WO2022225057A1 - Galectin-targeting immunotherapy - Google Patents
Galectin-targeting immunotherapy Download PDFInfo
- Publication number
- WO2022225057A1 WO2022225057A1 PCT/JP2022/018610 JP2022018610W WO2022225057A1 WO 2022225057 A1 WO2022225057 A1 WO 2022225057A1 JP 2022018610 W JP2022018610 W JP 2022018610W WO 2022225057 A1 WO2022225057 A1 WO 2022225057A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- virus
- galectin
- gal
- protein
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/162—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001166—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/70—Vectors or expression systems specially adapted for E. coli
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5258—Virus-like particles
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/36011—Togaviridae
- C12N2770/36111—Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
- C12N2770/36123—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/36011—Togaviridae
- C12N2770/36111—Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
- C12N2770/36134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/36011—Togaviridae
- C12N2770/36111—Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
- C12N2770/36141—Use of virus, viral particle or viral elements as a vector
- C12N2770/36143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
Definitions
- Galectins are members of the lectin family, which show high affinities for ⁇ -galactosides. There have been about 15 galectins discovered in mammals, encoded by the LGALS genes, which are numbered in a consecutive manner. Currently only galectin-1, -2, -3, -4, -7, -7B, -8, -9, -9B, 9C, -10, -12, -13, -14, and -16 have been identified in humans.
- Galectin-1 (Gal-1) is a member of a highly conserved family of animal lectins binding to N-acetyllactosamine (LacNAc; Gal ⁇ 1-4GlcNAc)-containing glycoprotein or glycolipids (Non Patent Literature 1: Barondes SH 1994). Gal-1 is significantly upregulated and secreted in many tumors. High levels of Gal-1 are associated with tumor aggressiveness, metastasis, and poor survival for many cancers (Non Patent Literature 2: Astorgues-Xerri L 2014).
- Non Patent Literature 3 Banh A 2011
- Expression of Galectin-1 is upregulated by hypoxic condition and glycosylation-dependent galectin-receptor interactions control angiogenesis (Non Patent Literature 4: Rabinovich 2014) (Non Patent Literature 5: Xu-Yun Zhao 2010).
- targeting galectin-glycan interactions may interfere tumor progression by simultaneously augmenting antitumor immunity and suppressing aberrant angiogenesis (Non Patent Literature 6: Thijssen VL 2006).
- Non Patent Literature 7 Lucile Astorgues-Xerri 2014
- most known galectin antagonists are glycomimetics and are derivatives or analogs of galactoside, targeting the canonical carbohydrate-binding site of galectins
- Non Patent Literature 8 Koonce NA 2017
- Peptide and antibody Gal-1 inhibitors are also reported its ability to antagonize galectin-receptor interactions (Non Patent Literature 9: Diego O. Croci 2012, Non Patent Literature 10: van der Schaft DW 2002).
- Galectin-3 (Gal-3) is a member of a highly conserved family of animal lectins binding to ⁇ -galactoside-containing glycoconjugates (glycoprotein or glycolipids) (Non Patent Literature 11: M. A. Henderson NC 2006, Non Patent Literature 12: Mourad-Zeidan AA 2008). Gal-3 is unique among other Galectin-family proteins in its structure composed of two domains: a carboxyl-terminal domain that contains the carbohydrate-binding region and an amino-terminal domain consisting primarily of tandem repeat of nine amino acids to cross-link carbohydrate and noncarbohydrate ligands (Figure 12A) (Non Patent Literature 13: Liu 1990, Non Patent Literature 1: Barondes SH 1994).
- Non Patent Literature 14 Reynolds 2005, Non Patent Literature 15 MacKinnon AC 2008.
- Secreted extracellular Gal-3 forms homo-dimer or pentamer and it is important for the biological function.
- the N-terminal domain of galectin-3 has been demonstrated to be important for the formation of protein oligomers ( Figure 12 B) (Non Patent Literature 13: Liu 1990, Non Patent Literature 16: Dumic J 2006, Non Patent Literature 17: Kuklinski S 1998, Non Patent Literature 18: Lepur A 2012).
- Non Patent Literature 19 Yang RY 1996.
- Gal-3 was shown to be increased in various models of fibrotic diseases and patients including lung fibrosis, liver fibrosis, systemic sclerosis and cardiac fibrosis (Non Patent Literature 20: M. A. Henderson NC 2008, Non Patent Literature 21: Barman, et al. 2019, Non Patent Literature 22: Nishi Y 2007, Non Patent Literature 23: De Boer 2010). This suggests that Gal-3 may be an important mediator of and effective therapeutic target for tissue fibrosis. To date, preclinical and clinical studies of investigational Galectin-3 inhibitors showed protection against fibrotic disorders (Non Patent Literature 24: Nikhil Hirani 2017, Non Patent Literature 25: Yu L 2013).
- Alphaviruses comprise a set of genetically, structurally, and serologically related mosquito-borne viruses of the Togaviridae family.
- the alphaviruses include Eastern Equine Encephalitis Virus (EEEV), Venezuelan Equine Encephalitis Virus (VEEV), Everglades Virus, Mucambo Virus, Pixuna Virus, Western Equine Encephalitis Virus (WEEV), Sindbis Virus, Semliki Forest Virus, Middleburg Virus, Chikungunya Virus (CHIKV), O'nyong-nyong Virus, Ross River Virus, Barmah Forest Virus, Getah Virus, Sagiyama Virus, Bebaru Virus, Mayaro Virus, Una Virus, Aura Virus, Whataroa Virus, Babanki Virus, Kyzylagach Virus, Highlands J virus, Fort Morgan Virus, Ndumu Virus, and Buggy Creek Virus.
- EEEV Eastern Equine Encephalitis Virus
- VEEV
- Structural subunits containing a single viral protein, capsid associate with the RNA genome in an icosahedral nucleocapsid.
- the capsid is surrounded by a lipid envelope covered with a regular array of transmembrane protein spikes, each of which consists of a heterodimeric complex of two glycoproteins, E1 and E2.
- VLPs Virus-like particles
- GlaxoSmithKline s EngerixR (hepatitis B virus) and CervarixR (human papillomavirus), and Merck and Co., Inc.’s Recombivax HBR (hepatitis B virus) and GardasilR (human papillomavirus) are some examples.
- Other VLP-based vaccine candidates are in clinical trials or undergoing preclinical evaluation, such as, influenza virus, parvovirus, Norwalk and various chimeric VLPs.
- VLP-based vaccine blockbusters are briefly presented concomitantly with the latest results from clinical trials and the recent developments in chimeric VLP-based technology for either therapeutic or prophylactic vaccination.
- VLP-based vaccines have been produced for more than 30 different viruses that infect human and other animals.
- the examples include AAV (Adeno-associated virus), H5N3 (Avian influenza), BFDV (Budgerigar fledgling disease virus), BTV (Bluetongue virus), Ebola, Enterovirus 71, GHPV (Goose hemorrhagic polyoma virus), HBV (Hepatitis B virus), HCV (Hepatitis C virus), HDV (Hepatitis ⁇ virus), HEV (Hepatitis E virus), HIV, HPV (Human papillomavirus), IBDV (Infectious bursal disease virus), Influenza A, Influenza A H1N1, Influenza A H3N2, JC polymavirus, Margurg, MS2, IPCV (Indian peanut clump virus), NDV (Newcastle disease virus), No (Norovirus) Nv (Norwalk virus), PhMV (Physalis mottle virus), Polymavirus,
- Patent Literature 1 discloses a virus-like particle (VLP) comprising one or more Chikungunya virus viral structural proteins which is useful for formulating a vaccine or antigenic composition for Chikungunya that induces immunity to an infection or at least one symptom thereof.
- Patent Literature 2 discloses modified alphavirus or flavivirus virus-like particles (VLPs) and methods for enhancing production of modified VLPs for use in the prevention or treatment of alphavirus and flavivirus-mediated diseases.
- VLP virus-like particle
- VLPs modified alphavirus or flavivirus virus-like particles
- Patent Literature 3 discloses a Chikungunya virus (CHIKV) or Venezuelan equine encephalitis virus (VEEV) virus-like particle, wherein said virus-like particle contains at least one antigen inserted into an E2 envelope protein to form a fusion protein.
