WO2022232808A1 - Dosing regimens of peptide conjugates of topoisomerase i inhibitors - Google Patents
Dosing regimens of peptide conjugates of topoisomerase i inhibitors Download PDFInfo
- Publication number
- WO2022232808A1 WO2022232808A1 PCT/US2022/071967 US2022071967W WO2022232808A1 WO 2022232808 A1 WO2022232808 A1 WO 2022232808A1 US 2022071967 W US2022071967 W US 2022071967W WO 2022232808 A1 WO2022232808 A1 WO 2022232808A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- compound
- administered
- pharmaceutically acceptable
- acceptable salt
- daily dose
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/47—Quinolines; Isoquinolines
- A61K31/4738—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems
- A61K31/4745—Quinolines; Isoquinolines ortho- or peri-condensed with heterocyclic ring systems condensed with ring systems having nitrogen as a ring hetero atom, e.g. phenantrolines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
Definitions
- the present invention relates to dosing regimens of peptide conjugates of topoisomerase I inhibitors (e.g., a peptide conjugate of the topoisomerase I inhibitor exatecan), which is useful for the treatment of diseases such as cancer.
- SEQUENCE LISTING This application contains a Sequence Listing that has been submitted electronically as an ASCII text file named 43236-0019WO1_ST25.txt. The ASCII text file, created on April 26, 2022, is 2.20 kilobytes in size. The material in the ASCII text file is hereby incorporated by reference in its entirety.
- BACKGROUND OF THE INVENTION Cancer is a group of diseases characterized by aberrant control of cell growth. The annual incidence of cancer is estimated to be in excess of 1.6 million in the United States alone. While surgery, radiation, chemotherapy, and hormones are used to treat cancer, it remains the second leading cause of death in the U.S. It is estimated that about 600,000 Americans will die from cancer each year. Treatment of cancer in humans by systemic administration of pharmaceutical agents often functions by slowing or terminating the uncontrolled replication that is a characteristic of cancer cells.
- One class of such agents is topoisomerase I inhibitors. Topoisomerase 1 enzymes function to relax supercoiled DNA and alleviate DNA helical constraints and play a role in transcriptional regulation.
- Topoisomerase I is essential for the development in the mammalian system due to its dynamic functions in DNA replication and transcription. However, due to its direct role in transcriptional regulation, topoisomerase I dysfunction may lead to abnormal cellular functions. See Li, M., Genomics Proteomics Bioinformatics 14 (2016), 166-171.
- human diseases such as cancer, neurodegenerative diseases, and autoimmune diseases, are linked to topoisomerase I regulation and activity. Inhibitors of topoisomerase I have been developed and continue to be developed as anti-cancer agents. In particular, topoisomerase I inhibitors are widely used for the treatment of colorectal, gastric, and other cancers.
- topoisomerase I inhibitors are useful in the treatment of cancer, the compounds also exhibit side effects, including neutropenia and severe diarrhea. Preferential delivery of topoisomerase inhibitors to these diseased tissues could avoid these serious side effects.
- Peptide conjugates of topoisomerase I inhibitors are described in US Patent Application Publication No. US 2021/009719. There is a need for the further development of peptide conjugates of topoisomerase inhibitors, and dosing regimens thereof.
- the present disclosure provides, inter alia, a method of treating cancer in a patient, comprising administering to said patient a compound of Formula (I): or a pharmaceutically acceptable salt thereof, wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; and Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.1 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of the compound.
- a compound of Formula (I): or a pharmaceutically acceptable salt thereof wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; and Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof
- the present disclosure provides, inter alia, a method of treating cancer in a patient, comprising administering to said patient Compound 1 having the structure: Compound 1, or a pharmaceutically acceptable salt thereof, wherein Pv1 is a peptide comprising the following sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1); and wherein Compound 1 or the pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.1 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of Compound 1.
- the present disclosure further provides a method of treating cancer in a patient, comprising administering to said patient a compound of Formula (I): or a pharmaceutically acceptable salt thereof, wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; and Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound.
- a compound of Formula (I): or a pharmaceutically acceptable salt thereof wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; and Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof is administered in
- the present disclosure further provides a method of treating cancer in a patient, comprising administering to said patient Compound 1 having the structure: or a pharmaceutically acceptable salt thereof, wherein Pv1 is a peptide comprising the following sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1); and wherein Compound 1 or the pharmaceutically acceptable salt thereof is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of Compound 1.
- the present disclosure further provides a method of administering Compound 1, or a pharmaceutically acceptable salt thereof, to a patient in need of treatment, comprising parenterally delivering to said patient Compound 1 having the structure: or a pharmaceutically acceptable salt thereof, wherein Pv1 is a peptide comprising the following sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1); and wherein Compound 1 or the pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.1 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of Compound 1.
- the present disclosure further provides a method of administering Compound 1, or a pharmaceutically acceptable salt thereof, to a patient in need of treatment, comprising parenterally delivering to said patient Compound 1 having the structure:
- Compound 1, or a pharmaceutically acceptable salt thereof wherein Pv1 is a peptide comprising the following sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1); and wherein Compound 1 or the pharmaceutically acceptable salt thereof is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of Compound 1.
- the present disclosure further provides a use of a compound of Formula (I) or a pharmaceutically acceptable salt thereof in the preparation of a medicament for the treatment of cancer.
- the present disclosure further provides a compound of Formula (I) or a pharmaceutically acceptable salt thereof for use in any of the methods described herein.
- FIG.1A shows the mean plasma levels of Compound 1 and exatecan (Cohort A) at 1 day.
- FIG.1B shows the mean plasma levels of Compound 1 and exatecan (Cohort A) at 4 days.
- FIG.2A shows the mean plasma levels of Compound 1 and exatecan (Cohort B) at 1 day.
- FIG.2B shows the mean plasma levels of Compound 1 and exatecan (Cohort B) at 3 days.
- the present disclosure provides, inter alia, a method of treating cancer in a patient, comprising administering to said patient a compound of Formula (I): or a pharmaceutically acceptable salt thereof, wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; and Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.1 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of the compound.
- the present disclosure further provides a method of treating cancer in a patient, comprising administering to said patient a compound of Formula (I): or a pharmaceutically acceptable salt thereof, wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; Q is a linker, which is covalently linked to moiety R 1 and R 2 ; and wherein the compound, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound.
- a compound of Formula (I): or a pharmaceutically acceptable salt thereof wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; Q is a linker, which is covalently linked to moiety R 1 and R 2 ; and wherein the compound, or the pharmaceutically acceptable salt thereof, is administered
- the present disclosure further provides a method of administering a compound of Formula (I): or a pharmaceutically acceptable salt thereof, to a patient in need of treatment, comprising parenterally delivering the compound to said patient, wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; and Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.1 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of the compound.
- the present disclosure further provides a method of administering a compound of Formula (I): or a pharmaceutically acceptable salt thereof, to a patient in need of treatment, comprising parenterally delivering the compound to said patient, wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; and Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound.
- the present disclosure further provides a method of administering a compound of Formula (I): or a pharmaceutically acceptable salt thereof, to a patient in need of treatment, comprising parenterally delivering to said patient the compound, or a pharmaceutically acceptable salt thereof, wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; and Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound.
- R 1 is a peptide
- R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I
- Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof, is administered
- the present disclosure further provides a method of administering a compound of Formula (I): or a pharmaceutically acceptable salt thereof, to a patient in need of treatment, comprising parenterally delivering to said patient the compound, or a pharmaceutically acceptable salt thereof, wherein: R 1 is a peptide; R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I; and Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound.
- R 1 is a peptide
- R 2 is a small molecule topoisomerase I targeting moiety, which binds to topoisomerase I
- Q is a linker, which is covalently linked to moiety R 1 and R 2 ; wherein the compound, or the pharmaceutically acceptable salt thereof, is administered
- the peptide of R 1 has 10 to 50 amino acids, 20 to 40 amino acids, 10 to 20 amino acids, 20 to 30 amino acids, or 30 to 40 amino acids.
- the peptide of R 1 is a conformationally restricted peptide.
- a conformationally restricted peptide can include, for example, macrocyclic peptides and stapled peptides.
- a stapled peptide is a peptide constrained by a covalent linkage between two amino acid side-chains, forming a peptide macrocycle.
- Conformationally restricted peptides are described, for example, in Guerlavais et al., Annual Reports in Medicinal Chemistry 2014, 49, 331-345; Chang et al., Proceedings of the National Academy of Sciences of the United States of America (2013), 110(36), E3445-E3454; Tesauro et al., Molecules 2019, 24, 351-377; Dougherty et al., Journal of Medicinal Chemistry (2019), 62(22), 10098-10107; and Dougherty et al., Chemical Reviews (2019), 119(17), 10241- 10287, each of which is incorporated herein by reference in its entirety.
- the peptide of R 1 is an environmentally sensitive peptide described, for example, in U.S. Pat. Nos.8,076,451 and 9,289,508 and U.S. Pat. Pub. No. 2019/209580 (each of which are incorporated herein by reference in their entirety), although other peptides capable of such selective insertion could be used.
- Other suitable peptides are described, for example, in Weerakkody, et al., PNAS 110 (15), 5834-5839 (April 9, 2013), which is also incorporated herein by reference in its entirety. Without being bound by theory, it is believed that the environmentally sensitive peptide undergoes a conformational change and inserts across cell membranes in response to physiological changes (e.g., pH).
- the peptide can target acidic tissue and selectively translocate polar, cell-impermeable molecules across cell membranes in response to low extracellular pH.
- the peptide is capable of selectively delivering molecules across a cell membrane having an acidic or hypoxic mantle having a pH less than about 6.0.
- the peptide is capable of selectively delivering a molecule across a cell membrane having an acidic or hypoxic mantle having a pH less than about 6.5.
