WO2022218891A2 - Rna compositions comprising a buffer substance and methods for preparing, storing and using the same - Google Patents
Rna compositions comprising a buffer substance and methods for preparing, storing and using the same Download PDFInfo
- Publication number
- WO2022218891A2 WO2022218891A2 PCT/EP2022/059555 EP2022059555W WO2022218891A2 WO 2022218891 A2 WO2022218891 A2 WO 2022218891A2 EP 2022059555 W EP2022059555 W EP 2022059555W WO 2022218891 A2 WO2022218891 A2 WO 2022218891A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- alkylene
- composition
- independently selected
- alkyl
- hydroxyethyl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/7105—Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/48—Preparations in capsules, e.g. of gelatin, of chocolate
- A61K9/50—Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
- A61K9/51—Nanocapsules; Nanoparticles
- A61K9/5107—Excipients; Inactive ingredients
- A61K9/5123—Organic compounds, e.g. fats, sugars
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
- A61K47/10—Alcohols; Phenols; Salts thereof, e.g. glycerol; Polyethylene glycols [PEG]; Poloxamers; PEG/POE alkyl ethers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
- A61K47/183—Amino acids, e.g. glycine, EDTA or aspartame
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/22—Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/14—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles
- A61K9/19—Particulate form, e.g. powders, Processes for size reducing of pure drugs or the resulting products, Pure drug nanoparticles lyophilised, i.e. freeze-dried, solutions or dispersions
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/20011—Coronaviridae
- C12N2770/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the present disclosure relates generally to the field of RNA compositions comprising a buffer substance, methods for preparing and storing such compositions, and the use of such compositions in therapy.
- RNA recombinant nucleic acid
- the advantages of using RNA include transient expression and a nontransforming character. RNA does not need to enter the nucleus in order to be expressed and moreover cannot integrate into the host genome, thereby eliminating diverse risks such as oncogenesis.
- a recombinant nucleic acid may be administered in naked form to a subject in need thereof; however, usually a recombinant nucleic acid is administered using a composition.
- RNA may be delivered to a subject using different delivery vehicles, based mostly on cationic polymers or lipids which together with the RNA form nanoparticles.
- the nanoparticles are intended to protect the RNA from degradation, enable delivery of the RNA to the target site and facilitate cellular uptake and processing by the target cells.
- RNA delivery depends, in part, on the molecular composition of the nanoparticle and can be influenced by numerous parameters, including particle size, formulation, and charge or grafting with molecular moieties, such as polyethylene glycol (PEG) or other ligands.
- PEG polyethylene glycol
- the fate of such nanoparticle formulations is controlled by diverse key-factors (e.g., size and size distribution of the nanoparticles; etc.). These factors are, e.g., referred to in the FDA "Liposome Drug Products Guidance" from 2018 as specific attributes which should be analyzed and specified.
- the limitations to the clinical application of current nanoparticle formulations may lie in the lack of homogeneous, pure and well-characterized nanoparticle formulations.
- Nanoparticles comprising ionizable lipids may display advantages in terms of targeting and efficacy in comparison to other RNA nanoparticle products. However, it is challenging to obtain sufficient shelf life as required for regular pharmaceutical use. It is said that for stabilization, nanoparticles comprising ionizable lipids need to be frozen at much lower temperatures, such as -80°C, which poses substantial challenges on the cold chain, or they can only be stored above the freezing temperature, e.g. 5°C, where only limited stability can be obtained.
- RNA in solution or in nanoparticles undergoes slow fragmentation. Furthermore, in the presence of phosphate buffered saline (PBS), RNA has the tendency to adopt a very stable folded form which is hardly accessible for translation. Both mechanisms, i.e., fragmentation and formation of this stable RNA fold (also called “light migrating species (LMS)”), are temperature dependent and result in loss of intact and accessible RNA thereby limiting the stability of the liquid product; however, they are essentially absent in the frozen state.
- PBS phosphate buffered saline
- compositions which comprise ionizable lipids and RNA and which are stable and can be stored in a temperature range compliant to regular technologies in pharmaceutical practice, in particular at a temperature of about -25°C or even in liquid form at temperatures between +2 and +20°C; (ii) compositions which are ready to use; (iii) compositions which, preferably, can repeatably be frozen and thawed; and (iv) methods for preparing and storing such compositions.
- the present disclosure addresses these and other needs.
- compositions and methods described herein fulfill the above- mentioned requirements.
- a specific buffer substance in particular triethanolamine (TEA) and its protonated form, it is possible to prepare compositions which are stable and which can be stored in liquid form.