- US patent No. 9,969,986 discloses an alphavirus virus-like particle, wherein said virus-like particle comprises an alphavirus viral sturctural protein that comprises an envelope protein E3, wherein said envelope protein E3 is modified to contain at least one foreign antigen inserted into furin cleavage site thereof.
- the cited references are herein incorporated by reference.
- the present disclosure relates to a galectin-targeting immunotherapy.
- the present disclosure provides a virus like particle comprising a viral structural protein and at least one galectin antigen.
- the present disclosure provides an isolated nucleic acid molecule comprising a nucleotide sequence encoding the virus like particle provided in the first aspect of the present application.
- the present disclosure provides a pharmaceutical composition or vaccine composition
- a pharmaceutical composition or vaccine composition comprising (a) the virus like particle of the first aspect, the nucleic acid molecule of the second aspect, and/or the vector of the third aspect; and (b) a pharmaceutically acceptable carrier.
- the present disclosure provides a galectin-targeting immunotherapy which comprises administering an effective amount of the virus like particle of the first aspect, the nucleic acid molecule of the second aspect, and/or the vector of the third aspect to a subject in need thereof.
- This method may be useful for treating or preventing a cancer, inflammatory disease, and a fibrotic disease.
- Methods for modulating an immune response in a subject for immunostimulating a subject, for producing an antibody against galectin in a non-human mammal; for modulating an immune response in a subject; for immunostimulation in a subject; for inhibiting galectin-glycan interactions in a subject; or for inhibiting a galectin activity is also provided.
- the present disclosure provides use of the virus like particle of the first aspect, the nucleic acid molecule of the second aspect, and/or the vector of the third aspect, for the manufacture of a pharmaceutical composition or a kit for immunotherapy, for modulating an immune response in a subject, for immunostimulating a subject, for producing an antibody against galectin in a non-human mammal; for modulating an immune response in a subject; for immunostimulation in a subject; for inhibiting galectin-glycan interactions in a subject.
- VEEV Gal-1 VLPs Preparation of VEEV Gal-1 VLPs. Each lane is a VEEV VLP bearing Gal-1 epitope peptides #5, #7, #12 and #14, respectively, from left to right. The far right is a control VLP with no antigen peptide.
- VEEV-VLPs bearing a Gal-1 epitope peptide A 3D structure of the Gal-1 protein. Gal-1 epitope peptide #5 and #12 encode four ⁇ -sheet S3, S4, S5 and S6 near the carbohydrate recognition domain (CRD). A 3D structure of the Gal-1 protein. The Gal-1 peptide #7 and #14 encodes F4 and F5 ⁇ -sheet which might be important in homophilic dimerization. Anti-human Gal-1 antibody titer in mice sera immunized with VEEV-VLPs bearing Gal-1 epitope peptides #5, #7, #12 and #14.
- VEEV-VLPs bearing Gal-3 epitope peptides #17, #21, #22 and #23 and control VLP.
- Galectin-3 protein structure consists of N terminal Domain, which has a N terminal Region of 12 amino acids containing serin 6 (6) phosphorylation site and a 100 aa long collagen like repeat sequence.
- the carbohydrrecoginition domain (CDR) 130 aa comprise the C-terminal and contains the NWGR motif;
- CDR carbohydrrecoginition domain
- agent any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
- ameliorate is meant decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease or a symptom thereof.
- alteration is meant a change in an amino acid or nucleotide at a specified position with reference to a polypeptide sequence or polynucleotide sequence.
- an alteration includes a substitution, deletion, or insertion of an amino acid or nucleotide at a specified position of a polypeptide or polynucleotide.
- an alteration in an alphavirus capsid protein nuclear localization signal includes substitution of a charged amino acid (e.g., lysine or arginine) with an uncharged amino acid (e.g., alanine or asparagine, or any amino acid except a basic charged amino acid such as lysine or arginine).
- an analog is meant a molecule that is not identical, but has analogous functional or structural features.
- a polypeptide analog retains the biological activity of a corresponding naturally-occurring polypeptide, while having certain biochemical modifications that enhance the analog's function relative to a naturally occurring polypeptide. Such biochemical modifications could increase the analog's protease resistance, membrane permeability, or half-life, without altering, for example, ligand binding.
- An analog may include an unnatural amino acid.
- detect is meant identifying the presence, absence or amount of the analyte to be detected.
- disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
- fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide.
- a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
- isolated polynucleotide is meant a nucleic acid molecule (e.g., a DNA) that is free of the genes which, in the naturally-occurring genome of the organism from which the nucleic acid molecule of this disclosure is derived, flank the gene.
- the term therefore includes, for example, a recombinant DNA that is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote; or that exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease digestion) independent of other sequences.
- the term includes an RNA molecule that is transcribed from a DNA molecule, as well as a recombinant DNA that is part of a hybrid gene encoding additional polypeptide sequence.
- isolated polypeptide is meant a polypeptide of this disclosure that has been separated from components that naturally accompany it.
- the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
- the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of this disclosure.
- An isolated polypeptide of this disclosure may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
- marker is meant any protein or polynucleotide having an alteration in expression level or activity that is associated with a disease or disorder.
- reference is meant a standard or control condition.
- reference sequence is a defined sequence used as a basis for sequence comparison.
- a reference sequence may be a subset of or the entirety of a specified sequence; for example, a segment of a full-length cDNA or gene sequence, or the complete cDNA or gene sequence.
- the length of the reference polypeptide sequence will generally be at least about 16 amino acids, preferably at least about 20 amino acids, more preferably at least about 25 amino acids, and even more preferably about 35 amino acids, about 50 amino acids, or about 100 amino acids.
- the length of the reference nucleic acid sequence will generally be at least about 50 nucleotides, preferably at least about 60 nucleotides, more preferably at least about 75 nucleotides, and even more preferably about 100 nucleotides or about 300 nucleotides or any integer thereabout or therebetween.
- telomere binding As used herein, “specifically binds” is meant a compound or antibody that recognizes and binds a polypeptide or protein, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes the polypeptide or protein.
- subject is meant a mammal, including, but not limited to, a human or non- human mammal, such as a bovine, equine, canine, ovine, or feline.
- Ranges provided herein are understood to be shorthand for all of the values within the range.
- a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
- the term "about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
- a virus like particle comprising a viral structural protein and a galectin antigen is provided.
- the modified fragment has at least 80%, 85%, 90%, 95% or 98% amino acid sequence identity to a fragment of the naturally occurring galectin protein.
- the modified peptide fragment is a mutant where at most 10% of the amino acids are deleted, substituted, and/or added based on a fragment of the naturally occurring galectin protein.
- Galectin-1 Homo sapiens
- Galectin-3 [Homo sapiens](GenBank Accession No: AAB86584.1) MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI(SEQ ID NO: 8)
- galectin antigens i.e. galectin epitope peptides may include the followings: Gal-1 epitope peptides #5: SFVLNLGKDSNNL S LHFNPRFNAHGDANTIV S NSKDGGAWGTEQREAVFPFQPGS (SEQ ID NO: 9) #7: ANLTVKLPDGYEFKFPNRLNLEA (SEQ ID NO: 10) #12: SFVLNLGKDSNNL S LHFNPRFNAHGDANTIV S NTKEDGTWGTEHREPAFPFQPGS (SEQ ID NO: 11) #14: ADLTIKLPDGHEFKFPNRLNMEA (SEQ ID NO: 12)
- Gal-1 epitope peptide #5 is a fragment derived from human Gal-1 and #12 is the corresponding fragment derived from mouse Gal-1, wherein cysteines in the wild type sequences are replaced with serin (underlined).
- Gal-1 epitope peptide #7 is a fragment of wild type human Gal-1, and #14 is the corresponding fragment of mouse wild type Gal-1.
- Gal-3 epitope peptide #17 is consisting of human N-term Gal-3 epitope peptide.
- Gal-3 epitope peptides #21 and 22 consisting of human Gal-3 N-term repeat sequence epitope peptide and #22 has longer repeat sequence than that of #21.
- #23 encodes mouse Gal-3 N-term peptide
- a viral structural protein and an antigen may be linked through at least one first attachment site which is present in the viral structural protein and at least one second attachment site which is present in the antigen.
- each of "a first attachment site” and “a second attachment site” refers to a site where more than one substance is linked each other.
