morphosys Ag | Protein/(poly)peptide libraries |
| EP1537878A1 (en) | 2002-07-03 | 2005-06-08 | Ono Pharmaceutical Co., Ltd. | Immunopotentiating compositions |
| US6933368B2 (en) | 1992-03-09 | 2005-08-23 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation of immunoglobulin variable region |
| US6995259B1 (en) | 1998-10-23 | 2006-02-07 | Sirna Therapeutics, Inc. | Method for the chemical synthesis of oligonucleotides |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| WO2008024188A2 (en) | 2006-08-18 | 2008-02-28 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| US20080241223A1 (en) | 2004-04-30 | 2008-10-02 | Allergan, Inc. | Extended release biodegradable ocular implants |
| EP2161336A1 (en) | 2005-05-09 | 2010-03-10 | ONO Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| EP2170959A1 (en) | 2007-06-18 | 2010-04-07 | N.V. Organon | Antibodies to human programmed death receptor pd-1 |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| US20120183548A1 (en) * | 2011-01-14 | 2012-07-19 | Five Prime Therapeutics, Inc. | IL-27 Antagonists for Treating Inflammatory Diseases |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013173223A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| WO2015103072A1 (en) | 2013-12-30 | 2015-07-09 | Epimab Biotherapeutics | Fabs-in-tandem immunoglobulin and uses thereof |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
| WO2016106159A1 (en) | 2014-12-22 | 2016-06-30 | Enumeral Biomedical Holding, Inc. | Anti-pd-1 antibodies |
| US20190031766A1 (en) | 2017-06-22 | 2019-01-31 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
| WO2019178269A2 (en) | 2018-03-14 | 2019-09-19 | Surface Oncology, Inc. | Antibodies that bind cd39 and uses thereof |
| WO2021062244A1 (en) * | 2019-09-25 | 2021-04-01 | Surface Oncology, Inc. | Anti-il-27 antibodies and uses thereof |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6565841B1 (en) | 1991-03-15 | 2003-05-20 | Amgen, Inc. | Pulmonary administration of granulocyte colony stimulating factor |
| US5470582A (en) | 1992-02-07 | 1995-11-28 | Syntex (U.S.A.) Inc. | Controlled delivery of pharmaceuticals from preformed porous polymeric microparticles |
| EP2648752B1 (en) * | 2010-12-06 | 2017-02-15 | Seattle Genetics, Inc. | Humanized antibodies to liv-1 and use of same to treat cancer |
| CN112512571B (zh) * | 2018-03-22 | 2025-02-07 | 表面肿瘤学有限责任公司 | 抗il-27抗体及其用途 |
-
2022
- 2022-05-06 WO PCT/US2022/028189 patent/WO2022236134A1/en not_active Ceased
- 2022-05-06 IL IL308198A patent/IL308198A/en unknown
- 2022-05-06 US US17/738,927 patent/US12577299B2/en active Active
- 2022-05-06 MX MX2023013149A patent/MX2023013149A/es unknown
- 2022-05-06 CA CA3215856A patent/CA3215856A1/en active Pending
- 2022-05-06 KR KR1020237041204A patent/KR20240005809A/ko active Pending
- 2022-05-06 JP JP2023564682A patent/JP2024516970A/ja active Pending
- 2022-05-06 EP EP22727555.9A patent/EP4334348A1/en active Pending
- 2022-05-06 AU AU2022270170A patent/AU2022270170A1/en active Pending
- 2022-05-09 TW TW111117374A patent/TW202304981A/zh unknown
-
2023
- 2023-11-05 JO JOJO/P/2023/0282A patent/JOP20230282A1/ar unknown