- TAA triethanolamine
- the present disclosure provides a composition
- a composition comprising (i) RNA; (ii) a cationically ionizable lipid; and (iii) an aqueous phase
- the aqueous phase comprises a buffer system comprising a buffer substance having the formula N(R’)(R 2 )(R 3 ), its N-oxide, or a protonated form thereof, wherein: each of R 1 , R 2 , and R 3 is independently selected from H, C 1 - 6 alkyl, C 1 - 6 alkylene-R 4 , CH(C 1-5 alkylene-R 4 )2, and C(C 1-5 alkylene-R 4 )3, wherein at most one of R 1 , R 2 , and R 3 is H, CH(C 1-5 alkylene-R 4 )2, or C(C 1-5 alkylene-R 4 ); ⁇ ; or two of R 1 , R 2 , and R 3 join together with the nitrogen atom to form a 5- or 6-
- RNA composition As demonstrated in the present application, using a buffer system based on the particular buffer substances specified above, in particular TEA and its protonated form, instead of PBS in an RNA composition inhibits the formation of a very stable folded form (also called "light migrating species (LMS)" herein) of RNA. Furthermore, the present application demonstrates that, surprisingly, by using this buffer system, it is possible to obtain an RNA composition having improved RNA integrity after storage in liquid form for about 3 months. Thus, the claimed composition provides improved stability, can be stored in a temperature range compliant to regular technologies in pharmaceutical practice, and provides a ready-to-use composition.
- LMS light migrating species
- the present disclosure provides a composition comprising (i) RNA; and (ii) an aqueous phase, wherein the aqueous phase comprises a buffer system comprising a buffer substance having the formula N(R')(R 2 )(R 3 ), its N-oxide, or a protonated form thereof, wherein each of R 1 , R 2 , and R 3 is independently selected from II, C M alkyl, C M alkylene-R 4 , CH(C 1-5 alkylene-R 4 )?, and C(C 1-5 alkylene-R 4 )?, wherein at most one of R 1 , R 2 , and R 3 is H, CH(C 1-5 alkylene-R 4 ) 2 , or C(CM alkylene- R 4 ) ?
- a buffer system comprising a buffer substance having the formula N(R')(R 2 )(R 3 ), its N-oxide, or a protonated form thereof, wherein each of R 1 , R 2 ,
- each R 4 is independently selected from -OH, -0-(CM alkylene-OH), and -N(R 6 ) Z -(CM alkylene-OH) 2-z , wherein each z is independently selected from 0 and 1 ; and each R 6 is independently selected from H and C M alkyl; and each R 5 is independently selected from CM alkyl, CM alkylene-R 4 , CH(C 1-5 alkylene-R 4 ) ? , and C(C 1-5 alkylene- R 4 )?.
- each of R 1 , R 2 , and R 3 is independently selected from Ci-6 alkyl, Ci-6 alkylene-R 4 , CH(CM alkylene-R 4 )?, and C(Ci- 5 alkylene-R 4 ) ? , wherein at most one of R 1 , R 2 , and R 3 is CH(CM alkylene-R 4 )? or C(CM alkylene-R 4 )?, preferably each of R 1 , R 2 , and R 3 is independently selected from C M alkyl, C 1-4 alkylene-R 4 , CH(C M alkylene-R 4 ) ? , and C(C K?
- alkylene- R 4 )3 wherein at most one of R 1 , R 2 , and R 3 is CH(CM alkylene-R 4 ) 2 or C(C M alkylene-R 4 ) ? , more preferably each of R 1 , R 2 , and R 3 is independently selected from C 1.3 alkyl, C 1-3 alkylene-R 4 , CH(C M alkylene-R 4 )?, and C(CM alkylene-R 4 )3, wherein at most one of R 1 , R 2 , and R 3 is CH(C M alkylene-R 4 ) ?
- each of R 1 , R 2 , and R 3 is independently selected from C 1-2 alkyl, Ci - 2 alkylene-R 4 , CH(C I-2 alkylene-R 4 ) 2 , and C(C 1-2 alkylene-R 4 ) 3 , wherein at most one of R 1 , R 2 , and R 3 is CH(C I-2 alkylene-R 4 ) 2 or C(C M alkylene-R 4 ) 3 .
- each of R 1 , R 2 , and R 3 may be independently selected from CM alkyl, C M alkylene-R 4 , and C(C M alkylene-R 4 ) ?
- R 1 , R 2 , and R 3 are C(C 1-5 alkylene-R 4 ) 3 , preferably each of R 1 , R 2 , and R 3 is independently selected from Ci- 4 alkyl, C 1-4 alkylene-R 4 , and C(CM alkylene-R 4 ) 3 , wherein at most one of R 1 , R 2 , and R 3 is C(Ci_ 3 alkylene-R 4 )?, more preferably each of R 1 , R 2 , and R 3 is independently selected from C K? alkyl, Ci- 3 alkylene-R 4 , and C(CM alkylene-R 4 ) ?
- R 1 , R 2 , and R 3 are C(C M alkylene- R 4 ) 3 , more preferably each of R 1 , R 2 , and R 3 is independently selected from C M alkyl, C M alkylene-R 4 , and C(CM alkylene-R 4 ) ? , wherein at most one of R 1 , R 2 , and R 3 is C(C M alkylene-R 4 ) ? .
- each of R 1 , R 2 , and R 3 is independently selected from C M alkyl and C M alkylene-R 4 , preferably each of R 1 , R 2 , and R 3 is independently selected from C M alkyl and C M alkylene-R 4 , more preferably each of R 1 , R 2 , and R 3 is independently selected from C M alkyl and C M alkylene-R 4 , more preferably each of R 1 , R 2 , and R 3 is independently selected from CM alkyl and C M alkylene-R 4 .