- a viral structural protein and an antigen may be directly or indirectly fused.
- one or two linkers may intervene between N-terminal residue of an antigen and a viral structural protein and/or between C-terminal residue of an antigen and a viral structural protein.
- an antigen or a viral structural protein can be truncated and replaced by short linkers.
- an antigen or a viral structural protein include one or more peptide linkers.
- a linker consists of from 2 to 25 amino acids (e.g. 2, 3, 4, 5 or 6 amino acids). Usually, it is from 2 to 15 amino acids in length, although in certain circumstances, it can be only one, such as a single glycine residue.
- the first attachment site is modified from the viral structural protein so that through a linker peptide including SG, GS, SGG, GGS and SGSG, the protein is conjugated with the antigen.
- the first attachment site and the second attachment site may be linked through a chemical cross-linker which is a chemical compound.
- the cross-linker include, but are not limited to, SMPH, Sulfo-MBS, Sulfo-EMCS, Sulfo-GMBS, Sulfo-SIAB, Sulfo-SMPB, Sulfo-SMCC, SVSB, SIA and other cross-linkers available from the Pierce Chemical Company.
- alphavirus examples include Chikungunya virus and Venezuelan equine encephalitis virus.
- Chikungunya virus may include Chikungunya virus 37997 strain and OPY-1 strain.
- Examples of Venezuelan equine encephalitis virus may include Venezuelan equine encephalitis virus TC-83 strain.
- Viral structural protein may include a capsid protein, and/or an envelope protein, a fragment thereof or a complex thereof.
- viral structural protein used for the present application may comprise a capsid protein and/or an envelope protein and/or a fragment or derivative thereof.
- the virus like particle provided by this disclosure comprises capsid, E3, E2 and E1 proteins, and a galectin antigen.
- an antigen may be linked to the Chikungunya virus viral structural protein or Venezuelan equine encephalitis virus viral structural protein as a fusion protein produced by way of genetic engineering.
- E3 can be dissociated from E2 after furin cleavage.
- the furin cleavage site located in E3 may be mutated to prevent furin site from cleaving.
- an antigen can be inserted into the furin cleavage site to introduce a mutation in the furin cleavage site.
- the virus like particle provided may consist of or comprises capsid, E3, E2 and E1 proteins, where E3 is bound to E2 to form a single protein and an antigen is inserted into E3 region.
- the virus like particle provided by the present application may be formed by assembling 240 capsids, 240 E1 proteins, 240 proteins in each of which E2 is bound to E3 and an antigen is inserted into each of E3 region.
- Chikungunya virus viral structural protein or Venezuelan equine encephalitis virus viral structural protein used in the present application may be a naturally occurring viral structural protein or modified protein thereof.
- the modified protein may be a fragment of the naturally occurring viral structural protein.
- the modified protein has at least 70%, 75%, 80%, 85%, 90%, 95% or 98% amino acid sequence identity to a naturally occurring viral capsid and/or envelope protein.
- the modified protein is a mutant where at most 10% of the amino acids are deleted, substituted, and/or added based on a naturally occurring viral capsid and/or envelope protein.
- K64A or K64N mutation may be introduced into a capsid of Venezuelan equine encephalitis virus viral structural protein used in the present application.
- a Chikungunya virus like particle or Venezuelan equine encephalitis virus like particle comprising a Chikungunya or Venezuelan equine encephalitis virus viral structural protein and at least one galectin antigen, wherein the at least one galectin antigen is inserted in E3 of the viral structural protein, and the Chikungunya virus viral structural protein or Venezuelan equine encephalitis virus viral structural protein and the galectin antigen are expressed as a fusion protein
- the galectin antigen may be inserted directly or indirectly in E3 of the viral structural protein.
- At least one galectin antigen may be inserted instead of furin cleavage site (RKRR) in E3, from 322R to 325R of SEQ ID NO: 1 or 2, or a site corresponding to furin site (RKRR) from 322R to 325R of SEQ ID NO: 1 or 2.
- RKRR furin cleavage site
- At least one galectin antigen is inserted between residues H at 321-position and S at 326-position of SEQ ID NO: 1 or 2; between P at 320-position and S at 326-position of SEQ ID NO: 1 or 2; or between S at 319-position and S at 326-position of SEQ ID NO: 1 or 2, or the corresponding site.
- VLP_CHI 0.56 vector may be used for preparing Chikungunya virus like particle where the galectin antigen is inserted between residues 321 and 326 of SEQ ID Nos.1 or 2.
- the virus like particle provided by the present application may be Chikungunya virus like particle comprising a complex of E2 and E3, capsid and E1, and wherein the at least one galectin antigen is inserted in E3 region.
- At least one galectin antigen may be inserted instead of furin cleavage site (RKRR) in E3 from 331R to 334R of SEQ ID NO: 3, or a site corresponding to the furin cleavage site from 331R to 334R of SEQ ID NO: 3.
- RKRR furin cleavage site
- at least one galectin antigen is inserted between G at 330-position and S at 335-position of SEQ ID NO: 3; between P at 329-position and S at 335-position of SEQ ID NO: 3; or between C at 328-position and S at 335-position of SEQ ID NO: 3, or a corresponding site.
- VLP_VEEV 0.66 vector may be used for preparing Venezuelan equine encephalitis virus like particle where the antigen is inserted between residues 330 and 335 of SEQ ID NO: 3.
- the virus like particle provided by the present application may be Venezuelan equine encephalitis virus like particle comprising a complex of E2 and E3, capsid and E1, and wherein the at least one galectin antigen is inserted into E3 region.
- the term "corresponding to” is used to indicate that the amino acid residue at a specified amino acid position in the first sequence corresponds to or aligns with the amino acid position in the second protein when the two proteins are subjected to standard sequence alignments (e.g., using the BLASTp program).
- the amino acid position "A” in the first protein will correspond to the amino acid position "B” in the second sequence if residues at positions "A” and "B” correspond to each other in a sequence alignment.
- the viral structural protein of Chikungunya virus as well as Venezuelan equine encephalitis comprise capsid, E1, E2, 6K and E3. 6K is naturally cleaved during the process of assemble and removed from the VLPs.
- viral structural protein refers not only those having 6K, but also after 6K is removed.
- 6K sequences of the CHIKV and VEEV used in the working examples are as follows: CHIKV OPY-1 Strain, 6K: 749-809aa of SEQ ID NO: 1 atyqeaaiylwneqqplfwlqaliplaalivlcnclrllpcccktlaflavmsvgahtvsa (SEQ ID NO: 4) CHIKV 37997 strain, 6K: 749-809aa of SEQ ID NO: 2 atyyeaaaylwneqqplfwlqaliplaalivlcnclkllpcccktlaflavmsigahtvsa (SEQ ID NO: 5) VEEV TC-83strain, 6K: 758-813aa of SEQ ID NO: 3 ettwesldhlwnnnqqmfwiqlliplaalivvtrllrcvccvvpflv
- Nucleic acid molecules provided herein include any nucleic acid molecule that encodes a polypeptide of this disclosure or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of this disclosure include any nucleic acid molecule that encodes a polypeptide of this disclosure or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity.
- Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule.
- hybridize is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
- complementary polynucleotide sequences e.g., a gene described herein
- stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
- Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
- Stringent temperature conditions will ordinarily include temperatures of at least about 30°C, more preferably of at least about 37°C, and most preferably of at least about 42°C.
- Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
- concentration of detergent e.g., sodium dodecyl sulfate (SDS)
- SDS sodium dodecyl sulfate
- Various levels of stringency are accomplished by combining these various conditions as needed.
- hybridization will occur at 30°C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS.
- hybridization will occur at 37°C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 ⁇ g/ml denatured salmon sperm DNA (ssDNA).
- hybridization will occur at 42°C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 ⁇ g/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
- wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
- stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
- Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25 °C, more preferably of at least about 42°C, and even more preferably of at least about 68°C.
- wash steps will occur at 25 °C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42 C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68°C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS.
- Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Hogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
- substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
- a reference amino acid sequence for example, any one of the amino acid sequences described herein
- nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
- such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
- Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e ⁇ "3> and e ⁇ "100> indicating a closely related sequence.
- sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University
- compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
- proteins may comprise mutations containing alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded protein or how the proteins are made.
- Nucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host, see U.S. patent publication 2005/0118191, herein incorporated by reference in its entirety for all purposes.
- nucleotides can be sequenced to ensure that the correct coding regions were cloned and do not contain any unwanted mutations.
- the nucleotides can be subcloned into an expression vector (e.g., baculovirus) for expression in any cell.
- an expression vector e.g., baculovirus
- An isolated nucleic acid may be substantially purified, but need not be.
- a nucleic acid that is isolated within a cloning or expression vector is not pure in that it may comprise only a tiny percentage of the material in the cell in which it resides.
- Such a nucleic acid is isolated, as the term is used herein, because it is readily manipulatable by standard techniques known to those of ordinary skill in the art.
- VLPs comprising an alfavirus viral sturctural protein and at least one gelactin antigen may be produced by transforming a suitable host cell with all or part of a polypeptide-encoding nucleic acid molecule or fragment thereof in a suitable expression vehicle.
- a polypeptide of this disclosure may be produced in a prokaryotic host (e.g., E. coli) or in a eukaryotic host (e.g., Saccharomyces cerevisiae, insect cells, e.g., Sf21 cells, or mammalian cells, e.g., NIH 3T3, HeLa, COS cells).
- a prokaryotic host e.g., E. coli
- a eukaryotic host e.g., Saccharomyces cerevisiae, insect cells, e.g., Sf21 cells, or mammalian cells, e.g., NIH 3T3, HeLa, COS cells.
- mammalian cells are COS cells, baby hamster kidney cells, mouse L cells, LNCaP cells, Chinese hamster ovary (CHO) cells, human embryonic kidney (HEK) cells, African green monkey cells, CV1 cells, HeLa cells, MDCK cells, Vero and Hep-2 cells. Xenopus laevis oocytes, or other cells of amphibian origin, may also be used.
- Prokaryotic host cells include bacterial cells, for example, E. coli, B. subtilis, and mycobacteria.
- the gene encoding a specific alphavirus viral structural protein e.g., a CHIKV or VEEV viral structural protein can be isolated by RT-PCR from polyadenylated mRNA extracted from cells which had been infected with said virus.
- the resulting product gene can be cloned as a DNA insert into a vector.
- vector refers to the means by which a nucleic acid can be propagated and/or transferred between organisms, cells, or cellular components.
- Vectors include plasmids, viruses, bacteriophages, pro-viruses, phagemids, transposons, artificial chromosomes, and the like, that replicate autonomously or can integrate into a chromosome of a host cell.
- a vector can also be a naked RNA polynucleotide, a naked DNA polynucleotide, a polynucleotide composed of both DNA and RNA within the same strand, a poly-lysine-conjugated DNA or RNA, a peptide-conjugated DNA or RNA, a liposome-conjugated DNA, or the like, that is not autonomously replicating.
- the vectors of the present invention are plasmids or bacmids.
- This disclosure further provides nucleotides that encode proteins, including chimeric molecules, cloned into an expression vector that can be expressed in a cell that provides for the formation of VLPs.
- An "expression vector” is a vector, such as a plasmid, that is capable of promoting expression, as well as replication of a nucleic acid incorporated therein.
- the nucleic acid molecule to be expressed is "operably linked" to a promoter and/or enhancer, and is subject to transcription regulatory control by the promoter and/or enhancer.
- Expression vectors useful for producing such polypeptides include, without limitation, chromosomal, episomal, and virus-derived vectors, e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof.
- virus-derived vectors e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retrovirus
- Constructs and/or vectors provided herein comprise alphavirus polynucleotides that encode structural protein, including envelope proteins or capsid proteins or portions thereof as described herein.
- the vector may be, for example, a phage, plasmid, viral, or retroviral vector.
- the constructs and/or vectors that comprise the nucleotides should be operatively linked to an appropriate promoter, such as the CMV promoter, phage lambda PL promoter, the E. coli lac, phoA and tac promoters, the SV40 early and late promoters, and promoters of retroviral LTRs are non-limiting examples.
- Other suitable promoters will be known to the skilled artisan depending on the host cell and/or the rate of expression desired.
- the expression constructs will further contain sites for transcription initiation, termination, and, in the transcribed region, a ribosome-binding site for translation.
- the coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon appropriately positioned at the end of the polypeptide to be translated.
- Expression vectors will preferably include at least one selectable marker.
- markers include dihydrofolate reductase, G418 or neomycin resistance for eukaryotic cell culture and tetracycline, kanamycin or ampicillin resistance genes for culturing in E. coli and other bacteria.
- virus vectors such as baculovirus, poxvirus (e.g., vaccinia virus, avipox virus, canarypox virus, fowlpox virus, raccoonpox virus, swinepox virus, etc.), adenovirus (e.g., canine adenovirus), herpesvirus, and retrovirus.
- vectors for use in bacteria comprise vectors for use in bacteria, which comprise pQE70, pQE60 and pQE-9, pBluescript vectors, Phagescript vectors, pNH8A, pNH16a, pNH18A, pNH46A, ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5.
- preferred eukaryotic vectors are pFastBacl pWINEO, pSV2CAT, pOG44, pXTl and pSG, pSVK3, pBPV, pMSG, and pSVL.
- Other suitable vectors will be readily apparent to the skilled artisan.
- Recombinant constructs can be prepared and used to transfect, infect, or transform and can express viral proteins, including those described herein, into eukaryotic cells and/or prokaryotic cells.
- this disclosure provides for host cells which comprise a vector (or vectors) that contain nucleic acids which code for alphavirus viral sturctural genes, including capsid, E3, E2, 6K, and El or portions thereof, and/or any chimeric molecule described above, and permit the expression of alphavirus viral sturctural genes, including capsid E3, E2, 6K, and El, or portions thereof, and/or any chimeric molecule described above in said host cell under conditions which allow the formation of VLPs.
- said vector is a recombinant baculovirus.
- said recombinant baculovirus is transfected into an insect cell.
- said cell is an insect cell.
- said insect cell is a Sf9 cell.
- said vector and/or host cell comprises nucleotides that encode alphavirus genes, including capsid, E3, E2, 6K, and El, or portions thereof as described.
- said vector and/or host cell consists essentially of alphavirus capsid, E3, E2, 6K, and El, or portions thereof as described herein.
- said vector and/or host cell consists of alphavirus protein comprising capsid, E3, E2, 6K, and El, or portions thereof, as described herein.
- These vector and/or host cell contain alphavirus core, E3, E2, 6K, and El, or portions thereof, as described herein, and may contain additional cellular constituents such as cellulVLProteins, baculovirus proteins, lipids, carbohydrates etc.
- E. coli pET expression system (Novagen, Inc., Madison, Wis). According to this expression system, DNA encoding a polypeptide is inserted into a pET vector in an orientation designed to allow expression. Since the gene encoding such a polypeptide is under the control of the T7 regulatory signals, expression of the polypeptide is achieved by inducing the expression of T7 RNA polymerase in the host cell. This is typically achieved using host strains that express T7 RNA polymerase in response to IPTG induction. Once produced, a recombinant polypeptide is then isolated according to standard methods known in the art, for example, those described herein.
- pGEX expression system Another bacterial expression system for polypeptide production is the pGEX expression system (Pharmacia).
- This system employs a GST gene fusion system that is designed for high-level expression of genes or gene fragments as fusion proteins with rapid purification and recovery of functional gene products.
- the protein of interest is fused to the carboxyl terminus of the glutathione S-transferase protein from Schistosoma japonicum and is readily purified from bacterial lysates by affinity chromatography using Glutathione Sepharose 4B. Fusion proteins can be recovered under mild conditions by elution with glutathione.
- Cleavage of the glutathione S-transferase domain from the fusion protein is facilitated by the presence of recognition sites for site-specific proteases upstream of this domain.
- proteins expressed in pGEX-2T plasmids may be cleaved with thrombin; those expressed in pGEX-3X may be cleaved with factor Xa.
- compositions and Administration This disclosure features pharmaceutical compositions that comprise VLPs as described herein.
- the pharmaceutical compositions useful herein contain a pharmaceutically acceptable carrier, including any suitable diluent or excipient, which includes any pharmaceutical agent that does not itself induce the production of an immune response harmful to the vertebrate receiving the composition, and which may be administered without undue toxicity and a VLP of this disclosure.