- the peptide is capable of selectively delivering a molecule across a cell membrane having an acidic or hypoxic mantle having a pH less than about 5.5.
- the peptide is capable of selectively delivering a molecule across a cell membrane having an acidic or hypoxic mantle having a pH between about 5.0 and about 6.0.
- the term “acidic and/or hypoxic mantle” refers to the environment of the cell in the diseased tissue in question having a pH lower than 7.0 and preferably lower than 6.5.
- An acidic or hypoxic mantle more preferably has a pH of about 5.5 and most preferably has a pH of about 5.0.
- the compounds of formula (I) insert across a cell membrane having an acidic and/or hypoxic mantle in a pH dependent fashion to insert R 2 - into the cell, whereupon the disulfide linker is cleaved to deliver free R 2 H. Since the compounds of formula (I) are pH-dependent, they preferentially insert across a cell membrane only in the presence of an acidic or hypoxic mantle surrounding the cell and not across the cell membrane of “normal” cells, which do not have an acidic or hypoxic mantle.
- An example of a cell having an acidic or hypoxic mantle is a cancer cell.
- pH-sensitive or “pH-dependent” as used herein to refer to the peptide R 1 or to the mode of insertion of the peptide R 1 or of the compounds of the invention across a cell membrane, means that the peptide has a higher affinity to a cell membrane lipid bilayer having an acidic or hypoxic mantle than a membrane lipid bilayer at neutral pH.
- the compounds of the invention preferentially insert through the cell membrane to insert R 2 - to the interior of the cell (and thus deliver R 2 H as described above) when the cell membrane lipid bilayer has an acidic or hypoxic mantle (a “diseased” cell) but does not insert through a cell membrane when the mantle (the environment of the cell membrane lipid bilayer) is not acidic or hypoxic (a “normal” cell). It is believed that this preferential insertion is achieved as a result of the peptide R 1 forming a helical configuration, which facilitates membrane insertion.
- the peptide of R 1 comprises at least one of the following sequences: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO.1; Pv1), AEQNPIYWARYADWLFTTPLLLLDLALLVDADECG (SEQ ID NO.2; Pv2); ADDQNPWRAYLDLLFPTDTLLLDLLWDADECG (SEQ ID NO.3; Pv3); Ac-AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTKCG (SEQ ID NO. 4; Pv4); and AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTC (SEQ ID No.5; Pv5).
- the peptide of R 1 comprises at least one of the following sequences: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO.1; Pv1), AEQNPIYWARYADWLFTTPLLLLDLALLVDADECG (SEQ ID NO. 2; Pv2), and ADDQNPWRAYLDLLFPTDTLLLDLLWDADECG (SEQ ID NO.3; Pv3).
- the peptide of R 1 comprises the sequence ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO.1; Pv1).
- the peptide of R 1 comprises the sequence AEQNPIYWARYADWLFTTPLLLLDLALLVDADECG (SEQ ID NO.2; Pv2). In some embodiments, the peptide of R 1 comprises the sequence ADDQNPWRAYLDLLFPTDTLLLDLLWDADECG (SEQ ID NO.3; Pv3). In some embodiments, the peptide of R 1 comprises the sequence Ac-AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTKCG (SEQ ID NO.4; Pv4). In some embodiments, the peptide of R 1 comprises the sequence AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTC (SEQ ID NO.5; Pv5).
- the peptide of R 1 consists essentially of the sequence ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO.1; Pv1). In some embodiments, the peptide of R 1 consists essentially of the sequence AEQNPIYWARYADWLFTTPLLLLDLALLVDADECG (SEQ ID NO.2; Pv2). In some embodiments, the peptide of R 1 consists essentially of the sequence ADDQNPWRAYLDLLFPTDTLLLDLLWDADECG (SEQ ID NO.3; Pv3).
- the peptide of R 1 consists essentially of the sequence AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTKCG (SEQ ID NO.4; Pv4). In some embodiments, the peptide of R 1 consists essentially of the sequence AAEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTC (SEQ ID NO.5; Pv5). Additional peptides are disclosed in in U.S. Patent Publication No. US 2019/209580, U.S. Patent Application No.16/925,094, and U.S. Patent Application No.16/924,445, each of which is incorporated herein in its entirety.
- topoisomerase I targeting moiety or “topoisomerase I inhibitor” refers to a chemical group that binds to topoisomerase I.
- the small molecule topoisomerase I targeting moiety can be a group derived from a compound that inhibits the activity of topoisomerase I.
- Topoisomerase inhibitors include camptothecin and derivatives and analogues thereof such as opotecan, irinotecan (CPT-11), silatecan (DB- 67, AR-67), cositecan (BNP-1350), lurtotecan, gimatecan (ST1481), belotecan (CKD- 602), rubitecan, topotecan, deruxtecan, and exatecan. Topoisomerase inhibitors are described in, for example, Ogitani, Bioorg. Med. Chem. Lett.
- R 2 is camptothecin, opotecan, irinotecan (CPT-11), silatecan (DB-67, AR-67), cositecan (BNP-1350), lurtotecan, gimatecan (ST1481), belotecan (CKD-602), rubitecan, topotecan, deruxtecan, or exatecan.
- R 2 is exatecan.
- the moiety Q is a linking group, covalently connecting R 1 and R 2 that serves a tether between the peptide and topoisomerase I inhibitor that may be cleaved when the conjugate or portion thereof is inside a cell.
- R q is independently selected from OH, CN, -COOH, NH 2 , halo, C 1-6 haloalkyl, C 1-6 alkyl, C 1-6 alkoxy, C 1-6 haloalkoxy, NH(C 1-6 alkyl) and N(C 1-6 alkyl) 2 .
- the compound is a compound of Formula (II): or a pharmaceutically acceptable salt thereof, wherein: R 1 is a peptide; R 2 is a topoisomerase I inhibitor; Ring Z is a monocyclic C 5-7 cycloalkyl ring or a monocyclic 5-7 membered heterocycloalkyl ring; each R Z is independently selected from C 1-4 alkyl, halo, CN, NO 2 , OR a1 , SR a1 , C(O)R b1 , C(O)NR c1 R d1 , C(O)OR a1 , OC(O)R b1 , OC(O)NR c1 R d1 , NR c1 R d1 , NR c1 C(O)R b1 , NR c1 C(O)OR a1 , and NR c1 C(O)NR c1 R d1 ; or two adjacent R Z
- R 1 is a peptide comprising the sequence of SEQ ID NO: 1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, or SEQ ID NO:5.
- R 1 is Pv1, Pv2, Pv3, Pv4, or Pv5.
- R 1 is attached to the core via a cysteine residue of R 1 wherein one of the sulfur atoms of the disulfide moiety in Formula II is derived from the cysteine residue.
- R 2 is camptothecin, opotecan, irinotecan (CPT-11), silatecan (DB-67, AR-67), cositecan (BNP-1350), lurtotecan, gimatecan (ST1481), belotecan (CKD-602), rubitecan, topotecan, deruxtecan, or exatecan.
- R 2 is exatecan.
- R 2 is attached to the core through an N atom.
- Ring Z is a monocyclic C 5-7 cycloalkyl ring.
- Ring Z is a cyclopentyl ring. In some embodiments of compounds of Formula (II), Ring Z is a cyclohexyl ring. In some embodiments of compounds of Formula (II), Ring Z is a cycloheptyl ring. In some embodiments of compounds of Formula (II), Ring Z is a monocyclic 5-7 membered heterocycloalkyl ring. In some embodiments of compounds of Formula (II), Ring Z is a 5-membered heterocycloalkyl ring. In some embodiments of compounds of Formula (II), Ring Z is a 6-membered heterocycloalkyl ring.
- Ring Z is a 7-membered heterocycloalkyl ring.
- two adjacent R Z together with the atoms to which they are attached form a fused monocyclic C5-7 cycloalkyl ring, a fused monocyclic 5-7 membered heterocycloalkyl ring, a fused C6-10 aryl ring, or a fused 6-10 membered heteroaryl ring, each of which is optionally substituted with 1, 2, or 3 substituents independently selected from C 1-4 alkyl, halo, CN, NO 2 , OR a1 , SR a1 , C(O)R b1 , C(O)NR c1 R d1 , C(O)OR a1 , OC(O)R b1 , OC(O)NR c1 R d1 , NR c1 R d1 , NR c1 C(
- n is 0. In some embodiments of compounds of Formula (II), n is 1. In some embodiments of compounds of Formula (II), n is 2. In some embodiments of compounds of Formula (II), n is 3. In some embodiments, the compounds of the invention is a compound of Formula (III), Formula (IV), or Formula (V):
- the compound is Compound 1, having the structure: or a pharmaceutically acceptable salt thereof, wherein Pv1 is a peptide comprising the following sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1).
- the method comprises administering to said patient a compound of Formula (I), or a pharmaceutically acceptable salt thereof, wherein the compound, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.1 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.25 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.1 mg/kg to 1.25 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.25 mg/kg to about 1.25 mg/kg as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.25 mg/kg to about 0.75 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.25 mg/kg to about 0.50 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.5 mg/kg to about 0.75 mg/kg as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.5 mg/kg to about 1.25 mg/kg as measured by the amount of the free form of the compound.
- a method of treating cancer in a patient comprising administering to said patient a compound of Formula (I), wherein the compound is administered in a daily dose of about 0.1 mg/kg to about 1.5 mg/kg.
- the compound is administered in a daily dose of about 0.25 mg/kg to about 1.5 mg/kg.
- the compound is administered in a daily dose of about 0.1 mg/kg to 1.25 mg/kg.
- the compound is administered in a daily dose of about 0.25 mg/kg to about 1.25 mg/kg.