- each R 4 is independently selected from -OH, -O- (C 1-4 alkylene-OH), and -N(R 6 ) Z -(C M alkylene-OH) 2-z , wherein each z is independently selected from 0 and 1 ; and each R 6 is independently selected from H and C M alkyl, preferably each R 4 is independently selected from -OH, -0-(Ci-i alkylene-OH), and -N(R 6 ) Z -(C I _3 alkyl ene-OH) ?-?
- each z is independently selected from 0 and 1 ; and each R 6 is independently selected from H and C 1.3 alkyl, more preferably each R 4 is independently selected from -OH, -0-(C 1-2 alkylene-OH), and -N(R 6 ) Z -(C I -2 alkylene-OH)2.
- z wherein each z is independently selected from 0 and 1 ; and each R 6 is independently selected from H and C 1-2 alkyl.
- each R 4 may independently be selected from -OH, -0-(Ci- 4 alkylene-OH), and -N(C 1-4 alkylene-OH)2, preferably each R 4 is independently selected from -OH, -O- (C 1-3 alkylene-OH), and -N(C I -3 alkylene-OH)2, more preferably each R 4 is independently selected from -OH, -0-(C 1-2 alkylene-OH), and -N(C I -2 alkylene-OH)2.
- each R 4 is independently selected from -OH, 2-hydroxyethoxy, and bis(2-hydroxyethyl)amino.
- any one (or each) of R 1 , R 2 , and R 3 is C 1-6 alkylene-R 4 and R 4 is OH
- the alkylene group has 2 to 6 carbon atoms, such as 2 to 4, e.g., 2, 3, or 4 carbon atoms.
- any one (or each) of R 1 , R 2 , and R 3 preferably is C 2-6 alkylene-OH, more preferably C 2-4 alkylene-OH, more preferably C 2-3 alkylene-OH, such as C 2 alkylene-OH.
- each of R 1 , R 2 , and R 3 is independently selected from methyl, ethyl, 2-hydroxyethyl, 2-(2-hydroxyethoxy)ethyl, 2-[bis(2-hydroxyethyl)amino]ethyl, and l,5-dihydroxy-3-(2-hydroxyethyl)pentan-3-yl.
- all of R 1 , R 2 , and R 3 are the same.
- all of R 1 , R 2 , and R 3 may be methyl, ethyl, or 2-hydroxyethyl.
- R 1 and R 2 are the same and R 3 differs from R 1 and R 2 .
- each of R 1 and R 2 may be 2-hydroxyethyl or methyl; and/or R 3 is selected from methyl, ethyl, 2-hydroxyethyl, 2-(2-hydroxyethoxy)ethyl, 2-[bis(2-hydroxyethyl)amino]ethyl, and 1,5- dihydroxy-3-(2-hydroxyethyl)pentan-3-yl.
- R 1 and R 2 join together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring which is optionally substituted with one or two R 5 .
- R 3 is selected from C 1 - 6 alkyl, CM alkylene-R 4 , and C(C 1-5 alkylene-R 4 ) ?
- R 3 is selected from C 1.4 alkyl, C M alkylene-R 4 , and C(Ci- 3 alkylene-R 4 )3, more preferably R 3 is selected from Ci -3 alkyl, C 1-3 alkylene-R 4 , and C(Ci- 3 alkylene-R 4 )?, more preferably R 3 is selected from C 1-2 alkyl, C1-2 alkylene-R 4 , and C(Cj_2 alkylene-R 4 ) ?
- R 3 is selected from selected from methyl, ethyl, 2-hydroxyethyl, 2-(2-hydroxyethoxy)ethyl, and 2-[bis(2-hydroxyethyl)amino]ethyl
- the N-heterocyclic ring is a monocyclic ring containing at least one nitrogen ring atom and optionally one further ring heteroatom selected from O and S.
- the N-heterocyclic ring may be a monocyclic ring containing (i) one nitrogen ring atom; (ii) two nitrogen ring atoms; (iii) one nitrogen ring atom and one oxygen ring atom; (iv) one nitrogen ring atom and one sulfur ring atom; or (v) three nitrogen ring atoms.
- the N-heterocyclic ring is a monocyclic 5- or 6- membered N-heterocyclic ring, such as is a monocyclic 6-membered N-heterocyclic ring.
- N-heterocyclic ring examples include pyrrolidinyl, imidazolidinyl, pyrazolidinyl, oxazolidinyl, thiazolidinyl, piperidinyl, piperazinyl, 1 ,2-diazinanyl, 1,3-diazinanyl, 1,3,5-triazinanyl, morpholinyl, and thiomorpholinyl.
- the N-heterocyclic ring is selected from piperidinyl, piperazinyl, 1 ,2- diazinanyl, 1,3-diazinanyl, morpholinyl, and thiomorpholinyl.
- the N- heterocyclic ring contains only one nitrogen ring atom; in these embodiments, it is preferred that this nitrogen ring atom is substituted with R 3 , R 3 being other than H. In some embodiments, the N- heterocyclic ring contains more than one nitrogen ring atom; in these embodiments, it is preferred that one nitrogen ring atom is substituted with R 3 , R 3 being other than H, and at least one of the other nitrogen ring atoms, preferably each of the other nitrogen ring atoms, is substituted with R 5 .