- pharmaceutically acceptable means being approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopia, European Pharmacopia or other generally recognized pharmacopia for use in mammals, and more particularly in humans.
- These compositions can be useful as a vaccine and/or antigenic compositions for inducing a protective immune response in a vertebrate.
- Pharmaceutically acceptable carriers include but are not limited to saline, buffered saline, dextrose, water, glycerol, sterile isotonic aqueous buffer, and combinations thereof.
- saline buffered saline
- dextrose dextrose
- water glycerol
- sterile isotonic aqueous buffer and combinations thereof.
- the formulation should suit the mode of administration.
- the formulation is suitable for administration to humans, preferably is sterile, non-particulate and/or non-pyrogenic.
- composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
- the composition can be a solid form, such as a lyophilized powder suitable for reconstitution, a liquid solution, suspension, emulsion, tablet, pill, capsule, sustained release formulation, or powder.
- Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
- the VLP composition is supplied in liquid form, for example in a sealed container indicating the quantity and concentration of the VLP composition.
- the liquid form of the VLP composition is supplied in a hermetically sealed container at least about 50 ⁇ g/ml, more preferably at least about 100 ⁇ g/ml, at least about 200 ⁇ g/ml, at least 500 ⁇ g/ml, or at least 1 mg/ml.
- the vaccine formulation is administered intranasally, either by drops, large particle aerosol (greater than about 10 microns), or spray into the upper respiratory tract or small particle aerosol (less than 10 microns) or spray into the lower respiratory tract. While any of the above routes of delivery results in an immune response, intranasal administration confers the added benefit of eliciting mucosal immunity at the site of entry of many viruses, including alphaviruses, for example CHIKV or VEEV.
- this disclosure also comprises a method of formulating a vaccine or antigenic composition that induces immunity to an infection or at least one symptom thereof to a mammal, comprising adding to said formulation an effective dose of VLPs, e.g., alphavirus (e.g., CHIKV or VEEV).
- VLPs e.g., alphavirus (e.g., CHIKV or VEEV).
- stimulation of immunity with a single dose is preferred, however additional dosages can be also be administered, by the same or different route, to achieve the desired effect.
- additional dosages can be also be administered, by the same or different route, to achieve the desired effect.
- multiple administrations may be required to elicit sufficient levels of immunity. Administration can continue at intervals throughout childhood, as necessary to maintain sufficient levels or protection.
- the dosage of the pharmaceutical formulation can be determined readily by the skilled artisan, for example, by first identifying doses effective to elicit a prophylactic or therapeutic immune response, e.g., by measuring the serum titer of virus specific immunoglobulins or by measuring the inhibitory ratio of antibodies in serum samples, or urine samples, or mucosal secretions. Said dosages can be determined from animal studies.
- a non-limiting list of animals used to study the efficacy of vaccines include the guinea pig, hamster, ferrets, chinchilla, mouse and cotton rat, and non-human primates. Most animals are not natural hosts to infectious agents but can still serve in studies of various aspects of the disease.
- any of the above animals can be dosed with a vaccine candidate, e.g., VLPs of this disclosure, to partially characterize the immune response induced, and/or to determine if any neutralizing antibodies have been produced.
- a vaccine candidate e.g., VLPs of this disclosure
- many studies have been conducted in the mouse model because mice are small size and their low cost allows researchers to conduct studies on a larger scale.
- the immunogenicity of a particular composition can be enhanced by the use of non-specific stimulators of the immune response, known as adjuvants.
- adjuvants have been used experimentally to promote a generalized increase in immunity against unknown antigens. Immunization protocols have used adjuvants to stimulate responses for many years, and as such, adjuvants are well known to one of ordinary skill in the art. Some adjuvants affect the way in which antigens are presented. For example, the immune response is increased when protein antigens are precipitated by alum. Emulsification of antigens also prolongs the duration of antigen presentation.
- the inclusion of any adjuvant described in Vogel et al., "A Compendium of Vaccine Adjuvants and Excipients (2nd Edition)," herein incorporated by reference in its entirety for all purposes, is envisioned within the scope of this invention.
- Exemplary adjuvants include complete Freund's adjuvant (a non-specific stimulator of the immune response containing killed Mycobacterium tuberculosis), incomplete Freund's adjuvants and aluminum hydroxide adjuvant.
- Other adjuvants comprise GMCSP, BCG, aluminum hydroxide, MDP compounds, such as thur-MDP and nor-MDP, CGP (MTP-PE), lipid A, and monophosphoryl lipid A (MPL).
- RIBI which contains three components extracted from bacteria, MPL, trehalose dimycolate (TDM) and cell wall skeleton (CWS) in a 2% squalene/Tween-80 emulsion also is contemplated.
- MF-59, Novasomes.RTM., MHC antigens may also be used.
- the VLPs of this disclosure can also be formulated with "immune stimulators.” These are the body's own chemical messengers (cytokines) to increase the immune system's response. Immune stimulators include, but not limited to, various cytokines, lymphokines and chemokines with immunostimulatory, immunopotentiating, and pro-inflammatory activities, such as interleukins (e.g., IL-1, IL-2, IL-3, IL-4, IL-12, IL-13); growth factors (e.g., granulocyte-macrophage (GM)-colony stimulating factor (CSF)); and other immunostimulatory molecules, such as macrophage inflammatory factor, Flt3 ligand, B7.1; B7.2, etc.
- interleukins e.g., IL-1, IL-2, IL-3, IL-4, IL-12, IL-13
- growth factors e.g., granulocyte-macrophage (GM)-colony stimulating factor (CSF
- the immunostimulatory molecules can be administered in the same formulation as the VLPs, or can be administered separately. Either the protein or an expression vector encoding the protein can be administered to produce an immunostimulatory effect.
- this disclosure comprises antigenic and vaccine formulations comprising an adjuvant and/or an immune stimulator.
- the composition is useful for immunotherapy, treating or preventing cancer or inflammatory disease including liver fibrotic disease; producing an antibody against galectin in a mammal; modulating an immune response in a subject; immunostimulation in a subject; inhibiting an interaction between galectin and galectin receptor; or inhibiting a galectin activity.
- cancers that may be treated by the composition include, but are not limited to, head and neck cancer, lung cancer, non-small cell lung cancer, bone cancer, pancreatic cancer, cutaneous or intraocular malignant melanoma, melanoma, breast cancer, uterine cancer, ovarian cancer, rectal cancer, colon cancer, duodenal cancer, anal cancer, stomach cancer, liver cancer, testicular cancer, fallopian tube cancer, uterine Endometrial and cervical cancer.
- Vaginal cancer vulvar cancer, Hodgkin's disease, non-Hodgkin's lymphoma, esophageal cancer, small bowel cancer, endocrine system cancer, thyroid cancer, parathyroid cancer, adrenal cancer, soft tissue sarcoma, urethral cancer.
- Cancer of the penis acute myelogenous leukemia, chronic myelogenous leukemia, acute lymphocytic leukemia, chronic lymphocytic leukemia, pediatric solid tumors, lymphocytic lymphoma, bladder cancer, kidney or ureter cancer, prostate cancer, cancer of the renal pelvis.
- the VLP provided by this disclosure may be used for treating or preventing cancer, such as lung cancer, and diseases or conditions caused by HPV infection.
- the VLP may be used for treating or preventing diseases and conditions associated with fiblosis including, but not limited to, lung fibrosis, liver fibrosis including non-alcoholic steatohepatitis (NASH), systemic sclerosis and cardiac fibrosis.
- diseases and conditions associated with fiblosis including, but not limited to, lung fibrosis, liver fibrosis including non-alcoholic steatohepatitis (NASH), systemic sclerosis and cardiac fibrosis.
- Galectin-1 (Gal-1) vaccine epitopes were designed by using amino acid sequence and 3D-structure of human and mouse Gal-1 proteins (Table 1).
- epitope peptides #5-#10 are fragments of human gal-1
- epitope peptides #12 and #14 are fragments of mouse gal-1 protein.
- E3 region of Chikungunya virus (CHIKV) or Venezuelan Equine Encephalitis virus (VEEV) viral structural protein was modified with the Gal-1 epitope peptides.
- the epitope peptide was fused through linkers SGG (N-terminal) and GGS (C-terminal) between H at 321-position and S at 326-position of SEQ ID NO: 2 for CHIKV, between G at 330-position and S at 335-position of SEQ ID NO: 3 for VEEV.