- the compound is administered in a daily dose of about 0.25 mg/kg to about 0.75 mg/kg. In some embodiments, the compound is administered in a daily dose of about 0.25 mg/kg to about 0.50 mg/kg. In some embodiments, the compound is administered in a daily dose of about 0.5 mg/kg to about 0.75 mg/kg. In some embodiments, the compound is administered in a daily dose of about 0.5 mg/kg to about 1.25 mg/kg. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.25 mg/kg as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.5 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.75 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 1.0 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 1.25 mg/kg as measured by the amount of the free form of the compound.
- the compound is administered in a daily dose of about 0.25 mg/kg. In some embodiments, the compound is administered in a daily dose of about 0.5 mg/kg. In some embodiments, the compound is administered in a daily dose of about 0.75 mg/kg. In some embodiments, the compound is administered in a daily dose of about 1.0 mg/kg. In some embodiments, the compound is administered in a daily dose of about 1.25 mg/kg. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 1.5 mg/kg or lessas measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 1.25 mg/kg or lessas measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 1.0 mg/kg or lessas measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.75 mg/kg or less as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.5 mg/kg or lessas measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.25 mg/kg or lessas measured by the amount of the free form of the compound. In some embodiments, the compound is administered in a daily dose of about 1.5 mg/kg or less. In some embodiments, the compound is administered in a daily dose of about 1.25 mg/kg or less. In some embodiments, the compound is administered in a daily dose of about 1.0 mg/kg or less. In some embodiments, the compound is administered in a daily dose of about 0.75 mg/kg or less. In some embodiments, the compound is administered in a daily dose of about 0.5 mg/kg or less. In some embodiments, the compound is administered in a daily dose of about 0.25 mg/kg or less.
- the compound, or a pharmaceutically acceptable salt thereof is administered intravenously. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.1 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 0.1 mg/kg to about 1.25 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 1.25 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 0.75 mg/kg as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 0.5 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 0.75 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 1.25 mg/kg as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.25 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.5 mg/kg as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 0.75 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 1.0 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 1.25 mg/kg as measured by the amount of the free form of the compound. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 0.1 mg/kg to about 1.5 mg/kg.
- the compound is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 1.5 mg/kg. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 0.1 mg/kg to about 1.25 mg/kg. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 1.25 mg/kg. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 0.75 mg/kg. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 0.5 mg/kg.
- the compound is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 0.75 mg/kg. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 1.25 mg/kg. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 1.5 mg/kg. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 0.25 mg/kg. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 0.5 mg/kg. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 0.75 mg/kg.
- the compound is administered as an intravenous infusion in a dosage of about 1.0 mg/kg. In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 1.25 mg/kg.
- a method of treating cancer in a patient comprising administering to said patient a compound of Formula (I), or a pharmaceutically acceptable salt thereof, wherein the compound, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 10 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 5 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 10 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 20 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 20 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 20 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 20 mg/m 2 to about 30 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 10 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 10 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 30 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 30 mg/m 2 to about 60 mg/m 2 ⁇ as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 30 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of the compound.
- a method of treating cancer in a patient comprising administering to said patient the compound, wherein the compound is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 .
- the compound is administered in a daily dose of about 10 mg/m 2 to about 100 mg/m 2 .
- the compound is administered in a daily dose of about 5 mg/m 2 to about 80 mg/m 2 .
- the compound is administered in a daily dose of about 10 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of the compound.
- the compound is administered in a daily dose of about 20 mg/m 2 to about 60 mg/m 2 .
- the compound is administered in a daily dose of about 20 mg/m 2 to about 100 mg/m 2 . In some embodiments, the compound is administered in a daily dose of about 20 mg/m 2 to about 45 mg/m 2 . In some embodiments, the compound is administered in a daily dose of about 20 mg/m 2 to about 30 mg/m 2 . In some embodiments, the compound is administered in a daily dose of about 10 mg/m 2 to about 60 mg/m 2 . In some embodiments, the compound is administered in a daily dose of about 10 mg/m 2 to about 45 mg/m 2 . In some embodiments, the compound is administered in a daily dose of about 30 mg/m 2 to about 80 mg/m 2 .
- the compound is administered in a daily dose of about 30 mg/m 2 to about 60 mg/m 2 . In some embodiments, the compound is administered in a daily dose of about 30 mg/m 2 to about 45 mg/m 2 . In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 5 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 10 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 20 mg/m 2 as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 30 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 45 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 60 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, is administered in a daily dose of about 5 mg/m 2 . In some embodiments, the compound is administered in a daily dose of about 10 mg/m 2 .
- the compound is administered in a daily dose of about 20 mg/m 2 . In some embodiments, the compound is administered in a daily dose of about 30 mg/m 2 . In some embodiments, the compound is administered in a daily dose of about 45 mg/m 2 . In some embodiments, the compound is administered in a daily dose of about 60 mg/m 2 . In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 10 mg/m 2 or less as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 20 mg/m 2 or less as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 30 mg/m 2 or less as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 45 mg/m 2 or less as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 60 mg/m 2 or less as measured by the amount of the free form of the compound. In some embodiments, the compound is administered in a daily dose of about 5 mg/m 2 or less. In some embodiments, the compound is administered in a daily dose of about 10 mg/m 2 or less.
- the compound is administered in a daily dose of about 20 mg/m 2 or less. In some embodiments, the compound is administered in a daily dose of about 30 mg/m 2 or less. In some embodiments, the compound is administered in a daily dose of about 45 mg/m 2 or less . In some embodiments, the compound is administered in a daily dose of about 60 mg/m 2 or less. In some embodiments, the compound, or the pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 5 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 30 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of the compound.
- the compound, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of the compound. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of the compound.
- a method of treating cancer in a patient comprising administering to said patient the compound, wherein the compound is administered as an intravenous infusion in a dosage of about 5 mg/m 2 to about 100 mg/m 2 .
- the compound is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 100 mg/m 2 .
- the compound is administered as an intravenous infusion in a dosage of about 5 mg/m 2 to about 80 mg/m 2 .
- the compound is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of the compound.
- the compound is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 60 mg/m 2 . In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 100 mg/m 2 . In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 45 mg/m 2 . In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 30 mg/m 2 . In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 60 mg/m 2 .
- the compound is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 45 mg/m 2 . In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 80 mg/m 2 . In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 60 mg/m 2 . In some embodiments, the compound is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 45 mg/m 2 . In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in a continuous dosing schedule.
- the compound, or a pharmaceutically acceptable salt thereof is administered once weekly. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered in an intermittent dosing schedule comprising one or more cycles, wherein each cycle comprises a first period of consecutive days wherein the compound, or the pharmaceutically acceptable salt thereof, is administered and a second period of consecutive days wherein the compound, or the pharmaceutically acceptable salt thereof, is not administered.
- the total length of each cycle is 7 days to 60 days. In some embodiments, the total length of each cycle is 14 days to 30 days. In some embodiments, the total length of each cycle is 21 days. In some embodiments, the total length of each cycle is 14 days. In some embodiments, the total length of each cycle is 28 days.
- the first period is 6 days and the second period is the remainder of the cycle. In some embodiments, the first period is 5 days and the second period is the remainder of the cycle. In some embodiments, the first period is 4 days and the second period is the remainder of the cycle. In some embodiments, the first period is 3 days and the second period is the remainder of the cycle. In some embodiments, the first period is 2 days and the second period is the remainder of the cycle. In some embodiments, the first period is 1 day and the second period is the remainder of the cycle. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered only on the first day of a cycle that is 21 days.
- the compound, or a pharmaceutically acceptable salt thereof is administered only on the first and the eighth day of a cycle that is 21 days. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered only on the first, eighth, and fifteenth day of a cycle that is 21 days. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered only on the first day of a cycle that is 28 days. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered only on the first and the eighth day of a cycle that is 28 days. In some embodiments, the compound, or a pharmaceutically acceptable salt thereof, is administered only on the first, eighth, and fifteenth day of a cycle that is 28 days.
- the compound, or a pharmaceutically acceptable salt thereof is administered only on the first, eighth, fifteenth, and twenty-second day of a cycle that is 28 days.
- Administration of Compound 1 The present application provides, inter alia, a method of treating cancer in a patient, comprising administering Compound 1, having the structure: Compound 1, or a pharmaceutically acceptable salt thereof, wherein Pv1 is a peptide.
- the present application further provides a method of administering Compound 1, or a pharmaceutically acceptable salt thereof, to a patient in need of treatment, comprising parenterally delivering to said patient Compound 1 having the structure:
- Pv1 is a peptide.
- Compound 1 is described in US Patent Application Publication No. US 2021/009719, the entirety of which is incorporated herein by reference.
- Compound 1 is a peptide conjugate of exatecan, which is a topoisomerase I inhibitor.
- As a peptide conjugate of a topoisomerase I inhibitor Compound 1 is useful in the treatment of various diseases such as cancer.
- Pv1 is a peptide comprising a 10-50 amino acid sequence, made up of naturally-occurring amino acid residues and optionally one or more non- naturally-occurring amino acids.
- Pv1 is a peptide of 20 to 40, 20 to 30 amino acids, or 30 to 40 residues.
- Pv1 is an environmentally sensitive peptide.
- environmentally sensitive peptides are those that can insert across a cell membrane via a conformational change or a change in secondary structure in response to environmental (e.g., pH) changes.
- the peptide is capable of selectively delivering the exatecan moiety across a cell membrane having an acidic or hypoxic mantle having a pH less than about 6.0.
- Pv1 is a peptide comprising the following sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1). In some embodiments, Pv1 is a peptide comprising the following sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1), wherein the sequence contains 1, 2, 3, 4, or 5 amino acid replacements, additions, or deletions.
- Pv1 is an environmentally sensitive peptide comprising the following sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1), wherein the sequence contains 1, 2, 3, 4, or 5 amino acid replacements, additions, or deletions, so long as the peptide retains its environmental sensitivity.