Patent Citations (73)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3710795A (en) | 1970-09-29 | 1973-01-16 | Alza Corp | Drug-delivery device with stretched, rate-controlling membrane |
| EP0036676A1 (en) | 1978-03-24 | 1981-09-30 | The Regents Of The University Of California | Method of making uniformly sized liposomes and liposomes so made |
| EP0058481A1 (en) | 1981-02-16 | 1982-08-25 | Zeneca Limited | Continuous release pharmaceutical compositions |
| EP0088046A2 (de) | 1982-02-17 | 1983-09-07 | Ciba-Geigy Ag | Lipide in wässriger Phase |
| EP0133988A2 (de) | 1983-08-02 | 1985-03-13 | Hoechst Aktiengesellschaft | Regulatorische Peptide enthaltende pharmazeutische Präparate mit protrahierter Freisetzung und Verfahren zu deren Herstellung |
| EP0143949A1 (en) | 1983-11-01 | 1985-06-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4863457A (en) | 1986-11-24 | 1989-09-05 | Lee David A | Drug delivery device |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO1990002809A1 (en) | 1988-09-02 | 1990-03-22 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| US5571698A (en) | 1988-09-02 | 1996-11-05 | Protein Engineering Corporation | Directed evolution of novel binding proteins |
| US5403484A (en) | 1988-09-02 | 1995-04-04 | Protein Engineering Corporation | Viruses expressing chimeric binding proteins |
| EP0430539A2 (en) | 1989-11-22 | 1991-06-05 | Visionex, Inc. | Ocular implants |
| WO1991010737A1 (en) | 1990-01-11 | 1991-07-25 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| US5780225A (en) | 1990-01-12 | 1998-07-14 | Stratagene | Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules |
| US5427908A (en) | 1990-05-01 | 1995-06-27 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5698426A (en) | 1990-09-28 | 1997-12-16 | Ixsys, Incorporated | Surface expression libraries of heteromeric receptors |
| US5501856A (en) | 1990-11-30 | 1996-03-26 | Senju Pharmaceutical Co., Ltd. | Controlled-release pharmaceutical preparation for intra-ocular implant |
| EP0488401A1 (en) | 1990-11-30 | 1992-06-03 | Senju Pharmaceutical Co., Ltd. | A controlled-release pharmaceutical preparation for intra-ocular implant |
| US5821047A (en) | 1990-12-03 | 1998-10-13 | Genentech, Inc. | Monovalent phage display |
| WO1992018619A1 (en) | 1991-04-10 | 1992-10-29 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| US5658727A (en) | 1991-04-10 | 1997-08-19 | The Scripps Research Institute | Heterodimeric receptor libraries using phagemids |
| WO1993011236A1 (en) | 1991-12-02 | 1993-06-10 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6933368B2 (en) | 1992-03-09 | 2005-08-23 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation of immunoglobulin variable region |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| WO1994004678A1 (en) | 1992-08-21 | 1994-03-03 | Casterman Cecile | Immunoglobulins devoid of light chains |
| WO1994025591A1 (en) | 1993-04-29 | 1994-11-10 | Unilever N.V. | PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE) |
| WO1994029351A2 (en) | 1993-06-16 | 1994-12-22 | Celltech Limited | Antibodies |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| WO1995020401A1 (en) | 1994-01-31 | 1995-08-03 | Trustees Of Boston University | Polyclonal antibody libraries |