- pCHIKV-Gal-1 or pVEEV Gal-1 plasmid DNA vectors For the generation of mammalian expression vectors, pCHIKV-Gal-1 or pVEEV Gal-1 plasmid DNA vectors, a synthesized dsDNA fragment of Gal-1 epitope peptide sequence (gBlocks, IDT) was inserted into the specific location of CHIKV E3 envelope protein DNA in pCHIKV or pVEEV vector. pCHIKV or pVEEV vector without any insertion of Gal-1 epitope peptide was used as a control VLP expression vector.
- FreeStyle 293F cells (Thermo Fisher Scientific, #R790-07) were cultured in suspension with FreeStyle 293 Expression medium (Thermo Fisher Scientific, #12338-018) using a shaking incubator (INFORS HT) in the presence of 8% CO 2 at 37°C.
- PEI Polyethylenimine
- the culture supernatant was harvested 4 days post-transfection and clarified by centrifugation (3,000rpm, 10 min) followed by filtration with a 0.45 ⁇ m PES membrane filter system (VWR #10040-470).
- Production of Gal-1 VLP was confirmed by western blot analysis of the filtered culture supernatant without any purification or concentration by using rabbit anti-CHIKV anti-sera (VLP Therapeutics) or mouse anti-VEEV sera (ATCC) and HRP-labeled species specific secondary antibody.
- the VLP-containing culture supernatant was layered onto 1.5 mL of OptiPrep (60 % w/v) Iodixanol, Accurate chemical, #AN1114542) and centrifuged at 52,000 x g for 1.5 hours in SW-28 rotor (Beckman). After removing supernatant to leave 1.5 mL above the interface, two layers were mixed and centrifuged at 360,000 x g for 2.5 hours in NVT100 rotor (Beckman) to form a density gradient.
- OptiPrep 60 % w/v) Iodixanol, Accurate chemical, #AN1114542
- VLPs were collected and purified by size exclusion chromatography using Biologic Duo-Flow FPLC system (Bio-Rad) with HiPrep 16/60 Sephacryl S-500 HR column (GE, #28-9356-06) and phosphate-buffered saline (PBS). Fractions containing VLPs were concentrated by Amicon Ultra-15 centrifugal filter units (EMD Millipore, #UFC910024) and filtered through a 0.20 ⁇ m PES membrane.
- EMD Millipore #UFC910024
- Total protein concentration was measured by BCA Protein Assay (Pierce, #23225) following the manufacturer’s instructions. Purity of the VLP sample was confirmed by SDS-PAGE analysis (Any kD Mini-PROTEAN TGX Precast Protein Gel, Bio-Rad, #456-9035) followed by Coomassie dye-based staining using QC Colloidal Coomassie Stain (Bio-Rad, #1610803). Sucrose and EDTA were added to the VLP solution to the final concentration of 250 mM and 5 mM, respectively. Protein concentration of Gal-1 VLP samples were adjusted to 0.4 mg/mL and store at -80°C.
- 293F cells (10ml) were transfected with 10ug of plasmids encoding the indicated Gal-1 epitope into VEEV VLP. The supernatants were harvested and performed western blotting detecting anti-VEEV mouse sera (1:1000 dilution). The expression of VLPs bearing the Gal-1 epitope peptide #5, #7, #12 and #14 in the supernatant were confirmed (Figure 1)
- VLP solution was thawed and mixed with 2% Alhydrogel adjuvant (10 mg/ml aluminum, Brenntag, #250-843261, Batch #5014) at 1:1 (v/v).
- Mice (8-week-old female, BALB/c, Envigo) were injected with 10 ug (protein) in 0.05 mL intramuscularly into the thigh on Day 1, 4 and 8.
- 10 ug of full-length recombinant human or mouse Gal-1 protein (Sino Bioscience) with Alhydrogel adjuvant were injected to mice in two different groups as controls.
- Blood samples were collected on Day 0 and 15 via submandibular vein and on Day 29 by cardiac puncture. Animal handling, immunization, bleeding, and serum preparation were conducted at Smithers Avanza Toxicology Service (Gaithersburg, MD) following the Guideline of Institutional Animal Care and Use Committee. Whole blood samples were collected in Serum Separation Tubes (Greiner, #450472) and centrifuged at 1,200 x g for 5 min to separate serum. The collected sera were stored at -20 degree until analysis.
- ELISA Assay Gal-1 specific serum antibody titers were determined by indirect ELISA.
- Immunoassay plate (Thermo Fisher Scientific, Maxisorp, #442404) were coated with 100 ⁇ L (500 ng/mL) of recombinant human or mouse Galectin-1 protein (Sino Bioscience, #10290-HNAE and #50100-MNAE) in PBS at 4 degree overnight. After a rinse with TBS-T, wells were blocked with 350 ⁇ L of Blocking buffer (5% Skim milk in TBS-T) for 1 hour at room temperature. Wells were washed 3 times with TBS-T.
- Mouse sera were diluted 1:50 and further diluted serially 1:5 in Blocking buffer to a final dilution 1:781,250. Diluted sera were incubated in the coated wells for 1 hour at room temperature. Wells were washed 5 times with 400 ⁇ L of TBS-T and further incubated with HRP-labeled anti-mouse IgG+M+A antibody (Thermo Fisher, # PA1-84388) for 30 min at room temperature. The plate wells were washed 5 times with TBS-T and incubated with 100 ⁇ L of HRP substrate (SureBlue TMB 1-Component Microwell Peroxidase Substrate, Sera Care, #5120-0076).
- Immunoglobulin class and subclass of anti-Gal-1 antibody in immunized sera were determined by indirect ELISA and subclass specific secondary antibody panel. Immunoassay plates were coated with 100 ⁇ L (500 ng/mL) of recombinant mouse Galectin-1 protein (Sino Bioscience, #50100-MNAE) in PBS at 4 degree overnight. After a rinse with TBS-T, wells were blocked with 350 ⁇ L of Blocking buffer (5% Skim milk in TBS-T) for 1 hour at room temperature. Wells were washed 3 times with TBS-T. Mouse sera were diluted 1:1000 in Blocking buffer. Each diluted serum was transferred to 8 different Gal-1 coated wells and incubated for 1 hour at room temperature.
- Blocking buffer 5% Skim milk in TBS-T
- VLP Chikungunya virus
- VEEV Venezuelan Equine Encephalitis virus
- Total 5 different particles including four Gal-1 VEEV VLP (Table 1, #5, #7, #12 and #14) and control VEEV VLP were prepared.
- Molecular size and purity of Gal-1 VLP and control VLP were analyzed by SDS-PAGE under denatured condition ( Figure 3A). All VLP samples were matched with the theoretical molecular weight and over 90% in purity. Protein bands between 50-75 kDa are fusion protein of Gal-1 peptide and viral structural protein. The molecular weight is varied depends on the length of Gal-1 peptide inserted.
- mice were intramuscularly injected with 10 ⁇ g Gal-1 VLP protein with aluminum hydroxide adjuvant three times in a week.
- anti-Gal-1 antibody titer specific for human or mouse Gal-1 were determined by ELISA respectively.
- Gal-1 peptides conjugated VLP molecules #5, 7, 12 and 14 induced anti-mouse Gal-1 antibodies in mice but recombinant mouse Gal-1 protein did not ( Figure 3D, E).
- Gal-1 #5 and #7 are different human Gal-1 epitope sequence peptides and the VLPs bearong those peptides induced anti-human Gal-1 antibodies.
- Gal-1 VLP #12 and #14 are different mouse Gal-1 epitope peptides and the VLPs bearing those peptides induced anti-mouse Gal-1 antibody efficiently (Figure 3E).
- the Gal-1 peptide #5 and #12 encode four ⁇ -sheet S3, S4, S5 and S6 near the carbohydrate recognition domain (CRD) ( Figure 3B).
- the Gal-1 peptide #7 and #14 encodes F4 and F5 ⁇ -sheet which might be important in homophilic dimerization (Figure 3C).
- the chimeric antigen of self-protein with virus-derived protein displayed on the VLP protein nanoparticles breaks immune tolerance against self-protein and stimulate antibody production efficiently.