- Pv1 is a peptide consisting essentially of the following sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1).
- Pv1 is a peptide consisting of the following sequence: ADDQNPWRAYLDLLFPTDTLLLDLLWCG (SEQ ID NO: 1).
- a method of treating cancer in a patient comprising administering to said patient Compound 1, or a pharmaceutically acceptable salt thereof, wherein Compound 1, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.1 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.25 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.1 mg/kg to 1.25 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.25 mg/kg to about 1.25 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.25 mg/kg to about 0.75 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.25 mg/kg to about 0.50 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.5 mg/kg to about 0.75 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.5 mg/kg to about 1.25 mg/kg as measured by the amount of the free form of Compound 1.
- a method of treating cancer in a patient comprising administering to said patient Compound 1, wherein Compound 1 is administered in a daily dose of about 0.1 mg/kg to about 1.5 mg/kg. In some embodiments, Compound 1 is administered in a daily dose of about 0.25 mg/kg to about 1.5 mg/kg.
- Compound 1 is administered in a daily dose of about 0.1 mg/kg to 1.25 mg/kg. In some embodiments, Compound 1 is administered in a daily dose of about 0.25 mg/kg to about 1.25 mg/kg. In some embodiments, Compound 1 is administered in a daily dose of about 0.25 mg/kg to about 0.75 mg/kg. In some embodiments, Compound 1 is administered in a daily dose of about 0.25 mg/kg to about 0.50 mg/kg. In some embodiments, Compound 1 is administered in a daily dose of about 0.5 mg/kg to about 0.75 mg/kg. In some embodiments, Compound 1 is administered in a daily dose of about 0.5 mg/kg to about 1.25 mg/kg.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.25 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.5 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.75 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 1.0 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 1.25 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, is administered in a daily dose of about 0.25 mg/kg. In some embodiments, Compound 1 is administered in a daily dose of about 0.5 mg/kg. In some embodiments, Compound 1 is administered in a daily dose of about 0.75 mg/kg. In some embodiments, Compound 1 is administered in a daily dose of about 1.0 mg/kg. In some embodiments, Compound 1 is administered in a daily dose of about 1.25 mg/kg.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 1.5 mg/kg or lessas measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 1.25 mg/kg or lessas measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 1.0 mg/kg or lessas measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.75 mg/kg or less as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 0.5 mg/kg or lessas measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 0.25 mg/kg or lessas measured by the amount of the free form of Compound 1. In some embodiments, Compound 1 is administered in a daily dose of about 1.5 mg/kg or less. In some embodiments, Compound 1 is administered in a daily dose of about 1.25 mg/kg or less. In some embodiments, Compound 1 is administered in a daily dose of about 1.0 mg/kg or less.
- Compound 1 is administered in a daily dose of about 0.75 mg/kg or less. In some embodiments, Compound 1 is administered in a daily dose of about 0.5 mg/kg or less. In some embodiments, Compound 1 is administered in a daily dose of about 0.25 mg/kg or less. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered intravenously. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.1 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.1 mg/kg to about 1.25 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 1.25 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 0.75 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 0.5 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 0.75 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 1.25 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 1.5 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.25 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 0.5 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 0.75 mg/kg as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 1.0 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 1.25 mg/kg as measured by the amount of the free form of Compound 1.
- Compound 1 is administered intravenously.
- Compound 1 is administered as an intravenous infusion.
- Compound 1 is administered as an intravenous infusion in a dosage of about 0.1 mg/kg to about 1.5 mg/kg.
- Compound 1 is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 1.5 mg/kg.
- Compound 1 is administered as an intravenous infusion in a dosage of about 0.1 mg/kg to about 1.25 mg/kg.
- Compound 1 is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 1.25 mg/kg. In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 0.75 mg/kg. In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 0.25 mg/kg to about 0.5 mg/kg. In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 0.75 mg/kg. In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 1.25 mg/kg.
- Compound 1 is administered as an intravenous infusion in a dosage of about 0.5 mg/kg to about 1.5 mg/kg. In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 0.25 mg/kg. In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 0.5 mg/kg. In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 0.75 mg/kg. In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 1.0 mg/kg. In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 1.25 mg/kg.
- a method of treating cancer in a patient comprising administering to said patient Compound 1, or a pharmaceutically acceptable salt thereof, wherein Compound 1, or the pharmaceutically acceptable salt thereof, is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 10 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 5 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 10 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 20 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 20 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 20 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 20 mg/m 2 to about 30 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 10 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 10 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 30 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 30 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 30 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of Compound 1.
- a method of treating cancer in a patient comprising administering to said patient Compound 1, wherein Compound 1 is administered in a daily dose of about 5 mg/m 2 to about 100 mg/m 2 .
- Compound 1 is administered in a daily dose of about 10 mg/m 2 to about 100 mg/m 2 .
- Compound 1 is administered in a daily dose of about 5 mg/m 2 to about 80 mg/m 2 .
- Compound 1 is administered in a daily dose of about 10 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1 is administered in a daily dose of about 20 mg/m 2 to about 60 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 20 mg/m 2 to about 100 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 20 mg/m 2 to about 45 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 20 mg/m 2 to about 30 mg/m 2 .
- Compound 1 is administered in a daily dose of about 10 mg/m 2 to about 60 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 10 mg/m 2 to about 45 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 30 mg/m 2 to about 80 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 30 mg/m 2 to about 60 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 30 mg/m 2 to about 45 mg/m 2 .
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 5 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 10 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 20 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 30 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 45 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 60 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, is administered in a daily dose of about 5 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 10 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 20 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 30 mg/m 2 .
- Compound 1 is administered in a daily dose of about 45 mg/m 2 . In some embodiments, Compound 1 is administered in a daily dose of about 60 mg/m 2 . In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 10 mg/m 2 or less as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 20 mg/m 2 or less as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 30 mg/m 2 or less as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in a daily dose of about 45 mg/m 2 or less as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a daily dose of about 60 mg/m 2 or less as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, is administered in a daily dose of about 5 mg/m 2 or less. In some embodiments, Compound 1 is administered in a daily dose of about 10 mg/m 2 or less. In some embodiments, Compound 1 is administered in a daily dose of about 20 mg/m 2 or less. In some embodiments, Compound 1 is administered in a daily dose of about 30 mg/m 2 or less.
- Compound 1 is administered in a daily dose of about 45 mg/m 2 or less . In some embodiments, Compound 1 is administered in a daily dose of about 60 mg/m 2 or less. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered intravenously. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion. In some embodiments, Compound 1, or the pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 5 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 5 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 100 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 30 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 60 mg/m 2 as measured by the amount of the free form of Compound 1. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 45 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1 is administered as an intravenous infusion in a dosage of about 5 mg/m 2 to about 100 mg/m 2 .
- Compound 1 is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 100 mg/m 2 .
- Compound 1 is administered as an intravenous infusion in a dosage of about 5 mg/m 2 to about 80 mg/m 2 .
- Compound 1 is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 80 mg/m 2 as measured by the amount of the free form of Compound 1.
- Compound 1 is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 60 mg/m 2 . In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 100 mg/m 2 . In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 45 mg/m 2 . In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 20 mg/m 2 to about 30 mg/m 2 . In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 60 mg/m 2 .
- Compound 1 is administered as an intravenous infusion in a dosage of about 10 mg/m 2 to about 45 mg/m 2 . In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 80 mg/m 2 . In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 60 mg/m 2 . In some embodiments, Compound 1 is administered as an intravenous infusion in a dosage of about 30 mg/m 2 to about 45 mg/m 2 . In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in a continuous dosing schedule.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered once weekly. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered in an intermittent dosing schedule comprising one or more cycles, wherein each cycle comprises a first period of consecutive days wherein Compound 1, or the pharmaceutically acceptable salt thereof, is administered and a second period of consecutive days wherein Compound 1, or the pharmaceutically acceptable salt thereof, is not administered.
- the total length of each cycle is 7 days to 60 days. In some embodiments, the total length of each cycle is 14 days to 30 days. In some embodiments, the total length of each cycle is 21 days. In some embodiments, the total length of each cycle is 14 days. In some embodiments, the total length of each cycle is 28 days.
- the first period is 6 days and the second period is the remainder of the cycle. In some embodiments, the first period is 5 days and the second period is the remainder of the cycle. In some embodiments, the first period is 4 days and the second period is the remainder of the cycle. In some embodiments, the first period is 3 days and the second period is the remainder of the cycle. In some embodiments, the first period is 2 days and the second period is the remainder of the cycle. In some embodiments, the first period is 1 day and the second period is the remainder of the cycle. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered only on the first day of a cycle that is 21 days.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered only on the first and the eighth day of a cycle that is 21 days. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered only on the first, eighth, and fifteenth day of a cycle that is 21 days. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered only on the first day of a cycle that is 28 days. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered only on the first and the eighth day of a cycle that is 28 days. In some embodiments, Compound 1, or a pharmaceutically acceptable salt thereof, is administered only on the first, eighth, and fifteenth day of a cycle that is 28 days.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered only on the first, eighth, fifteenth, and twenty-second day of a cycle that is 28 days.
- the recited dosage is expressed in terms of a patient’s body weight and is provided in units of mg/kg (e.g., amount of the compound to be administered divided by the patient’s body weight).
- the recited dosage is expressed in terms of a patient’s body surface area and is provided in units of mg/m 2 (e.g., amount of the compound to be administered divided by the patient’s body surface area squared).
- a patient’s body surface area can be calculated using methods and formulae known to those of ordinary skilly in the art.
- a patient’s body surface area can be calculated using the 1987 formula published by Mosteller (Mosteller RD. Simplified calculation of body- surface area. N Engl J Med.1987; 317(17):1098).