| US5516637A (en) | 1994-06-10 | 1996-05-14 | Dade International Inc. | Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage |
| WO1996027011A1 (en) | 1995-03-01 | 1996-09-06 | Genentech, Inc. | A method for making heteromultimeric polypeptides |
| US6300064B1 (en) | 1995-08-18 | 2001-10-09 | Morphosys Ag | Protein/(poly)peptide libraries |
| US5750753A (en) | 1996-01-24 | 1998-05-12 | Chisso Corporation | Method for manufacturing acryloxypropysilane |
| US6001329A (en) | 1996-05-06 | 1999-12-14 | Uab Research Foundation | Radiolabeled fusion toxins for cancer therapy |
| WO1999051642A1 (en) | 1998-04-02 | 1999-10-14 | Genentech, Inc. | Antibody variants and fragments thereof |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6995259B1 (en) | 1998-10-23 | 2006-02-07 | Sirna Therapeutics, Inc. | Method for the chemical synthesis of oligonucleotides |
| US8728474B2 (en) | 2002-07-03 | 2014-05-20 | Ono Pharmaceutical Co., Ltd. | Immunopotentiative composition |
| US7595048B2 (en) | 2002-07-03 | 2009-09-29 | Ono Pharmaceutical Co., Ltd. | Method for treatment of cancer by inhibiting the immunosuppressive signal induced by PD-1 |
| US9073994B2 (en) | 2002-07-03 | 2015-07-07 | Ono Pharmaceutical Co., Ltd. | Immunopotentiative composition |
| US9067999B1 (en) | 2002-07-03 | 2015-06-30 | Ono Pharmaceutical Co., Ltd. | Immunopotentiative composition |
| EP1537878A1 (en) | 2002-07-03 | 2005-06-08 | Ono Pharmaceutical Co., Ltd. | Immunopotentiating compositions |
| US20080241223A1 (en) | 2004-04-30 | 2008-10-02 | Allergan, Inc. | Extended release biodegradable ocular implants |
| EP2161336A1 (en) | 2005-05-09 | 2010-03-10 | ONO Pharmaceutical Co., Ltd. | Human monoclonal antibodies to programmed death 1(PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| US8779105B2 (en) | 2005-05-09 | 2014-07-15 | Medarex, L.L.C. | Monoclonal antibodies to programmed death 1 (PD-1) |
| US8008449B2 (en) | 2005-05-09 | 2011-08-30 | Medarex, Inc. | Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics |
| US7943743B2 (en) | 2005-07-01 | 2011-05-17 | Medarex, Inc. | Human monoclonal antibodies to programmed death ligand 1 (PD-L1) |
| WO2007024715A2 (en) | 2005-08-19 | 2007-03-01 | Abbott Laboratories | Dual variable domain immunoglobin and uses thereof |
| WO2008024188A2 (en) | 2006-08-18 | 2008-02-28 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| US8354509B2 (en) | 2007-06-18 | 2013-01-15 | Msd Oss B.V. | Antibodies to human programmed death receptor PD-1 |
| US8900587B2 (en) | 2007-06-18 | 2014-12-02 | Merck Sharp & Dohme Corp. | Antibodies to human programmed death receptor PD-1 |
| EP2170959A1 (en) | 2007-06-18 | 2010-04-07 | N.V. Organon | Antibodies to human programmed death receptor pd-1 |
| US8952136B2 (en) | 2007-06-18 | 2015-02-10 | Merck Sharp & Dohme B.V. | Antibodies to human programmed death receptor PD-1 |
| WO2010027827A2 (en) | 2008-08-25 | 2010-03-11 | Amplimmune, Inc. | Targeted costimulatory polypeptides and methods of use to treat cancer |