- Gal-1 protein is highly conserved between species ( Figure 3F), the sera immunized with Gal-1 epitope peptide from different species induced human or mouse selective anti-Gal-1 antibodies ( Figure 3E).
- the Gal-1 VLP vaccine could effectively stimulate humoral immune response against self-protein.
- Lewis lung carcinoma cells (1x106 cells/100 ⁇ L
- MEER HPV model C57BL6 female, 8 weeks old mice were immunized with 10 ⁇ g VEEV Gal-1 virus-like particle vaccine with 2% alhydrogel adjuvant at 1:1 (v/v) three times on Day 1, 4 and 8 and weekly after Day 15 by intramuscle injection. Control mice were injected Control VEEV VLP vaccine with 2% alhydrogel. On day 15, 200 ⁇ l of blood was collected from each animal prior to tumor inoculation. Blood was processed for plasma and stored at -20 degree. Mice were challenged subcutaneously (s.c.) in the flank with MEER HPV+ cells (1x10 6 cells/100 ⁇ L) in serum-free PBS.
- Galectin-3 (Gal-3) epitope peptides were designed by using protein amino acid sequences and 3D-structure of human and mouse Gal-3 proteins (Table 2).
- pVEEV Gal-3 plasmid DNA vectors a synthesized dsDNA fragment of Gal-3 epitope peptide sequence (gBlocks, IDT) was inserted into specific location (between G at 330-position and S at 335-position)of DNA encoding VEEV E3 envelope protein in pVEEV vector.
- pVEEV vector without any insertion of Gal-1 epitope peptide was used as a control VLP expression vector.
- PEI Polyethylenimine, Polysciences, #23966
- VLP-containing culture supernatant was layered onto 1.5 mL OptiPrep (60 % w/v) Iodixanol, Accurate chemical, #AN1114542) and centrifuged at 52,000 x g for 1.5 hr in SW-28 rotor (Beckmann). After removing supernatant to leave 1.5 mL above the interface, two layers were mixed to make 50 % OptiPrep solution and centrifuged at 360,000 x g for 2.5 hrs in NVT100 rotor (Beckman) to form a density gradient.
- VLPs were collected and purified by size exclusion chromatography using Biologic Duo-Flow FPLC system (Bio-Rad) with Hiprep 16/60 Sephacryl S-500 HR column (GE, #28-9356-06) and phosphate-buffered saline (PBS). Fractions containing VLPs were concentrated by Amicon Ultra-15 centrifugal filter units (EMD Millipore, #UFC910024) and filtered through a 0.20 ⁇ m PES membrane.
- EMD Millipore #UFC910024
- VLP concentration was measured by BCA Protein Assay (Pierce, #23225) following the manufacturer’s instructions. Purity of the VLPs was confirmed by SDS-PAGE analysis (Any kD Mini-PROTEAN TGX Precast Protein Gel, Bio-Rad, #456-9035) followed by Coomassie dye-based staining using QC Colloidal Coomassie Stain (Bio-Rad, #1610803). Sucrose and EDTA were added to the VLP solution at the final concentration of 250 mM and 5 mM, respectively. Protein concentration of VLP samples were adjusted to 0.4 mg/mL and store at -80°C.
- VEEV VLPs comprising Gal-3 epitope peptides and a control VEEV VLP were analyzed by SDS-PAGE under denatured condition (Figure 7). All VLP samples were matched with the theoretical molecular weight and over 90% in purity. Protein bands between 50-75 kDa are fusion protein Gal-3 peptide with VEEV viral structural protein and size variation depends on the length of peptide.
- VLP solution was thawed and mixed with Alhydrogel adjuvant (10 mg/ml aluminium, Brenntag, #250-843261, Batch #5014) at 1:1 (v/v).
- Mice (8-week-old female, BALB/c, Envigo) were injected 10 ug (protein) in 0.05 mL intramuscularly into thigh on Day 1, 4 and 8. Blood samples were collected on Day 0 and 15 via submandibular vein and on Day 29 by cardiac puncture. Animal handling, immunization, bleeding, and serum preparation were conducted at Smithers Avanza Toxicology Service (Gaithersburg, MD) following the Guideline of Institutional Animal Care and Use Committee. Whole blood samples were collected in Serum Separation Tubes (Greiner, #450472) and centrifuged at 1,200 x g for 5 min to separate serum. The collected sera were stored at -20 degree until analysis.
- ELISA Assay Gal-3 specific serum antibody titers were determined by indirect ELISA.
- Immunoassay plate (Thermo Fisher Scientific, Maxisorp, #442404) were coated with 100 uL (500 ng/mL) of recombinant human or mouse Galectin-3 protein (GA3-H5129, AcroBioscience and #599806, Biolegend) in PBS at 4 degree overnight. After a rinse with TBS-T, wells were blocked with 350 uL of Blocking buffer (5% Skim milk in TBS-T) for 1 hour at room temperature. Wells were washed 3 times with TBS-T.
- Mouse sera were diluted 1:50 and further diluted serially 1:5 in Blocking buffer to a final dilution 1:781,250. Diluted sera were incubated in the coated wells for 1 hr at room temperature. Wells were washed 5 times with 400 uL of TBS-T and further incubated with HRP-labeled anti-mouse IgG+M+A antibody (Thermo Fisher, # PA1-84388) for 30 min at room temperature. The plate wells were washed 5 times with TBS-T and incubated with 100 uL of HRP substrate (SureBlue TM TMB 1-Component Microwell Peroxidase Substrate, Sera Care, #5120-0076).
- Gal-3 VLP #17 is consisting of human N-term Gal-3 epitope peptide and induced more anti-human Gal-3 antibodies than anti-mouse Gal-3.
- Gal-3 VLP #23 encodes mouse Gal-3 N-term peptide and induced more anti-mouse Gal-3 antibodies than anti-human Gal-3 antibodies.
- Gal-3 VLP #21 and 22 consisting of human Gal-3 N-term repeat sequence epitope peptide and #22 has longer repeat sequence than that of #21.
- mice 14-day-pregnant female mice (14-day-pregnant female) were obtained from Japan SLC, Inc. (Japan). All animals used in the study were housed and cared for in accordance with the Japanese Pharmacological Society Guidelines for Animal Use. The animals were maintained in a SPF facility under controlled conditions of temperature (23 ⁇ 2°C), humidity (45 ⁇ 10%), lighting (12-hour artificial light and dark cycles; light from 8:00 to 20:00) and air exchange.
- temperature 23 ⁇ 2°C
- humidity 45 ⁇ 10%
- lighting (12-hour artificial light and dark cycles; light from 8:00 to 20:00
- air exchange 12-hour artificial light and dark cycles
- NASH was induced in 25 male mice by a single subcutaneous injection of 200 ⁇ g streptozotocin (STZ, Sigma-Aldrich, USA) solution 2 days after birth and feeding with high fat diet (HFD, 57 kcal% fat, Cat# HFD32, CLEA Japan, Inc., Japan) after 4 weeks of age.
- Gal-3 VLP, control VLP and vehicle were administered intramuscularly (thigh) in a volume of 50 ⁇ L/body. An injection leg was changed each time to avoid local inflammation. The viability, clinical signs and behavior were monitored daily. Body weight was recorded before the treatment. Mice were observed for significant clinical signs of toxicity, moribundity and mortality approximately 60 minutes after each administration.
- the animals were sacrificed at 9 weeks of age by exsanguination through direct cardiac puncture under isoflurane anesthesia (Pfizer Inc.).
- non-fasting blood was collected from facial vein in serum separate tubes without anticoagulant on Day 15 (6 weeks of ages). The collected blood was centrifuged at 3,500 xg for 5 minutes at 4°C. The 20 ⁇ L of supernatant was collected and stored at -80°C for biochemistry. Serum ALT level were measured by FUJI DRI-CHEM 7000 (Fujifilm Corporation, Japan).
- FUJI DRI-CHEM 7000 Flujifilm Corporation, Japan
- HE staining sections were cut from paraffin blocks of liver tissue prefixed in Bouin’s solution and stained with Lillie- Mayer’s Hematoxylin (Muto Pure Chemicals Co., Ltd., Japan) and eosin solution (FUJIFILM Wako Pure Chemical Corporation).