- each R 5 is independently selected from Ci-6 alkyl, Ci-6 alkylene-R 4 , and C(C KS alkylene- R 4 )3, preferably R 5 is selected from Ci-4 alkyl, C M alkylene-R 4 , and C(Ci-3 alkylene-R 4 )3, more preferably R 5 is selected from C1-3 alkyl, C1-3 alkylene-R 4 , and C(Ci-3 alkylene-R 4 ) ?
- R 5 is selected from C1-2 alkyl, C1-2 alkylene-R 4 , and C(Ci-2 alkylene-R 4 )3, more preferably R 5 is selected from selected from methyl, ethyl, 2-hydroxyethyl, 2-(2-hydroxyethoxy)ethyl, and 2-[bis(2- hydroxyethyl)amino] ethyl .
- the N-heterocyclic ring is piperidinyl and the ring N atom is substituted with R 3 , R 3 being other than H.
- the N-heterocyclic ring is piperazinyl, one the two ring N atoms is substituted with R 3 , R 3 being other than H, and the other ring N atom is optionally substituted with R 5 , preferably the other ring N atom is substituted with R 5 .
- the N-heterocyclic ring is piperazinyl and both ring N atoms are substituted, wherein one of the two ring N atoms is substituted with R 3 , R 3 being other than H, and the other ring N atom is substituted with R 5 , wherein preferably R 5 is selected from CM alkyl, CM alkylene-R 4 , and C(C 1-5 alkylene-R 4 )3, more preferably R 5 is selected from C M alkyl, C M alkylene-R 4 , and C(Ci_3 alkylene-R 4 ) ?
- R 5 is selected from C 1-3 alkyl, C1-3 alkylene-R 4 , and C(Ci-3 alkylene-R 4 ) ?
- R 5 is selected from C1-2 alkyl, C1-2 alkylene-R 4 , and C(Ci_2 alkylene-R 4 ) ?
- R 5 is selected from selected from methyl, ethyl, 2-hydroxyethyl, 2-(2-hydroxyethoxy)ethyl, and 2-[bis(2- hydroxyethyl)amino] ethyl .
- each R 4 is independently selected from -OH, -0-(Ci- 4 alkylene-OH), and -N(C M alkylene-OH)2, preferably each R 4 is independently selected from -OH, -0-(Cifax 3 alkylene-OH), and -N(C I-3 alkylene-OHk, more preferably each R 4 is independently selected from -OH, -0-(C 1-2 alkylene-OH), and -N(C I-2 alkylene-OHk.
- each R 4 is independently selected from -OH, 2-hydroxyethoxy, and bis(2- hydroxyethyl)amino.
- R 1 and R 2 join together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring
- any one (or each) of R 3 and R 5 is C 1 - 6 alkylene-R 4 and R 4 is OH
- the alkylene group has 2 to 6 carbon atoms, such as 2 to 4, e.g., 2, 3, or 4 carbon atoms.
- any one (or each) of R 3 and R 5 preferably is C 2-6 alkylene-OH, more preferably C 2-4 alkylene-OH, more preferably C 2-3 alkylene-OH, such as C 2 alkylene-OH.
- R 3 and R 5 are the same, hi some of the above embodiments where R 1 and R 2 join together with the nitrogen atom to form a 5- or 6-membered N- heterocyclic ring, both of R 3 and R 5 are methyl, ethyl, 2-hydroxyethyl, or 2-(2-hydroxyethoxy)ethyl, preferably, both of R 3 and R 5 are 2-hydroxyethyl. In some of the above embodiments where R 1 and R 2 join together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring, R 3 and R 5 differ from each other.
- R 1 is H.
- each of R 2 and R 3 is independently selected from Ci-6 alkyl, C M alkylene-R 4 , CH(C 1-5 alkylene-R 4 ) 2 , and C(C M alkylene- R 4 )j, wherein at most one of R 2 and R 3 is CH(C 1-5 alkylene-R 4 ) 2 or C(C M alkylene-R 4 ) 3 , preferably each of R 2 and R 3 is independently selected from C M alkyl, C M alkylene-R 4 , CH(C I -3 alkylene-R 4 ) 2 , and C(C)- 3 alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is CH(CI-3 alkylene-R 4 )2 or C(C M alkylene-R 4 )3, more preferably each of R 2 and R 3 is independently selected from C 1-3 alkyl, C 1 -3 alkylene-R 4
- each of R 2 and R 3 may be independently selected from C M alkyl, C M alkylene-R 4 , and C(Ci- 5 alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is C(C]- 5 alkylene-R 4 ) 3 , preferably each of R 2 and R 3 is independently selected from C M alkyl, C M alkylene-R 4 , and C(Ci_3 alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is C(Ci-3 alkylene-R 4 )3, more preferably each of R 2 and R 3 is independently selected from C 1-3 alkyl, C 1-3 alkylene-R 4 , and C(C M alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is C(Ci- 3 alkylene-R 4 ) 3 , more preferably each of R 2 and R 3 is independently selected from C 1-2 alkyl, C 1-2 alkylene
- each of R 2 and R 3 is independently selected from C M alkyl and C M alkylene-R 4 , preferably each of R 2 and R 3 is independently selected from Ci - 4 alkyl and C M alkylene-R 4 , more preferably each of R 2 and R 3 is independently selected from Ci -3 alkyl and C 1-3 alkylene-R 4 , more preferably each of R 2 and R 3 is independently selected from C 1-2 alkyl and C 1-2 alkylene-R 4 .