| WO2010077634A1 (en) | 2008-12-09 | 2010-07-08 | Genentech, Inc. | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| WO2011066342A2 (en) | 2009-11-24 | 2011-06-03 | Amplimmune, Inc. | Simultaneous inhibition of pd-l1/pd-l2 |
| US20120183548A1 (en) * | 2011-01-14 | 2012-07-19 | Five Prime Therapeutics, Inc. | IL-27 Antagonists for Treating Inflammatory Diseases |
| WO2013079174A1 (en) | 2011-11-28 | 2013-06-06 | Merck Patent Gmbh | Anti-pd-l1 antibodies and uses thereof |
| WO2013173223A1 (en) | 2012-05-15 | 2013-11-21 | Bristol-Myers Squibb Company | Cancer immunotherapy by disrupting pd-1/pd-l1 signaling |
| WO2015103072A1 (en) | 2013-12-30 | 2015-07-09 | Epimab Biotherapeutics | Fabs-in-tandem immunoglobulin and uses thereof |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
| WO2016106159A1 (en) | 2014-12-22 | 2016-06-30 | Enumeral Biomedical Holding, Inc. | Anti-pd-1 antibodies |
| US20190031766A1 (en) | 2017-06-22 | 2019-01-31 | Novartis Ag | Antibody molecules to cd73 and uses thereof |
| WO2019178269A2 (en) | 2018-03-14 | 2019-09-19 | Surface Oncology, Inc. | Antibodies that bind cd39 and uses thereof |
| WO2021062244A1 (en) * | 2019-09-25 | 2021-04-01 | Surface Oncology, Inc. | Anti-il-27 antibodies and uses thereof |
Non-Patent Citations (149)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1987, WILEY INTERSCIENCE |
| "Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996 |
| "GenBank", Database accession no. AAC51773 |
| "UniProt", Database accession no. Q495A1 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, no. 17, 1997, pages 3389 - 3402 |
| ANONYMOUS: "History of Changes for Study: NCT04374877 Study of SRF388 in Patients With Advanced Solid Tumors", 8 October 2020 (2020-10-08), pages 1 - 6, XP055947017, Retrieved from the Internet <URL:https://clinicaltrials.gov/ct2/history/NCT04374877?V_3=View#StudyPageTop> [retrieved on 20220728] * |
| BALDRIDGE ET AL., METHODS, vol. 19, 1999, pages 103 - 107 |
| BATZER ET AL., NUCLEIC ACID RES., vol. 19, 1991, pages 5081 |
| BERGE ET AL., JPHARM SCI, vol. 66, 1977, pages 1 - 19 |
| BIEG ET AL., AUTOIMMUNITY, vol. 31, no. 1, 1999, pages 15 - 24 |
| BLANK ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 54, 2005, pages 307 - 314 |
| BLANK, C. ET AL., IMMUNOL. IMMUNOTHER., vol. 56, no. 5, 29 December 2006 (2006-12-29), pages 739 - 745 |
| BOCCI G. ET AL., CANCER RESEARCH, 2004 |
| BODER, METHODS ENZYMOLOGY, vol. 328, 2000, pages 430 - 444 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 |
| BRINKMAN ET AL., J IMMUNOL METHODS, vol. 184, 1995, pages 177 - 186 |
| BROWN ET AL., J. IMMUNOL., vol. 170, 2003, pages 1257 - 66 |
| BURTON ET AL., ADVANCES IN IMMUNOLOGY, vol. 57, 1994, pages 191 - 280 |
| BURTON ET AL., ADVIMMUN, vol. 51, 1992, pages 1 - 18 |
| CANFIELD ET AL., J EXP MED, vol. 173, 1991, pages 1483 - 1491 |
| CARON ET AL., J EXP MED, vol. 176, 1992, pages 1191 - 1195 |
| CHASTEEN ET AL., NUCLEIC ACIDS RES, vol. 34, no. 21, 2006, pages el45 |
| CHENMELLMAN, IMMUNITY, vol. 39, no. 1, 2013, pages 61 - 730 |
| CHEUNG ET AL., VIROLOGY, vol. 176, 1990, pages 546 |
| CO ET AL., MOL IMMUNOL, vol. 30, 1993, pages 1361 |