- Example cancers that are treatable using the disclosed methods are ovarian cancer, small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), breast cancer, gastric cancer, esophageal cancer, colorectal cancer, pancreatic cancer, urothelial cancer, and sarcoma. Further examples of cancers that are treatable using the disclosed methods are appendiceal cancer and osteosarcoma.
- cancers treatable with methods of the present disclosure include bladder cancer, bone cancer, glioma, breast cancer (e.g., triple-negative breast cancer), cervical cancer, colon cancer, colorectal cancer, endometrial cancer, epithelial cancer, esophageal cancer, Ewing's sarcoma, pancreatic cancer, gallbladder cancer, gastric cancer, gastrointestinal tumors, head and neck cancer (upper aerodigestive cancer), intestinal cancers, Kaposi's sarcoma, kidney cancer, laryngeal cancer, liver cancer (e.g., hepatocellular carcinoma), lung cancer (e.g., non-small cell lung cancer, adenocarcinoma), melanoma, prostate cancer, rectal cancer, renal clear cell carcinoma, skin cancer, stomach cancer, testicular cancer, thyroid cancer, and uterine cancer.
- breast cancer e.g., triple-negative breast cancer
- cervical cancer e.g., cervical cancer, colon cancer
- colorectal cancer endometrial cancer
- cancers treatable with methods of the present disclosure include melanoma (e.g., metastatic malignant melanoma), renal cancer (e.g. clear cell carcinoma), prostate cancer (e.g. hormone refractory prostate adenocarcinoma), breast cancer, triple-negative breast cancer, colon cancer and lung cancer (e.g. non-small cell lung cancer and small cell lung cancer). Additionally, the disclosure includes refractory or recurrent malignancies whose growth may be inhibited using Compound 1 or another compound of the disclosure.
- melanoma e.g., metastatic malignant melanoma
- renal cancer e.g. clear cell carcinoma
- prostate cancer e.g. hormone refractory prostate adenocarcinoma
- breast cancer triple-negative breast cancer
- colon cancer e.g. non-small cell lung cancer and small cell lung cancer
- lung cancer e.g. non-small cell lung cancer and small cell lung cancer.
- the disclosure includes refractory or recurrent malignancies
- cancers that are treatable using the methods of the present disclosure include, but are not limited to, solid tumors (e.g., prostate cancer, colon cancer, esophageal cancer, endometrial cancer, ovarian cancer, uterine cancer, renal cancer, hepatic cancer, pancreatic cancer, gastric cancer, breast cancer, lung cancer, cancers of the head and neck, thyroid cancer, glioblastoma, sarcoma, bladder cancer, etc.), hematological cancers (e.g., lymphoma, leukemia such as acute lymphoblastic leukemia (ALL), acute myelogenous leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), DLBCL, mantle cell lymphoma, Non-Hodgkin lymphoma (including relapsed or refractory NHL and recurrent follicular), Hodgkin lymphoma or multiple myeloma) and combinations
- the compounds of the disclosure can exhibit certain therapeutic advantages over a topoisomerase I inhibitor itself.
- administration of a compound of the disclosure can show reduced toxicity (e.g., bone marrow or gastric toxicity) as compared with administration of the corresponding topoisomerase I inhibitor (e.g., exatecan).
- the bone marrow toxicity is measured by total bone marrow count from samples of the subject (e.g., total bone marrow count in femurs of a mouse).
- bone marrow toxicity is measured by PARylation in bone marrow tissue.
- bone marrow toxicity is measured according to total nucleated bone marrow cells.
- gastric toxicity is assessed using photographs of the stomachs of the subject (e.g., a mouse) taken both in situ and ex vivo.
- Compound 1 can exhibit certain therapeutic advantages over a topoisomerase I inhibitor itself.
- administration of Compound 1 can show reduced toxicity (e.g., bone marrow or gastric toxicity) as compared with administration of the corresponding topoisomerase I inhibitor (e.g., exatecan).
- the bone marrow toxicity is measured by total bone marrow count from samples of the subject (e.g., total bone marrow count in femurs of a mouse).
- bone marrow toxicity is measured by PARylation in bone marrow tissue.
- bone marrow toxicity is measured according to total nucleated bone marrow cells.
- gastric toxicity is assessed using photographs of the stomachs of the subject (e.g., a mouse) taken both in situ and ex vivo.
- the cancer is refractory.
- the patient has failed at least one previous treatment for cancer.
- the previous treatment for cancer can include, for example, a chemotherapeutic agent, a targeted cancer therapy, an immunotherapy or radiation therapy.
- the chemotherapeutic agent of a previous treatment can include any exemplary chemotherapeutic agent listed herein.
- a compound of Formula (I), or a pharmaceutically acceptable salt thereof is administered in combination with an additional therapy.
- the additional therapy can include, for example, a chemotherapeutic agent, a targeted cancer therapy, an immunotherapy or radiation therapy.
- Compound 1, or a pharmaceutically acceptable salt thereof is administered in combination with an additional therapy.
- the additional therapy can include, for example, a chemotherapeutic agent, a targeted cancer therapy, an immunotherapy or radiation therapy.
- chemotherapeutic agents include, for example, alkylating agents (including, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes) such as uracil mustard, chlormethine, cyclophosphamide (CytoxanTM), ifosfamide, melphalan, chlorambucil, pipobroman, triethylene-melamine, triethylenethio ⁇ phosphoramine, busulfan, carmustine, lomustine, streptozocin, dacarbazine, and temozolomide.
- alkylating agents including, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazenes
- alkylating agents including, without limitation, nitrogen mustards, ethylenimine derivatives, alkyl sulfonates, nitrosoureas and triazene
- chemotherapeutic agents include: dacarbazine (DTIC), optionally, along with other chemotherapy drugs such as carmustine (BCNU) and cisplatin; the “Dartmouth regimen,” which consists of DTIC, BCNU, cisplatin and tamoxifen; a combination of cisplatin, vinblastine, and DTIC; or temozolomide.
- DTIC dacarbazine
- BCNU carmustine
- cisplatin the “Dartmouth regimen,” which consists of DTIC, BCNU, cisplatin and tamoxifen
- a combination of cisplatin, vinblastine, and DTIC or temozolomide.
- chemotherapeutic agents include: immunotherapy drugs, including cytokines such as interferon alpha, interleukin 2, and tumor necrosis factor (TNF).
- chemotherapeutic agents include, for example, antimetabolites (including, without limitation, folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors) such as methotrexate, 5-fluorouracil, floxuridine, cytarabine, 6- mercaptopurine, 6-thioguanine, fludarabine phosphate, pentostatine, and gemcitabine.
- antimetabolites including, without limitation, folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors
- methotrexate including, without limitation, folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors
- methotrexate including, without limitation, folic acid antagonists, pyrimidine analogs, purine analogs and adenosine deaminase inhibitors
- methotrexate
- chemotherapeutic agents include, for example, certain natural products and their derivatives (for example, vinca alkaloids, antitumor antibiotics, enzymes, lymphokines and epipodophyllotoxins) such as vinblastine, vincristine, vindesine, bleomycin, dactino-mycin, daunorubicin, doxorubicin, epirubicin, idarubicin, ara-C, paclitaxel (TAXOLTM), mithramycin, deoxycoformycin, mitomycin-C, L-asparaginase, interferons (especially IFN-a), etoposide, and teniposide.
- certain natural products and their derivatives for example, vinca alkaloids, antitumor antibiotics, enzymes, lymphokines and epipodophyllotoxins
- vinblastine vincristine, vindesine
- bleomycin dactino-mycin
- daunorubicin daunorubicin
- chemotherapeutic agents include, for example, navelbene, CPT-11, anastrazole, letrazole, capecitabine, reloxafine, cyclophosphamide, ifosamide, and droloxafine.
- Further chemotherapeutic agents include, for example, epidophyllotoxin; an antineoplastic enzyme; a topoisomerase inhibitor; procarbazine; mitoxantrone; platinum coordination complexes such as cis-platin and carboplatin; biological response modifiers; growth inhibitors; antihormonal therapeutic agents; leucovorin; tegafur; and haematopoietic growth factors.
- chemotherapeutic agents include antibody therapeutics such as trastuzumab (Herceptin), antibodies to costimulatory molecules such as CTLA-4, 4-1BB and PD-1, or antibodies to cytokines (IL-10, TGF- ⁇ , etc.). Further chemotherapeutic agents include those that block immune cell migration such as antagonists to chemokine receptors, including CCR2 and CCR4.
- chemotherapeutic agents include chemotherapy combinations such as platinum-based doublets used in lung cancer and other solid tumors (cisplatin or carboplatin plus gemcitabine; cisplatin or carboplatin plus docetaxel; cisplatin or carboplatin plus paclitaxel; cisplatin or carboplatin plus pemetrexed) or gemcitabine plus paclitaxel bound particles (Abraxane®).
- chemotherapy combinations such as platinum-based doublets used in lung cancer and other solid tumors (cisplatin or carboplatin plus gemcitabine; cisplatin or carboplatin plus docetaxel; cisplatin or carboplatin plus paclitaxel; cisplatin or carboplatin plus pemetrexed) or gemcitabine plus paclitaxel bound particles (Abraxane®).
- treating includes the administration of a compound or composition which reduces the frequency of, delays the onset of, or reduces the progression of symptoms of a disease involving acidic or hypoxic diseased tissue, such as cancer, stroke, myocardial infarction, or long-term neurodegenerative disease, in a subject relative to a subject not receiving the compound or composition.
- This can include reversing, reducing, or arresting the symptoms, clinical signs, or underlying pathology of a condition in a manner to improve or stabilize a subject's condition (e.g., regression of tumor growth, for cancer or decreasing or ameliorating myocardial ischemia reperfusion injury in myocardial infarction, stroke, or the like cardiovascular disease).