- each R 4 is independently selected from -OH, -0-(C 1-4 alkylene- OH), and -N(C 1-4 alkylene-OH) 2 , preferably each R 4 is independently selected from -OH, -0-(Ci-3 alkylene-OH), and -N(Ci_ 3 alkylene-OHfr, more preferably each R 4 is independently selected from -OH, -0-(Ci-2 alkylene-OH), and -N(CI-2 alkylene-OH)2.
- each R 4 may be independently selected from -OH, 2-hydroxyethoxy, and bis(2-hydroxyethyl)amino.
- any one (or each) of R 2 and R 3 is Ci -6 alkylene-R 4 and R 4 is OH
- the alkylene group has 2 to 6 carbon atoms, such as 2 to 4, e.g., 2, 3, or 4 carbon atoms.
- any one (or each) of R 2 and R 3 preferably is C2-6 alkylene-OH, more preferably C2-4 alkylene-OH, more preferably C2-3 alkylene-OH, such as C2 alkylene-OH.
- each of R 2 and R 3 is independently selected from 2-hydroxyethyl, 2-(2-hydroxyethoxy)ethyl, and 2-[bis(2-hydroxyethyl)amino]ethyl, preferably, both of R 2 and R 3 are 2- hydroxyethyl or 2-(2-hydroxyethoxy)ethyl.
- the buffer substance comprises or is a tertiary amine as defined herein (i.e., N(R*)(R 2 )(R 3 ), wherein none of R 1 , R 2 , and R 3 is H) or a protonated form thereof.
- each of R 1 , R 2 , and R 3 is independently selected from C j.
- the tertiary amine is a monoamine.
- the tertiary amine is selected from the group consisting of bis(2-hydroxyethyl)amino-tris(hydroxymethyl)methane (Bis-Tris-methane or BTM), triethanolamine (TEA), ethyldiethanolamine, 2-(diethylamino)ethan- 1 -ol , triethylamine, and 2-[2- (diethy lamino)ethoxy] ethan- 1 -ol .
- the tertiary amine comprises or is triethanolamine (TEA).
- the buffer substance comprises or is a cyclic amine as defined herein (i.e. , N(R*)(R 2 )(R 3 ), wherein two of R 1 , R 2 , and R 3 join together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring which is optionally substituted with one or two R 5 ) or a protonated form thereof.
- R 1 and R 2 join together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring which is optionally substituted with one or two R 5 , as specified above.
- the cyclic amine is selected from the group consisting of N,N'- bis(2-hydroxyethyl)piperazine and morpholine substituted with one or more C 1 - 6 alkylene-R 4 (such as 2-hydroxyethyl) moieties.
- the buffer substance comprises or is a secondary amine as defined herein (i.e., N(R')(R 2 )(R 3 ), wherein one of R 1 , R 2 , and R 3 is H) or a protonated form thereof.
- R 1 is H and each of R 2 and R 3 is independently selected from Q-c, alkyl, Ci-6 alkylene-R 4 , CH(C 1-5 alkylene-R 4 )2, and C(Ci_5 alkylene-R 4 )3, wherein at most one of R 2 and R 3 is CH(C 1-5 alkylene-R 4 )2, or C(C 1-5 alkylene-R 4 ) 3 , as specified above.
- the buffer substance comprises or is an N-oxide.
- the N-oxide is trimethylamine N-oxide.
- the buffer substance comprises at least one Ci-e alkylene-R 4 moiety.
- R 4 is OH
- the alkylene group has 2 to 6 carbon atoms, such as 2 to 4, e.g., 2, 3, or 4 carbon atoms.
- the buffer substance comprises at least one C 1 - 6 alkylene-R 4 moiety and R 4 is OH
- the at least one C 1 - 6 alkylene-R 4 moiety preferably is C2-6 alkylene-OH, more preferably C2-4 alkylene-OH, more preferably C2-3 alkylene-OH, such as C2 alkylene-OH or 2-hydroxyethyl.
- the buffer substance is selected from bis(2- hydroxyethyl)amino-tris(hydroxymethyl)methane (Bis-Tris-methane or BTM) and its protonated form, triethanolamine (TEA) and its protonated form, ethyldiethanolamine and its protonated form, 2- (diethylamino)ethan-l-ol and its protonated form, triethylamine and its protonated form, 2-[2- (diethylamino)ethoxy]ethan-l -ol and its protonated form, diethanolamine and its protonated form, N,N'- bis(2-hydroxyethyl)piperazine and its protonated form, N,N,N',N'-tetrakis(2- hydroxyethyl)ethylenediamine and its protonated form, and trimethylamine N-oxide and its protonated form.