| CORNELIS, CURR OPIN BIOTECHNOL, vol. 11, 2000, pages 450 - 454 |
| DEANS ET AL., PROC NATL ACAD SCI USA, vol. 81, 1984, pages 1292 |
| DI NIRO ET AL., BIOCHEM J, vol. 388, 2005, pages 889 - 894 |
| DIAKOWSKI ET AL., ADV. CLIN. EXP. MED., vol. 22, no. 5, 2013, pages 683 - 691 |
| DIETRICH ET AL., J. IMMUNOL., vol. 192, 2014, pages 5382 - 5389 |
| DONG ET AL., J. MOL. MED., vol. 81, 2003, pages 281 - 7 |
| DONG ET AL., NAT MED, vol. 8, no. 8, 2002, pages 793 - 800 |
| DUNCANWINTER, NATURE, vol. 322, 1988, pages 738 - 40 |
| E. MEYERSW. MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| ENGBERG ET AL., METHODS MOL BIOL, vol. 51, 1995, pages 355 - 376 |
| EPPSTEIN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 82, 1985, pages 3688 - 3692 |
| ETZ ET AL., JBACTERIOL, vol. 183, 2001, pages 6924 - 6935 |
| FABBI ET AL., MEDIATORS INFLAMM, 1 February 2017 (2017-02-01) |
| FERGUSSON ET AL., CELL REPORTS, vol. 9, no. 3, 2014, pages 1075 - 1088 |
| FURSOV ET AL., ASSAY DRUG DEV TECHNOL, vol. 9, no. 4, 2011, pages 420 - 429 |
| GAO ET AL., CLIN CANCER RES, vol. 15, 2009, pages 971 - 979 |
| GHEBEH ET AL., NEOPLASIA, vol. 8, 2006, pages 190 - 198 |
| GRABHERR ET AL., COMB CHEM HIGH THROUGHPUT SCREEN, vol. 4, 2001, pages 185 - 192 |
| GRUBER ET AL., J IMMUNOL, vol. 152, 1994, pages 5368 |
| GRUBER ET AL., J. IMMUNOL., vol. 152, 1994, pages 5368 |
| GUPTA ET AL., VACCINE, vol. 13, no. 14, 1995, pages 1263 - 1276 |
| HAMANISHI ET AL., PROC NAT ACAD SCI USA, vol. 104, 2007, pages 3360 - 3365 |
| HANAHANWEINBERG, CELL, vol. 144, no. 5, 2011, pages 646 - 674 |
| HANES ET AL., NAT BIOTECHNOL, vol. 18, 2000, pages 1287 - 1292 |
| HARDINGLONBERG, ANN. N.Y. ACAD. SCI., vol. 764, 1995, pages 536 - 546 |
| HINO ET AL., CANCER, vol. 116, no. 7, 2010, pages 1757 - 1766 |
| HISADA ET AL., CANCER RES., vol. 64, 2004, pages 1152 - 1156 |
| HOLLINGER ET AL., PROC NATL ACAD SCI USA, vol. 90, 1993, pages 6444 - 6448 |
| HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448 |
| HOOGENBOOM, TRENDS IN BIOTECHNOLOGY, vol. 15, 1997, pages 62 - 70 |
| HOU ET AL., CYTOKINE, vol. 10, 1998, pages 319 - 30 |
| HOUDEBINE, CURR OPIN BIOTECHNOL, vol. 13, no. 6, 2002, pages 625 - 629 |
| HUDSONKORTT, J. IMMUNOL. METHODS, vol. 231, no. 1, 1999, pages 177 - 189 |
| INMAN ET AL., CANCER, vol. 109, 2007, pages 1499 - 1505 |
| ISHIDA, Y. ET AL., EMBO J., vol. 11, 1992, pages 3887 - 3895 |
| ISNER ET AL., J. CLIN. INVEST., vol. 103, 1999, pages 1231 - 1236 |
| IWAI ET AL., PROC. NAT'L. ACAD. SCI. USA, vol. 99, 2002, pages 12293 - 7 |
| JANKOWSKI ET AL., ARCH IMMUNOL. THER. EXP., vol. 58, 2010, pages 417 - 425 |
| JOHNSON ET AL., J MED CHEM, vol. 42, 1999, pages 4640 - 4649 |
| KASZUBSKA ET AL., PROTEIN EXPRESSION AND PURIFICATION, vol. 18, 2000, pages 213 - 220 |
| KETTLEBOROUGH ET AL., EUR J IMMUNOL, vol. 24, 1994, pages 952 - 958 |
| KIEKE, PROTEIN ENG, vol. 10, 1997, pages 1303 - 1310 |
| KIM ET AL., J. BIOL. CHEM., vol. 275, 2000, pages 33920 - 33928 |
| KIM, I PATH., vol. 156, 2000, pages 1345 - 1362 |
| KINSTLER ET AL., ADVANCED DRUG DELIVERIES REVIEWS, vol. 54, 2002, pages 477 - 485 |
| KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614 |