- inhibiting or “reducing” are used for cancer in reference to methods to inhibit or to reduce tumor growth (e.g., decrease the size of a tumor) in a population as compared to an untreated control population.
- pharmaceutically acceptable is employed herein to refer to those compounds, materials, compositions and/or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
- the present invention also includes pharmaceutically acceptable salts of the compounds described herein.
- pharmaceutically acceptable salts refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form.
- examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like.
- the pharmaceutically acceptable salts of the present invention include the non-toxic salts of the parent compound formed, e.g., from non-toxic inorganic or organic acids.
- the pharmaceutically acceptable salts of the present invention can be synthesized from the parent compound which contains a basic or acidic moiety by conventional chemical methods.
- such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, non-aqueous media like ether, ethyl acetate, alcohols (e.g., methanol, ethanol, iso-propanol or butanol) or acetonitrile (MeCN) are preferred.
- non-aqueous media like ether, ethyl acetate, alcohols (e.g., methanol, ethanol, iso-propanol or butanol) or acetonitrile (MeCN) are preferred.
- suitable salts are found in Remington's Pharmaceutical Sciences, 17 th Ed., (Mack Publishing Company, Easton, 1985), p.1418, Berge et al., J. Pharm.
- Phase 1 is the dose-escalation portion of the study in which the safety and tolerability of two dosing schedules of Compound 1 will be evaluated.
- Subjects in Part A are treated with Compound 1 daily, 5 times per week every 3 weeks (Schedule A, i.e., 5 days on, 16 days off. Cycle length is 3 weeks).
- a 3 + 3 design is utilized.
- the initial cohorts in Phase 1 will enroll a single subject.
- Single-subject cohorts will be enrolled until a subject has a Grade 2 Adverse Event (AE) considered possibly related to Compound 1 during the dose-limiting toxicity (DLT) period (i.e., the subject’s initial 3-week cycle), at which time 2 additional subjects will be enrolled in that cohort, and a 3 + 3 design will subsequently be utilized.
- AE Grade 2 Adverse Event
- Dose escalations of up to 100% of the prior dose are permitted until the occurrence of a Grade 2 AE considered possibly related to Compound 1 during the DLT period. Subsequent dose escalations may be no more than 50% of the prior dose.
- cohorts of three subjects will enroll at a dose level. If none of the three subjects experience a DLT, the dose will be escalated to the next highest dose level. If one of the three initial subjects in a cohort experiences a DLT, up to three additional subjects will be enrolled and treated at the same dose. If none of the additional three subjects experience a DLT (i.e., only 1 of 6 subjects in the cohort has a DLT), the dose will be escalated to the next highest level.
- MTD maximum tolerated dose
- Phase 1 Part B Subjects in Phase 1 Part B will be treated with Compound 1 daily, three times per week every 3 weeks schedule (Schedule B, i.e., 3 days on, 18 days off. Cycle length is 3 weeks).
- the first cohort in Part B may open for accrual.
- the initial dose in Part B will be determined based on the safety and tolerability of Part A subjects to that point. If the maximum grade of AEs related to Compound 1 in Part A is Grade 2, then the Dose Level 1 in Part B will be chosen so that the total dose in the new cohort in Part A and the initial cohort in Part B will deliver the same weekly total of Compound 1, as shown in Table 1.
- Subjects are considered evaluable for DLTs if in Part A, they receive at least four of the planned five daily doses in Cycle 1 and in Part B if they receive two of the planned three daily doses in Cycle 1 and are evaluable for safety through the 3-week DLT period or have had a DLT.
- Study subjects who are not evaluable for safety throughout the DLT period for reasons other than Compound 1 related toxicity will be replaced in the same dose cohort.
- Part A and Part B after all subjects in a cohort have completed treatment through the DLT period or discontinued treatment due to a DLT, all available safety data will be reviewed, including DLTs and all available PK data for that cohort and make dose-level recommendations.
- a recommended Phase II dose will be determined for each schedule, as the MTD or a biologically active dose below the MTD. If an unequivocally biologically active (i.e., leading to confirmed responses) and tolerable dose is reached prior to the MTD, additional dose escalations may be stopped prior to defining an MTD. A minimum of six subjects will be evaluated at the RP2D in each of Part A and Part B. Once the RP2D has been established in both Part A and Part B, Phase 2 expansion cohorts may open.
- One or both schedules may be taken forward into Phase 2.
- One expansion cohort will enroll subjects with platinum- refractory epithelial ovarian cancer (including primary peritoneal and fallopian tube cancer) and one expansion cohort will enroll subjects with platinum-resistant SCLC.
- the protocol may be amended to include additional expansion cohorts based on emerging activity signals from Phase 1 or in tumor types in which topoisomerase 1 inhibitors have demonstrated efficacy.
- the subject will receive treatment with Compound 1 and be monitored for safety and disease status by AE assessment, physical examination, laboratory tests, radiologic assessment, and ECG. PK and biomarker samples will be collected.
- Dose-Limiting Toxicity DLTs will be assessed for all subjects enrolled in Phase 1 through their initial 3-week cycle of treatment (Cycle 1, the DLT period). Any AE occurring during the DLT period deemed at least possibly related to Compound 1 and meeting the criteria below will be designated a DLT. If intra-subject dose escalation for a subject is recommended and toxicity is observed upon escalation, this will not be considered a DLT, as it did not occur during the subject’s initial 3-week cycle. This will, however, be considered in the SRC’s subsequent dose-level recommendations.
- Non-hematologic DLTs x Any Grade 5 AE x Any Grade 4 AE other than electrolyte abnormalities that are asymptomatic and that resolve without clinical sequelae to ⁇ Grade 2 within 2 days with or without medical management x - Grade 3 aspartate aminotransferase (AST) and bilirubin > 2x the upper limit of normal (ULN) (and >35% direct bilirubin) without evidence of biliary obstruction x
- Any other Grade 3 non-hematologic AE with the following exceptions: - Grade 3 AST or alanine aminotransferase (ALT) that resolves to Grade 2 within 3 days - Grade 3 nausea, vomiting, diarrhea, or mucositis that occurs without optimal prophylaxis or resolves with or without medical management to Grade 2 within 3 days - Grade 3 rash that resolves with or without medical management to Grade 2 within 3 days - Grade 3 fever that is uncomplicated and without clinical sequelae that resolves to Grade 2 within 3 days - Grade 3 electro
- Subject has a histologically- or cytologically-diagnosed solid tumor which is advanced or metastatic and which has progressed on or following at least one systemic therapy regimen administered for advanced or metastatic disease or for which no approved therapy exists.
- Subject’s prior treatment should include all approved regimens that have demonstrated a survival advantage for the subject’s disease, stage, and line of therapy.
- Phase 1 preference will be given to subjects with the following tumor types: • Ovarian cancer • SCLC • Non-small cell lung cancer (NSCLC) • Hormone-receptor positive (HR+)/HER2 negative (HER2-) breast cancer • Gastric cancer • Esophageal cancer • Colorectal cancer • Pancreas Cancer • Urothelial cancer • Sarcoma • Tumors with a BRCA1 or BRCA2 mutation However, subjects with other solid tumors meeting eligibility are not excluded. In Phase 2 expansion cohorts, subjects with epithelial ovarian cancer or SCLC must have disease progression or recurrence within 6 months of their last dose of platinum chemotherapy. 2. Age 18 years at the time of signing the informed consent form (ICF) 3. Has measurable disease per RECIST 1.1 4.
- ICF informed consent form
- An adequate tumor sample must be available from core needle biopsies or an incisional or excisional biopsy obtained during the Screening Period and following the subject’s most recent systemic therapy.
- Previously obtained archival samples may be approved by the Medical Monitor for this inclusion criterion if the samples were taken following the most recent systemic therapy.
- the biopsy may not be from a previously irradiated lesion unless there has been disease progression in that lesion following the radiation therapy.
- the minimum adequate tumor sample is defined as the equivalent amount of tumor from approximately 3 core needle biopsies, with tissue from 4 to 5 cores being optimal. 5. Agrees to an on-treatment biopsy preferably of the same lesion from which the pre-Compound 1-treatment sample was obtained as long as the Investigator determines such biopsy can be performed with acceptable safety.
- a lesion from which 3 to 5 core biopsies can be obtained should be identified during the Screening Period. 6. Has provide written informed consent 7. ECOG Performance Status of 0 or 1 8. Adequate liver, renal, hematologic, pulmonary and coagulation function as follows a. Bilirubin ⁇ 1.5x ULN b. AST (SGOT), ALT (SGPT) d3.0x ULN c. Serum creatinine ⁇ 1.5 x ULN and/or an estimated creatinine clearance of ⁇ 60 ml/min based on the Cockcroft-Gault formula d. Absolute neutrophil count t1500/mm 3 e. Platelet count t100,000/mm 3 f. Hemoglobin t9 g/dL.
- Transfusion is permitted to meet this eligibility criterion g. International normalized ratio (INR) ⁇ 1.5x ULN and activated partial thromboplastin time (aPTT) ⁇ 1.5x ULN.
- INR International normalized ratio
- aPTT activated partial thromboplastin time
- Study subjects on therapeutic doses of anticoagulation medication must have INR and/or aPTT ⁇ the upper limit of the therapeutic range for intended use h .
- O 2 saturation > 90% on room air i. Serum potassium, magnesium, and calcium or ionized calcium ⁇ LLN within 3 days of the first dose of Compound 1.
- Subjects may receive supplementation to meet this eligibility criterion.
- a negative serum pregnancy test for women of child-bearing potential) during Screening and a negative serum or urine pregnancy test on Cycle 1 Day 1 prior to the first dose of Compound 1 10.
- Women of child-bearing potential must agree to use highly effective contraceptive methods and avoid egg donation or preservation during the study treatment and for 4 months after the last dose of Compound 1.