- BTM Bis(2- hydroxyethyl)amino-tris(hydroxymethyl)
- the buffer substance is selected from bis(2-hydroxyethyl)amino- tris(hydroxymethyl)methane (Bis-Tris-methane or BTM) and its protonated form, triethanolamine (TEA) and its protonated form, ethyldiethanolamine and its protonated form, 2-(diethylamino)ethan-l- ol and its protonated form, triethylamine and its protonated form, 2-[2-(diethylamino)ethoxy]ethan- 1 -ol and its protonated form, and N,N'-bis(2-hydroxyethyl)piperazine and its protonated form.
- the buffer substance comprises or is triethanolamine (TEA) or its protonated form.
- the concentration of the buffer substance in the composition is between about 10 mM and about 200 niM, such as between about 20 niM and about 180 mM, between about 30 mM and about 170 mM, between about 40 mM and about 160 mM, between about 50 mM and about 50 mM, between about 60 mM and about 140 mM, between about 70 mM and about 130 mM, between about 80 mM and about 120 mM, between about 90 mM and about 110 mM.
- the concentration of the buffer substance in the composition is between about 15 mM and about 100 mM, preferably between about 20 mM and about 80 mM, more preferably between about 40 mM and about 60 mM, such as about 50 mM.
- the buffer system further comprises an anion. In some embodiments, this anion can act as further buffer substance.
- the anion is selected from anions of inorganic and/or organic acids (in particular, when the desired pH of the composition is at least 2.5 pH units lower than the pKa of the buffer substance the formula N(R')(R 2 )(R 3 ), its N-oxide, or a protonated form thereof).
- the anion is selected from the group consisting of chloride, acetate, glycolate, lactate, and the anion of a di- or tricarboxylic acid, such as the anion of citric acid, succinic acid, malonic acid, glutaric acid, or adipic acid.
- the concentration of the anion in the composition is at least equal to the concentration of the buffer substance in the composition.
- the concentration of the anion in the composition may be higher than the concentration of the buffer substance in the composition.
- the concentration of the buffer substance in the composition is x being within in the range between about 10 mM and about 200 mM
- the concentration of the anion in the composition is at least equal to x, e.g., higher than x.
- the pH of the composition is between about 4.0 and about 8.0.
- the pH of the composition may be between about 4.5 and about 8.0, such as between about 5.0 and about 8.0, between about 5.5 and about 8.0, between about 6.0 and about 8.0, between about 6.5 and about 8.0, between about 6.8 and about 7.9, between about 7.0 and about 7.8, or about 7.5.
- water is the main component in the composition and or the total amount of solvent(s) other than water contained in the composition is less than about 1.0% (v/v), such as less than about 0.5% (v/v).
- the amount of water contained in the composition may be at least 50% (w/w), such as at least at least 55% (w/w), at least 60% (w/w), at least 65% (w/w), at least 70% (w/w), at least 75% (w/w), at least 80% (w/w), at least 85% (w/w), at least 90% (w/w), or at least 95% (w/w).
- the amount of water contained in the composition may be at least 50% (w/w), such as at least at least 55% (w/w), at least 60% (w/w), at least 65% (w/w), at least 70% (w/w), at least 75% (w/w), at least 80% (w/w), at least 85% (w/w), or at least 90% (w/w). If the composition is substantially free of a cryoprotectant, the amount of water contained in the composition may be at least 95% (w/w).
- the total amount of solvent(s) other than water contained in the composition may be less than about 1.0% (v/v), such as less than about 0.9% (v/v), less than about 0.8% (v/v), less than about 0.7% (v/v), less than about 0.6% (v/v), less than about 0.5% (v/v), less than about 0.4% (v/v), less than about 0.3% (v/v), less than about 0.2% (v/v), less than about 0.1% (v/v), less than about 0.05% (v/v), or less than about 0.01% (v/v).
- a cryoprotectant which is liquid under normal conditions will not be considered as a solvent other than water but as cryoprotectant.
- the total amount of solvent(s) other than water contained in the composition may be less than about 1.0% (v/v), such as less than about 0.5% (v/v), does not apply to cryoprotectants which are liquids under normal conditions.
- the osmolality of the composition is at most about 1000 x 10 ' osmol/kg, such as between about 100 x 10 "3 osmol/kg and about 750 x 10 -3 osmol/kg.
- the osmolality of the composition is at most about 500 x 10 "3 osmol/kg, such as at most about 490 x 10 '3 osmol/kg, at most about 480 x 10 ⁇ 3 osmol/kg, at most about 470 x 10 '3 osmol/kg, at most about 460 x 10 '3 osmol/kg, at most about 450 x lO "3 osmol/kg, at most about 440 x 10 '3 osmol/kg, at most about 430 x 10 3 osmol/kg, at most about 420 x 10 ⁇ 3 osmol/kg, at most about 410 x 10 '3 osmol/kg, at most about 400 x 10 '3 osmol/kg, at most about 390 x 10 ⁇ 3 osmol/kg, at most about 380 x 10 '3 osmol/kg, at most about 370 x 10
- the osmolality of the composition may be below 300 x 10 "3 osmol/kg, such as at most about 250 x 10 3 osmol/kg, at most about 200 x 1 O ’ ’ osmol/kg, at most about 150 x 10 '3 osmol/kg, at most about 100 x 10 3 osmol/kg, at most about 50 x 10 '3 osmol/kg, at most about 40 x 10 3 osmol/kg, or at most about 30 x 10 "3 osmol/kg.