| KITANO ET AL., ESMO OPEN, vol. 2, no. 2, 2017, pages e000150 |
| KLEFFEL ET AL., CELL, vol. 162, no. 6, 2015, pages 1242 - 1256 |
| KLEMM ET AL., MICROBIOLOGY, vol. 146, 2000, pages 3025 - 3032 |
| KONISHI ET AL., CLIN. CANCER RES., vol. 10, 2004, pages 5094 - 100 |
| KOSTELNY ET AL., J IMMUNOL, vol. 148, no. 5, 1992, pages 1547 - 1553 |
| KOSTELNY ET AL., J. IMMUNOL., vol. 148, no. 5, 1992, pages 1547 - 1553 |
| KUMAR ET AL., ANGIOGENESIS: FROM MOLECULAR TO INTEGRATIVE PHARM, 2000, pages 169 - 180 |
| LANGER ET AL., J. BIOMED. MATER. RES., vol. 15, 1981, pages 167 - 277 |
| LANGER, CHEM. TECH., vol. 12, 1982, pages 98 - 105 |
| LAROUSSERIE ET AL., AM. J. PATHOL., vol. 166, no. 4, 2005, pages 1217 - 28 |
| LEE ET AL., BIOCONJUG CHEM, vol. 10, no. 6, 1999, pages 973 - 8 |
| LIU ET AL., SCAN. J. IMMUNOL., vol. 68, 2008, pages 22 - 299 |
| LODMELL ET AL., VACCINE, vol. 18, 2000, pages 1059 - 1066 |
| LONBERG ET AL., NATURE, vol. 368, no. 6474, 1994, pages 856 - 859 |
| LONBERG, NATURE BIOTECH., vol. 23, no. 9, 2005, pages 1117 - 1125 |
| LONBERGHUSZAR, INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| LUSKYBOTCHAN, NATURE, vol. 293, 1981, pages 79 |
| MERZ ET AL., J NEUROSCI METHODS, vol. 62, no. 1-2, 1995, pages 213 - 9 |
| MICHAEL ET AL., GENE THER, vol. 2, 1995, pages 660 - 668 |
| MILSTEINCUELLO, NATURE, vol. 305, 1983, pages 537 - 539 |
| MOLDENHAUER ET AL., SCAND. J. IMMUNOL., vol. 32, 1990, pages 77 |
| MOREL ET AL., MOL. IMMUNOL., vol. 25, no. 1, 1988, pages 7 |
| MOUSA ET AL., ANGIOGEN. STIM. IIIHIB., vol. 35, 2000, pages 42 - 44 |
| MUELLER ET AL., MOLIMMUNOL, vol. 34, no. 6, 1997, pages 441 - 452 |
| MULLIGANBERG, PROC NATL ACAD SCI USA, vol. 78, 1981, pages 2072 |
| MUYLDERMANS ET AL., TRENDS BIOCHEM. SCI., vol. 26, 2001, pages 230 - 235 |
| NAKANISHI ET AL., CANCER IMMUNOL IMMUNOTHER, vol. 56, 2007, pages 1173 - 1182 |
| NEEDLEMANWUNSCH, J. MOL. BIOL., vol. 48, no. 48, 1970, pages 444 - 453 |
| NOMI ET AL., CLIN CANCER RES, vol. 11, 2005, pages 2947 - 2953 |
| NUTTALL ET AL., CURR. PHARM. BIOTECH., vol. 1, 2000, pages 253 - 263 |
| OHTSUKA ET AL., BIOL. CHEM., vol. 260, 1985, pages 2605 - 2608 |
| OLENA KOURKO ET AL: "IL-27, IL-30, and IL-35: A Cytokine Triumvirate in Cancer", FRONTIERS IN ONCOLOGY, vol. 9, 1 October 2019 (2019-10-01), XP055675977, DOI: 10.3389/fonc.2019.00969 * |
| PATNAIK AMITA ET AL: "Results of a phase 1 study of SRF388, a first-in-human, first-in-class, high-affinity anti-IL-27 antibody in advanced solid tumors.", MEETING ABSTRACT | 2021 ASCO ANNUAL MEETING I DEVELOPMENTAL THERAPEUTICS-IMMUNOTHERAPY, vol. 39, 28 June 2021 (2021-06-28), pages 1 - 4, XP055947029, Retrieved from the Internet <URL:https://ascopubs.org/doi/10.1200/JCO.2021.39.15_suppl.2551> * |
| PAVISIC ET AL., INT J PHARM, vol. 387, no. 1-2, 2010, pages 110 - 119 |
| PEARSONLIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| PEREBOEV ET AL., J VIROL, vol. 75, 2001, pages 7107 - 7113 |
| PERSIC ET AL., GENE, vol. 187, 1997, pages 9 - 18 |
| POLJAK, STRUCTURE, vol. 2, no. 12, 1994, pages 1121 - 1123 |
| REICHMANN ET AL., J. IMMUNOL. METH., vol. 231, 1999, pages 25 - 38 |