- a woman is considered to be of child- bearing potential unless she: a. has had a hysterectomy, bilateral tubal occlusion, or bilateral oophorectomy; b. is age ⁇ 60 years and is amenorrhoeic; or c.
- the interval may be reduced to 2 weeks for bone-only radiation therapy or investigational agents not expected to be associated with AEs after 2 weeks of last administration, with Medical Monitor approval.
- Small-molecule kinase inhibitors or hormonal agents ⁇ 14 days prior to the first dose of Compound 1 3.
- Subjects who are currently receiving any other anti-cancer or investigational agent(s) 5.
- Major surgery ⁇ 4 weeks or minor surgery ⁇ 14 days prior to the first dose of Compound 1.
- Adequate wound healing is required.
- Clinically significant intercurrent disease including but not limited to: a.
- New York Heart Association Class III or IV heart failure b. Myocardial infarction or stroke d26 weeks prior to the first dose of Compound 1 c. Unstable angina within d13 weeks prior to the first dose of Compound 1 unless the underlying disease has been corrected by procedural intervention (e.g. stent, bypass) and the subject has been angina-free for 4 weeks prior to the first dose of Compound 1 d. Severe aortic stenosis e. Uncontrolled arrhythmia. Medical Monitor approval of subjects with any documented arrhythmia is required f.
- QTc > 450 milliseconds by Fredericia criteria (QTcF) during Screening based on the average of 3 QTcF readings from 3 ECGs obtained 1 to 2 minutes apart and all within 10 minutes g.
- Clinically significant active infection requiring systemic antibiotic, antiviral or antifungal medication.
- Subjects must be medically stable, afebrile and not taking antimicrobial treatment for t3 days prior to the first dose of Compound 1 (excluding subjects with uncomplicated urinary tract or upper respiratory tract infections).
- h Ongoing inflammatory diseases or process that could result in a low pH tissue environment other than the tumor microenvironment unless approved by the Medical Monitor. 7.
- Brain metastases are considered stable if there is no progression when comparing brain MRI or CT scans obtained within 2 weeks prior to the planned first dose of Compound 1 to those obtained at least 4 weeks prior and the subject has not required doses of steroids equivalent to prednisone >10 mg daily, increasing doses of steroids, or other treatment to control brain metastases between the scans.
- Subjects taking medications know to prolong the QT interval or associated with torsades de pointes unless the subject can safely discontinue these medications or change to comparable medications that do not significantly prolong the QT interval at least 5 half-lives or 7 days (whichever is longer) prior to the first dose of Compound 1 9.
- Known history of HIV infection 12. Active hepatitis B or C infection 13. A history of another malignancy, unless potentially curative treatment has been performed. 14.
- Subjects must discontinue treatment with Compound 1 for any of the following reasons: x Subject requests to stop study treatment. x Intolerable AEs which, in the opinion of the Investigator, indicate that continued study treatment is not in the best interest of the subject. x Intercurrent illness such that continued study treatment would put the subject at unacceptable risk or that impacts their ability to continue to comply with study requirements or freely provide informed consent. x Non-compliance with study drug treatment or protocol requirements eg, failure to attend study visits. x Use of unacceptable concomitant medication eg, non-protocol anti-cancer medications. x Female subjects who become pregnant or are breastfeeding. x Protocol-specified reasons for treatment discontinuation.
- Compound 1 is aseptically manufactured as a lyophilized powder cake (target dose 20 mg/vial, with each vial containing 21.5 mg of active to account for overage) created from a sterile-filtered solution.
- the product is intended to be reconstituted with Water for Injection (WFI) (5.0 mL per vial used), then transferred to an infusion bag for dilution.
- WFI Water for Injection
- Preliminary Results Compound 1 was administered as a 1-hour IV infusion.
- the first patient on study was treated with a starting dose of 0.25 mg/kg, which was dosed daily five times a week every 3 weeks (Schedule A).
- an accelerated dose tritation was utilized, wherein single patient cohorts were accrued and the dose was escalated up to 100% for each new cohort until the occurrence of Grade 2 or greater treatment-related adverse events (TRAEs).
- a single patient was accrued to Cohort A1 (0.25 mg/kg).
- the dose was doubled to 0.5 mg/kg for Cohort A2, and 3 patients were accrued to this cohort due to the occurrence of greater than Grade 2 level adverse events.
- Findings from the initial four patients on Schedule A were: x
- the half-life of Compound 1 was about 20 hours, which was longer than the predicted half-life (about 8 hours), leading to significant accumulation with five consecutive days of dosing x
- Dosing on a mg/kg basis led to large variation in doses administered in a cohort (e.g., in one instance, one patient received more than twice the dose of another patient in the same cohort).
- one patient with ovarian cancer had a partial response (PR) noted after Cycle 1.
- PR partial response
- the patient’s dose was reduced for Cycle 2 and restaging demonstrated a complete response (CR) and normalization of CA-125 biomarker levels.
- Schedule A shows the mean plasma levels of Compound 1 and exatecan (Cohort A) at 1 day.
- FIG.1B shows the mean plasma levels of Compound 1 and exatecan (Cohort A) at 4 days.
- FIG.2A shows the mean plasma levels of Compound 1 and exatecan (Cohort B) at 1 day.
- FIG.2B shows the mean plasma levels of Compound 1 and exatecan (Cohort B) at 3 days.
- the following table summarizes the status of patients enrolled to Schedule B and Schedule C.
- CR Complete Response
- SD Stable Disease
- PR Partial Response
- PD Progressive Disease
- PE Pending Evaluation
- NE Not Evaluable
- Patient 2-5 was a breast cancer patient with multiple lines of prior therapy including the topoisomerase inhibitor trastuzumab deruxtecan from 28 months before disease progression on this therapy. After 4 cycles on Compound 1 the patient demonstrated stable disease.
- Patient 2-6 was a breast cancer patient having a large chest wall lesion, causing pain. Two cycles of Compound 1 demonstrated a 20% decrease (from pretreatment) in the chest wall lesion, resolution of pain, and decrease in numerous non-target lesions.
- Patient 1-9 (Cohort B3) was a colorectal cancer patient with prior therapy including the irinotecan-containing regiment of FOLFIRI + bevacizumab. The investigator reported a 16% reduction in target lesions after two cycles of Compound 1 treatment and resolution of bowel symptoms.
- Patient 3-1 (Cohort B3) was a colorectal cancer patient with prior therapy including two lines of irinotecan-containing regimens (FOLFURI + bevacizumab; FOLFIRINOX + bevacizumab).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Molecular Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Dermatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2023566472A JP2024516825A (ja) | 2021-04-29 | 2022-04-28 | トポイソメラーゼi阻害剤のペプチドコンジュゲートの投与レジメン |
| EP22724607.1A EP4329817A1 (en) | 2021-04-29 | 2022-04-28 | Dosing regimens of peptide conjugates of topoisomerase i inhibitors |
| CN202280044027.3A CN117897175A (zh) | 2021-04-29 | 2022-04-28 | 拓扑异构酶i抑制剂的肽缀合物的给药方案 |
| CA3218253A CA3218253A1 (en) | 2021-04-29 | 2022-04-28 | Dosing regimens of peptide conjugates of topoisomerase i inhibitors |
| AU2022267389A AU2022267389A1 (en) | 2021-04-29 | 2022-04-28 | Dosing regimens of peptide conjugates of topoisomerase i inhibitors |
| KR1020237040934A KR20240019097A (ko) | 2021-04-29 | 2022-04-28 | 토포이소머라아제 i 억제제의 펩타이드 접합체 투여 요법 |
| US18/288,650 US20240226308A1 (en) | 2021-04-29 | 2022-04-28 | Dosing regimens of peptide conjugates of topoisomerase i inhibitors |
| IL308052A IL308052A (en) | 2021-04-29 | 2022-04-28 | Topoisomerase I inhibitor conjugate peptide dose transmitters |
| MX2023012779A MX2023012779A (es) | 2021-04-29 | 2022-04-28 | Regimenes de dosificacion de conjugados de peptido de inhibidores de topoisomerasa i. |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163181640P | 2021-04-29 | 2021-04-29 | |
| US63/181,640 | 2021-04-29 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022232808A1 true WO2022232808A1 (en) | 2022-11-03 |
Family
ID=81749580
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/071967 Ceased WO2022232808A1 (en) | 2021-04-29 | 2022-04-28 | Dosing regimens of peptide conjugates of topoisomerase i inhibitors |
Country Status (12)
| Country | Link |
|---|---|
| US (1) | US20240226308A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4329817A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024516825A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20240019097A (cg-RX-API-DMAC7.html) |
| CN (1) | CN117897175A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2022267389A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3218253A1 (cg-RX-API-DMAC7.html) |