- the composition comprises a cryoprotectant, it is preferred that the main part of the osmolality of the composition is provided by the cryoprotectant.
- the cryoprotectant may provide at least 50%, such as at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, or at least 90%, of the osmolality of the composition.
- the concentration of the RNA in the composition is about 5 mg/1 to about 500 mg/1, such as about 10 mg/1 to about 400 mg/1, about 10 mg/1 to about 300 mg/1, about 10 mg/1 to about 200 mg/1, about 10 mg/1 to about 150 mg/1, or about 10 mg/1 to about 100 mg/1, preferably about 10 mg/1 to about 140 mg/1, more preferably about 20 mg/1 to about 130 mg/1, more preferably about 30 mg/1 to about 120 mg/1.
- the concentration of the RNA in the composition is about 5 mg/1 to about 150 mg/1, such as about 10 mg/1 to about 140 mg/1, about 20 mg/1 to about 130 mg/1, about 25 mg/1 to about 125 mg/1, about 30 mg/1 to about 120 mg/1, about 35 mg/1 to about 115 mg/1, about 40 mg/1 to about 110 mg/1, about 45 mg/1 to about 105 mg/1, or about 50 mg/1 to about 100 mg/1.
- the composition comprises a cryoprotectant, preferably in a concentration of at least about 1% w/v, wherein the cryoprotectant preferably comprises one or more compounds selected from the group consisting of carbohydrates and alcohols (such as sugar alcohols or lower alcohols), more preferably the cryoprotectant is selected from the group consisting of sucrose, glucose, glycerol, 1 ,2-propanediol, 1,3-propanediol, sorbitol, and a combination thereof (such as from the group consisting of sucrose, glucose, glycerol, 1 ,2-propanediol, 1 ,3 -propanediol, and a combination thereof or from the group consisting of sucrose, glucose, glycerol, sorbitol, and a combination thereof), more preferably the cryoprotectant comprises sucrose and/or glycerol.
- the cryoprotectant comprises sucrose and/or glycerol.
- the concentration of the cryoprotectant in the composition is at least 1% w/v, such as at least 2% w/v, at least 3% w/v, at least 4% w/v, at least 5% w/v, at least 6% w/v, at least 7% w/v, at least 8% w/v, or at least 9% w/v.
- the concentration of the cryoprotectant in the composition is up to 25% w/v, such as up to 20% w/v, up to 19% w/v, up to 18% w/v, up to 17% w/v, up to 16% w/v, up to 15% w/v, up to 14% w/v, up to 13% w/v, up to 12% w/v, or up to 11% w/v.
- the concentration of the cryoprotectant in the composition is 1 % w/v to 20% w/v, such as 2% w/v to 19% w/v, 3% w/v to 18% w/v, 4% w/v to 17% w/v, 5% w/v to 16% w/v, 5% w/v to 15% w/v, 6% w/v to 14% w/v, 7% w/v to 13% w/v, 8% w/v to 12% w/v, 9% w/v to 11% w/v, or about 10% w/v.
- the composition comprises a cryoprotectant (such as sucrose, glucose, glycerol, 1 ,2-propanediol, or 1,3-propanediol, in particular, sucrose and/or glycerol) in a concentration of from 5% w/v to 15% w/v, such as from 6% w/v to 14% w/v, from 7% w/v to 13% w/v, from 8% w/v to 12% w/v, or from 9% w/v to 11% w/v, or in a concentration of about 10% w/v.
- a cryoprotectant such as sucrose, glucose, glycerol, 1 ,2-propanediol, or 1,3-propanediol, in particular, sucrose and/or glycerol
- the cryoprotectant is present in a concentration resulting in an osmolality of the composition in the range of from about 50 x 10 "3 osmol/kg to about 1000 x 10 ‘3 osmol/kg (such as from about 50 x 10 '3 osmol/kg to about 500 x lO "3 osmol/kg, from about 50 x 10 '3 osmol/kg to about 480 x lO '3 osmol/kg, from about 60 x 10 "3 osmol/kg to about 460 x 10 '3 osmol/kg, from about 70 x 10 "3 osmol/kg to about 440 x 10 "3 osmol/kg, from about 80 x 10 '3 osmol/kg to about 420 x 10 "3 osmol/kg, from about 90 x 10 ⁇ 3 osmol/kg to
- the composition is substantially free of a cryoprotectant.
- the buffer substance comprises a tertiary amine as defined herein ( i.e ., N(R*)(R 2 )(R 3 ), wherein none of R 1 , R 2 , and R 3 is H) or its protonated form
- the pH of the composition is between about 4.0 and about 8.0
- the concentration of the RNA in the composition is about 5 mg/1 to about 500 mg/1.
- it is preferred that the pH of the composition is between about 4.5 and about 8.0 and the concentration of the RNA in the composition is about 20 mg/1 to about 130 mg/1, such as about 30 mg/1 to about 120 mg/1.