| ROBERTS ET AL., ADVANCED DRUG DELIVERY REVIEWS, vol. 54, 2002, pages 459 - 476 |
| ROGERS ET AL., J NUCL MED, vol. 38, 1997, pages 1221 - 1229 |
| RONDONMARASCO, ANNU. REV. MICROBIOL., vol. 51, 1997, pages 257 - 283 |
| ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 113, 1994, pages 91 - 101 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| SARVER ET AL., PROC NATL ACAD SCI USA, vol. 79, 1982, pages 7147 |
| SCHAFFITZEL ET AL., J IMMUNOL METHODS, vol. 231, no. 1-2, 1999, pages 147 - 157 |
| SCHOONBROODT ET AL., NUCLEIC ACIDS RES, vol. 33, 2005 |
| SCOPES: "Protein Purification", 1994, SPRINGER-VERLAG |
| SHALABY ET AL., J. EXP. MED., vol. 175, 1992, pages 217 - 225 |
| SHI ET AL., JMB, vol. 397, 2010, pages 385 - 396 |
| SHIMAUCHI ET AL., INT J CANCER, vol. 121, 2007, pages 2585 - 2590 |
| SHIMIZU ET AL., J. IMMUNOL., vol. 176, 2006, pages 7317 - 7324 |
| SHIRAISHI ET AL., NUCLEIC ACIDS SYMPOSIUM SERIES, vol. 51, no. 1, 2007, pages 129 - 130 |
| SHOPES, IMMUNOL, vol. 148, 1992, pages 2918 - 2922 |
| SIDMAN ET AL., BIOPOLYMERS, vol. 22, 1983, pages 547 - 556 |
| SMITHWATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
| SONGSIVILAILACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321 |
| SOUTHERNBERG, MOLAPPL GENET, vol. 1, 1982, pages 327 |
| STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242 |
| SURESH ET AL., METHODS ENZYMOL., vol. 121, 1986, pages 210 |
| TAKAHASHI ET AL., NAT. MED., vol. 5, 1995, pages 434 - 438 |
| THOMPSON ET AL., CLIN GENITOURIN CANCER, vol. 5, 2006, pages 206 - 211 |
| TOCHIZAWA ET AL., J IMMUNOL METHODS, vol. 313, no. 1-2, 2006, pages 29 - 37 |
| TODOROVSKA ET AL., J. IMMUNOL. METHODS, vol. 248, no. 1, 2001, pages 47 - 66 |
| TUTT ET AL., J IMMUNOL, vol. 147, 1991, pages 60 |
| TUTT ET AL., J. IMMUNOL., vol. 147, 1991, pages 60 |
| VAN KUIK-ROMEIJN ET AL., TRANSGENIC RES, vol. 9, no. 2, 2000, pages 155 - 159 |
| VARNER ET AL., ANGIOGEN, vol. 3, 1999, pages 53 - 60 |
| WIGLER ET AL., CELL, vol. 16, 1979, pages 77 |
| WRIGHT ET AL., EMBO J, vol. 10, no. 10, 1991, pages 2717 - 2723 |
| WU ET AL., NAT BIOTECHNOL, vol. 25, no. 11, 2007, pages 1290 - 1297 |
| YANG ET AL., INVEST OPHTHALMOL VIS SCI, vol. 49, no. 6, 2008, pages 2518 - 2525 |
| YANG J.C. ET AL., NEJM, 2003 |
| YEUNG ET AL., BIOTECHNOL PROG, vol. 18, 2002, pages 212 - 220 |
| YOSHIDA ET AL., ANNU. REV IMMUNOL., vol. 33, 2015, pages 417 - 43 |
| ZAPATA ET AL., PROTEIN ENG, vol. 8, no. 10, 1995, pages 1057 - 1062 |
| ZHAN ET AL., DRUG DISCOV TODAY, vol. 21, no. 6, 2016, pages 1027 - 1036 |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024110405A1 (en) * | 2022-11-22 | 2024-05-30 | Institut National de la Santé et de la Recherche Médicale | Use of il-27 antagonists for the treatment of ebv-driven b lymphoproliferative diseases |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20240005809A (ko) | 2024-01-12 |
| CA3215856A1 (en) | 2022-11-10 |
| AU2022270170A1 (en) | 2023-09-21 |
| TW202304981A (zh) | 2023-02-01 |
| MX2023013149A (es) | 2023-11-28 |
| US12577299B2 (en) | 2026-03-17 |
| IL308198A (en) | 2024-01-01 |
| JOP20230282A1 (ar) | 2023-11-05 |
| JP2024516970A (ja) | 2024-04-18 |