| CL (1) | CL2023003187A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL308052A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2023012779A (cg-RX-API-DMAC7.html) |
| TW (1) | TW202308696A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2022232808A1 (cg-RX-API-DMAC7.html) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025186213A1 (en) | 2024-03-04 | 2025-09-12 | Debiopharm International S.A. | Combination of a wee1 inhibitor and a topoisomerase 1 inhibitor |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| MX2022000449A (es) | 2019-07-10 | 2022-04-25 | Cybrexa 2 Inc | Conjugados peptídicos de citotoxinas como terapéuticos. |
| US11555019B2 (en) | 2019-07-10 | 2023-01-17 | Cybrexa 3, Inc. | Peptide conjugates of microtubule-targeting agents as therapeutics |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8076451B2 (en) | 2005-01-18 | 2011-12-13 | Board Of Governors For Higher Education, State Of Rhode Island And Providence Plantations | Selective delivery of molecules into cells or marking of cells in diseased tissue regions using environmentally sensitive transmembrane peptide |
| US9289508B2 (en) | 2010-07-13 | 2016-03-22 | University Of Rhode Island | Environmentally sensitive compositions and methods of use in the treatment and diagnosis of tumors |
| US20190209580A1 (en) | 2018-01-05 | 2019-07-11 | Cybrexa, Inc. | Compounds, compositions, and methods for treatment of diseases involving acidic or hypoxic diseased tissues |
| US20210009719A1 (en) | 2019-07-10 | 2021-01-14 | Cybrexa 2, Inc. | Peptide conjugates of cytotoxins as therapeutics |
-
2022
- 2022-04-28 CN CN202280044027.3A patent/CN117897175A/zh active Pending
- 2022-04-28 CA CA3218253A patent/CA3218253A1/en active Pending
- 2022-04-28 MX MX2023012779A patent/MX2023012779A/es unknown
- 2022-04-28 TW TW111116202A patent/TW202308696A/zh unknown
- 2022-04-28 AU AU2022267389A patent/AU2022267389A1/en active Pending
- 2022-04-28 EP EP22724607.1A patent/EP4329817A1/en active Pending
- 2022-04-28 IL IL308052A patent/IL308052A/en unknown
- 2022-04-28 JP JP2023566472A patent/JP2024516825A/ja active Pending
- 2022-04-28 US US18/288,650 patent/US20240226308A1/en active Pending
- 2022-04-28 WO PCT/US2022/071967 patent/WO2022232808A1/en not_active Ceased
- 2022-04-28 KR KR1020237040934A patent/KR20240019097A/ko active Pending
-
2023
- 2023-10-25 CL CL2023003187A patent/CL2023003187A1/es unknown
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8076451B2 (en) | 2005-01-18 | 2011-12-13 | Board Of Governors For Higher Education, State Of Rhode Island And Providence Plantations | Selective delivery of molecules into cells or marking of cells in diseased tissue regions using environmentally sensitive transmembrane peptide |
| US9289508B2 (en) | 2010-07-13 | 2016-03-22 | University Of Rhode Island | Environmentally sensitive compositions and methods of use in the treatment and diagnosis of tumors |
| US20190209580A1 (en) | 2018-01-05 | 2019-07-11 | Cybrexa, Inc. | Compounds, compositions, and methods for treatment of diseases involving acidic or hypoxic diseased tissues |
| US20210009719A1 (en) | 2019-07-10 | 2021-01-14 | Cybrexa 2, Inc. | Peptide conjugates of cytotoxins as therapeutics |
Non-Patent Citations (17)
| Title |
|---|
| "Remington's Pharmaceutical Sciences", 1985, MACK PUBLISHING COMPANY, pages: 1418 |
| BERGE ET AL., PHARM. SET., vol. 66, no. 1, 1977, pages 1 - 19 |
| CHANG ET AL., PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 110, no. 36, 2013, pages E3445 - E3454 |
| DOUGHERTY ET AL., CHEMICAL REVIEWS, vol. 119, no. 17, 2019, pages 10241 - 10287 |
| DOUGHERTY ET AL., JOURNAL OF MEDICINAL CHEMISTRY, vol. 62, no. 22, 2019, pages 10098 - 10107 |
| GUERLAVAIS ET AL., ANNUAL REPORTS IN MEDICINAL CHEMISTRY, vol. 49, 2014, pages 331 - 345 |
| KUMAZAWA, E., CANCER CHEMOTHER PHARMACOL, vol. 42, 1998, pages 210 - 220 |
| LEGARZA KATHLEEN ET AL: "NOVEL CAMPTOTHECIN DERIVATIVES", IN VIVO: INTERNATIONAL JOURNAL OF EXPERIMENTAL AND CLINICAL PATHOPHYSIOLOGY AND DRUG RESEARCH, INTERNATIONAL INSTITUTE OF ANTICANCER RESEARCH, GR, vol. 19, no. 1, 1 January 2005 (2005-01-01), pages 283 - 292, XP009079915, ISSN: 0258-851X * |
| LI, M., GENOMICS PROTEOMICS BIOINFORMATICS, vol. 14, 2016, pages 166 - 171 |
| MOSTELLER RD.: "Simplified calculation of body-surface area", N ENGL J MED., vol. 317, no. 17, 1987, pages 1098, XP008156553, DOI: 10.1056/NEJM198710223171717 |
| NAKADA, T., BIOORGANIC & MEDICINAL CHEMISTRY LETTERS, vol. 26, 2016, pages 1542 - 1545 |
| OGITANI, BIOORG. MED. CHEM. LETT., vol. 26, 2016, pages 5069 - 5072 |
| STAHL: "Handbook of Pharmaceutical Salts: Properties.", 2002, WILEY |
| TAHARA, M, MOL CANCER THER, vol. 13, no. 5, 2014, pages 1170 - 1180 |
| TESAURO, MOLECULES, vol. 24, 2019, pages 351 - 377 |
| VENDITTO VINCENT ET AL: "Cancer Therapies Utilizing the Camptothecins: A Review of the In Vivo Literature", MOLECULAR PHARMACEUTICS, vol. 7, no. 2, 1 January 2010 (2010-01-01), pages 307 - 349, XP055892704 * |
| WEERAKKODY, PNAS, vol. 110, no. 15, 9 April 2013 (2013-04-09), pages 5834 - 5839 |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2025186213A1 (en) | 2024-03-04 | 2025-09-12 | Debiopharm International S.A. | Combination of a wee1 inhibitor and a topoisomerase 1 inhibitor |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2022267389A1 (en) | 2023-11-09 |
| US20240226308A1 (en) | 2024-07-11 |
| CL2023003187A1 (es) | 2024-05-03 |
| MX2023012779A (es) | 2024-01-16 |
| IL308052A (en) | 2023-12-01 |
| JP2024516825A (ja) | 2024-04-17 |
| CN117897175A (zh) | 2024-04-16 |
| EP4329817A1 (en) | 2024-03-06 |
| KR20240019097A (ko) | 2024-02-14 |
| TW202308696A (zh) | 2023-03-01 |
| CA3218253A1 (en) | 2022-11-03 |
| AU2022267389A9 (en) | 2023-11-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240226308A1 (en) | Dosing regimens of peptide conjugates of topoisomerase i inhibitors | |
| TW202038957A (zh) | 抗體-藥物結合物與激酶抑制劑之組合 | |
| AU2011325989C1 (en) | Methods of treating cancer | |
| ES2933266T3 (es) | Administración de múltiples bolos de [6R] MTHF en una quimioterapia basada en 5-fluorouracilo | |
| JP6425653B2 (ja) | 抗腫瘍剤及び抗腫瘍効果増強剤 | |
| JP2021505548A (ja) | 化学療法抵抗性の卵巣がんまたは乳がんの治療におけるparp阻害剤の使用 | |
| CN112587666A (zh) | 用于治疗癌症的pd-1/pd-l1相互作用的小分子抑制剂和抗pd-1抗体的组合 | |
| JP2017530129A (ja) | ツブリシン複合体を用いた癌の治療方法 | |
| KR20220003560A (ko) | 유잉 육종의 치료를 위한 퀴놀린 화합물 또는 그의 약제학적으로 허용 가능한 염 | |
| JP2014515390A (ja) | Pi3k阻害剤化合物を用いた中皮腫の治療法 | |
| KR20200078483A (ko) | 간암 치료를 위한 조성물 및 방법 | |
| CN114302745A (zh) | 包含抗cd19抗体药物缀合物以及pi3k抑制剂或第二剂的组合疗法 | |
| US20230116137A1 (en) | Methods for treating colorectal and metastatic colorectal cancers | |
| JPWO2019176984A1 (ja) | 抗腫瘍剤、抗腫瘍効果増強剤及び抗腫瘍用キット | |
| AU2018234141A1 (en) | Combination between trifluridine/tipiracil hydrochloride, an anti-tumor platinum complex, and an immune checkpoint modulator | |
| US20250360124A1 (en) | Novel ras inhibitors | |
| Metzger et al. | Intraportal chemotherapy for colorectal hepatic metastases | |
| RU2777595C2 (ru) | Препарат и композиция для лечения злокачественных опухолей | |
| WO2024258916A1 (en) | Stat3 degraders and uses thereof | |
| WO2024255883A1 (zh) | Akt抑制剂在制备预防或治疗乳腺癌药物中的用途 | |
| WO2024255830A1 (zh) | Akt抑制剂在制备预防或治疗卵巢癌药物中的用途 | |
| AU2026201789A1 (en) | Therapeutic combinations of orally administered paclitaxel, a p-gp inhibitor, and a checkpoint inhibitor for the treatment of solid tumors | |
| Tolcher et al. | 403 POSTER Clinical responses in highly refractory solid tumor patients with oral MP-470, a multi-targeted tyrosine kinase inhibitor, in combination with standard of care chemotherapy regimens: preliminary report from a multi-institutional phase-1b clinical trial | |
| WO2020243745A1 (en) | Methods and uses for treating cancer | |
| HK40040066B (en) | Administration of multiple boluses of [6r] mthf in a 5-fluorouracil-based chemotherapy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22724607 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2022267389 Country of ref document: AU Ref document number: 804933 Country of ref document: NZ Ref document number: 2022267389 Country of ref document: AU |
|
| ENP | Entry into the national phase |
Ref document number: 3218253 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 308052 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 12023552978 Country of ref document: PH Ref document number: 2023566472 Country of ref document: JP Ref document number: MX/A/2023/012779 Country of ref document: MX Ref document number: 2301007060 Country of ref document: TH |
|
| ENP | Entry into the national phase |
Ref document number: 2022267389 Country of ref document: AU Date of ref document: 20220428 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202393046 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022724607 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11202308152P Country of ref document: SG |
|
| ENP | Entry into the national phase |
Ref document number: 2022724607 Country of ref document: EP Effective date: 20231129 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280044027.3 Country of ref document: CN |