- mice STAM non-alcoholic steatohepatitis (NASH) model mice treated with STZ and fed high-fat diet develop Non-alcoholic fatty liver disease (NAFLD) and NASH at the age of 6-8 weeks.
- Mice treated with control or Gal-3 VLP started at 4-weeks-old and three-times in the first week and then weekly up to 8-weeks-old, total six injections.
- NAS in steatosis There are three different components evaluates for NAS in steatosis, lobular inflammation and hepatocyte ballooning (Table 3, Figures 11A-C). H&E staining liver sections from the study in NASH models were scored and analyzed (Table 4). Liver sections from the Vehicle group exhibited micro- and macro- vesicular fat deposition, hepatocellular ballooning and inflammatory cell infiltration.
- NAS in the Control VLP and Gal-3 #23 VLP groups tended to decrease compared with the Vehicle group ( Figure 11, Table 4. Especially in hepatocyte ballooning score was decrease with VLP vaccine. Though there was no statistically significant difference in total NAS score between any group entered, there was some trend observed in lower ballooning score in groups treated with Control VLP or Gal-3 vaccines.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Virology (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Microbiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Mycology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202280030030.XA CN117222734A (zh) | 2021-04-23 | 2022-04-22 | 靶向半乳凝素的免疫疗法 |
| JP2023564484A JP2024519195A (ja) | 2021-04-23 | 2022-04-22 | ガレクチン標的の免疫療法 |
| EP22791828.1A EP4326858A4 (en) | 2021-04-23 | 2022-04-22 | GALECTIN-TARGETED IMMUNOTHERAPY |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163178755P | 2021-04-23 | 2021-04-23 | |
| US63/178755 | 2021-04-23 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022225057A1 true WO2022225057A1 (en) | 2022-10-27 |
Family
ID=83723024
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/JP2022/018610 Ceased WO2022225057A1 (en) | 2021-04-23 | 2022-04-22 | Galectin-targeting immunotherapy |
Country Status (5)
| Country | Link |
|---|---|
| US (1) | US20220347261A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4326858A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2024519195A (cg-RX-API-DMAC7.html) |
| CN (1) | CN117222734A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2022225057A1 (cg-RX-API-DMAC7.html) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023204148A1 (en) * | 2022-04-18 | 2023-10-26 | Cyn-K, Llc | Treatment of inflammatory conditions |
| WO2025084276A1 (ja) * | 2023-10-16 | 2025-04-24 | Cyn-Kバイオ株式会社 | 肥満の処置 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016021209A1 (en) * | 2014-08-08 | 2016-02-11 | Vlp Therapeutics, Llc | Virus like particle comprising modified envelope protein e3 |
| WO2017009400A1 (en) * | 2015-07-15 | 2017-01-19 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against epithelial ovarian cancer and other cancers |
| WO2017074235A1 (en) * | 2015-10-29 | 2017-05-04 | Theravac Pharmaceuticals Ab | A novel fusion partner for safe vaccines |
| WO2018029586A1 (en) * | 2016-08-07 | 2018-02-15 | Novartis Ag | Mrna-mediated immunization methods |
| WO2018138257A1 (en) * | 2017-01-27 | 2018-08-02 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against ovarian cancer and other cancers |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6753314B1 (en) * | 1999-04-01 | 2004-06-22 | Curagen Corporation | Protein-protein complexes and methods of using same |
| EP2370455B1 (en) * | 2008-11-26 | 2019-07-03 | Government of the United States of America, as represented by the Secretary, Department of Health and Human Services | Virus like particle compositions and methods of use |
| SI3573647T1 (sl) * | 2017-01-27 | 2023-07-31 | Immatics Biotechnologies Gmbh | Peptidi in kombinacija peptidov za uporabo v imunoterapiji proti raku jajčnikov in drugim oblikam raka |
| US11407797B2 (en) * | 2017-10-11 | 2022-08-09 | University Of Florida Research Foundation, Incorporated | Modified gal-1 proteins and uses thereof |
-
2022
- 2022-04-22 EP EP22791828.1A patent/EP4326858A4/en active Pending
- 2022-04-22 JP JP2023564484A patent/JP2024519195A/ja active Pending
- 2022-04-22 US US17/726,623 patent/US20220347261A1/en active Pending
- 2022-04-22 WO PCT/JP2022/018610 patent/WO2022225057A1/en not_active Ceased
- 2022-04-22 CN CN202280030030.XA patent/CN117222734A/zh active Pending
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016021209A1 (en) * | 2014-08-08 | 2016-02-11 | Vlp Therapeutics, Llc | Virus like particle comprising modified envelope protein e3 |
| WO2017009400A1 (en) * | 2015-07-15 | 2017-01-19 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against epithelial ovarian cancer and other cancers |
| WO2017074235A1 (en) * | 2015-10-29 | 2017-05-04 | Theravac Pharmaceuticals Ab | A novel fusion partner for safe vaccines |
| WO2018029586A1 (en) * | 2016-08-07 | 2018-02-15 | Novartis Ag | Mrna-mediated immunization methods |
| WO2018138257A1 (en) * | 2017-01-27 | 2018-08-02 | Immatics Biotechnologies Gmbh | Novel peptides and combination of peptides for use in immunotherapy against ovarian cancer and other cancers |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4326858A4 * |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023204148A1 (en) * | 2022-04-18 | 2023-10-26 | Cyn-K, Llc | Treatment of inflammatory conditions |
| WO2025084276A1 (ja) * | 2023-10-16 | 2025-04-24 | Cyn-Kバイオ株式会社 | 肥満の処置 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4326858A4 (en) | 2025-03-12 |
| JP2024519195A (ja) | 2024-05-09 |
| EP4326858A1 (en) | 2024-02-28 |
| US20220347261A1 (en) | 2022-11-03 |
| CN117222734A (zh) | 2023-12-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| JP7641512B2 (ja) | Tlr7アゴニストにカップリングする新規コロナウイルスポリペプチドワクチンおよびその適用 | |
| KR102638978B1 (ko) | Rsv에 대한 백신 | |
| JP2023533772A (ja) | SARS-CoV-2及びインフルエンザ混合ワクチン | |
| KR20220010478A (ko) | 기도 감염의 치료 또는 예방용 서브유닛 백신 | |
| JP2023514348A (ja) | 2019-nCoV(SARS-CoV-2)ワクチン | |
| CN105792842A (zh) | 埃巴病毒疫苗 | |
| CN115989036B (zh) | Rsv疫苗组合物、方法及其用途 | |
| WO2022225057A1 (en) | Galectin-targeting immunotherapy | |
| JP2023523423A (ja) | SARS-CoV-2に対するワクチン及びその調製物 | |
| US20230241203A1 (en) | Enhancing immune responses through targeted antigen expression | |
| US12344636B2 (en) | Respiratory syncytial virus recombinant F protein and vaccine composition containing same | |
| CN109923125B (zh) | 免疫原性组合物 | |
| JP2023540778A (ja) | Ace2結合力が減少したコロナウイルス由来の受容体結合ドメイン変異体及びこれを含むワクチン組成物 | |
| WO2023204148A1 (en) | Treatment of inflammatory conditions | |
| US20230310584A1 (en) | Nucleic acids encoding a polypeptide comprising a modified fc region of a human igg1 and at least one heterologous antigen | |
| US20250057933A1 (en) | Rhinovirus Vaccine | |
| CN118108812B (zh) | Rsv f蛋白的突变体 | |
| KR20260023012A (ko) | Rsv 백신 조성물, 방법 및 이의 용도 | |
| CN118176204A (zh) | 截短的流感神经氨酸酶及其使用方法 | |
| WO2025084276A1 (ja) | 肥満の処置 | |
| WO2010043232A1 (en) | Potato virus a coat protein-based vaccine for treating melanoma and its use | |
| RU2811991C2 (ru) | Субъединичная вакцина для лечения или предотвращения инфекции дыхательных путей | |
| EP4653469A1 (en) | Fusion protein of ge and gi of varicella-zoster virus and use | |
| CN117045781A (zh) | 一种基于分子佐剂的广谱型h9亚型禽流感ha亚单位黏膜疫苗及其制备方法和应用 | |
| HK40106052A (zh) | Rsv f蛋白的突变体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22791828 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280030030.X Country of ref document: CN Ref document number: 2023564484 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022791828 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022791828 Country of ref document: EP Effective date: 20231123 |