| EP4334348A1 (en) | 2024-03-13 |
| US20220389089A1 (en) | 2022-12-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12496342B2 (en) | Anti-CCR8 antibodies and uses thereof | |
| US20260055176A1 (en) | Anti-il-27 antibodies and uses thereof | |
| US20250154244A1 (en) | Anti-il-27 antibodies and uses thereof | |
| US20240199732A1 (en) | Anti-IL-27 Antibodies and Uses Thereof | |
| US12577299B2 (en) | Anti-IL-27 antibodies and uses thereof | |
| WO2026055168A1 (en) | Anti-il-27 antibodies and uses and doses thereof | |
| WO2026055167A1 (en) | Anti-il-27 antibodies and use of biomarkers in uses thereof | |
| EA051459B1 (ru) | Антитела к il-27 и их применение | |
| CN118076635A (zh) | 抗il-27抗体和其用途 | |
| WO2025226603A1 (en) | Methods for treating cancer using anti-ccr8 antibodies | |
| EA052811B1 (ru) | Антитела против ил-27 и их применение | |
| EA051778B1 (ru) | Антитела к il-27 и их применение |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22727555 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 803300 Country of ref document: NZ Ref document number: 2022270170 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 2022270170 Country of ref document: AU Date of ref document: 20220506 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3215856 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023564682 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280030336.5 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 308198 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2023/013149 Country of ref document: MX Ref document number: P6002866/2023 Country of ref document: AE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112023022944 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20237041204 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202393104 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022727555 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022727555 Country of ref document: EP Effective date: 20231207 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202306647V Country of ref document: SG |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112023022944 Country of ref document: BR Free format text: EXPLIQUE A DIVERGENCIA NO NOME DE UM DOS INVENTORES (ALISON O'NEILL) QUE CONSTA NA PUBLICACAO INTERNACIONAL WO 2022/236134 E O CONSTANTE DA PETICAO INICIAL NO 870230096939. A EXIGENCIA DEVE SER RESPONDIDA EM ATE 60 (SESSENTA) DIAS DE SUA PUBLICACAO E DEVE SER REALIZADA POR MEIO DA PETICAO GRU CODIGO DE SERVICO 207. |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523451419 Country of ref document: SA |
|
| ENP | Entry into the national phase |
Ref document number: 112023022944 Country of ref document: BR Kind code of ref document: A2 Effective date: 20231101 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523451419 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523451419 Country of ref document: SA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 523451419 Country of ref document: SA |
|
| WWR | Wipo information: refused in national office |
Ref document number: 523451419 Country of ref document: SA |