- the buffer substance comprises a tertiary amine as defined herein or its protonated form; the pH of the composition is between about 5.0 and about 8.0; the concentration of the RNA in the composition is about 30 mg/1 to about 120 mg/1; and the composition comprises a cryoprotectant.
- the buffer substance comprises a tertiary amine as defined herein or its protonated form; the pH of the composition is between about 5.0 and about 8.0; the concentration of the RNA in the composition is about 30 mg/1 to about 120 mg/1; and the composition is substantially free of a cryoprotectant.
- the tertiary amine is a monoamine.
- the tertiary amine is selected from the group consisting of bis(2- hydroxyethyl)amino-tris(hydroxymethyl)methane (Bis-Tris-methane or BTM), triethanolamine (TEA), ethyldiethanolamine, 2-(diethylamino)ethan-l-ol, triethylamine, and 2-[2-(diethylamino)ethoxy]ethan- l-ol.
- the tertiary amine comprises or is triethanolamine (TEA).
- the buffer substance comprises a cyclic amine as defined herein (i.e ., N(R')(R 2 )(R 3 ), wherein two of R 1 , R 2 , and R 3 join together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring which is optionally substituted with one or two R 5 ) or its protonated form, the pH of the composition is between about 4.0 and about 8.0, and the concentration of the RNA in the composition is about 5 mg/1 to about 500 mg/1.
- a cyclic amine as defined herein i.e ., N(R')(R 2 )(R 3 ), wherein two of R 1 , R 2 , and R 3 join together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring which is optionally substituted with one or two R 5 ) or its protonated form
- the pH of the composition is between about 4.0 and about 8.0
- the pH of the composition is between about 4.5 and about 8.0 and the concentration of the RNA in the composition is about 20 mg/1 to about 130 mg/1, such as about 30 mg/1 to about 120 mg/1.
- the buffer substance comprises a cyclic amine as defined herein or its protonated form; the pH of the composition is between about 5.0 and about 8.0; the concentration of the RNA in the composition is about 30 mg/1 to about 120 mg/1; and the composition comprises a cryoprotectant.
- the buffer substance comprises a cyclic amine as defined herein or its protonated form; the pH of the composition is between about 5.0 and about 8.0; the concentration of the RNA in the composition is about 30 mg/1 to about 120 mg/1; and the composition is substantially free of a cryoprotectant.
- the cyclic amine is selected from the group consisting of N,N'-bis(2-hydroxyethyl)piperazine and morpholine substituted with one or more C 1 - 6 alkylene-R 4 (such as 2-hydroxyethyl) moieties.
- the cationically ionizable lipid comprises a head group which includes at least one nitrogen atom which is capable of being protonated under physiological conditions.
- the cationically ionizable lipid has the structure of Formula (X) or a pharmaceutically acceptable salt, tautomer, prodrug or stereoisomer thereof, wherein L 10 , L 20 , G 1 , G 2 , G 3 , R 35 , R 36 , and R 37 are as defined herein.
- the cationically ionizable lipid is selected from the following: the structures X-l to X-36 (shown herein); the structures A to G (shown herein); or N,N-dimethyl-2,3 -dioleyloxypropylamine (DODMA), l,2-dioleoyl-3-dimethylammonium- propane (DODAP), heptatriaconta-6,9,28,31 -tetraen-19-yl-4-(dimethylamino)butanoate (DLin-MC3- DMA), and 4-((di((9Z, 12Z)-octadeca-9, 12-dien- 1 -yl)amino)oxy)-N,N -dimethyl -4-oxobutan- 1 -amine (DPL-14).
- the cationically ionizable lipid is the lipid having the structure X-3.
- the cationically ionizable lipid has the structure of Formula
- the cationically ionizable lipid is selected from the structures (XIV-1), (XIV-2), and (XIV-3) (shown herein).
- the cationically ionizable lipid comprises from about 20 mol % to about 80 mol %, preferably from about 25 mol % to about 65 mol %, more preferably from about 30 mol % to about 50 mol %, such as from about 40 mol % to about 50 mol %, of the total lipid present in the composition.
- the composition further comprises one or more additional lipids.
- the one or more additional lipids are selected from the group consisting of polymer conjugated lipids, neutral lipids, steroids, and combinations thereof.
- the composition comprises the cationically ionizable lipid, a polymer conjugated lipid (e.g., a pegylated lipid; or a polysarcosine-lipid conjugate or a conjugate of polysarcosine and a lipid-like material), a neutral lipid (e.g., a phospholipid, such as DSPC), and a steroid (e.g., cholesterol).
- a polymer conjugated lipid e.g., a pegylated lipid; or a polysarcosine-lipid conjugate or a conjugate of polysarcosine and a lipid-like material
- a neutral lipid e.g., a phospholipid, such as DSPC
- a steroid e
- the composition further comprises a polymer conjugated lipid as one of the one or more additional lipids
- the polymer conjugated lipid comprises a pegylated lipid.
- the pegylated lipid is selected from the group consisting of DSPE-PEG, DOPE-PEG, DPPE-PEG, and DMPE-PEG.
- the pegylated lipid has the following structure: or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein R 12 , R 13 , and w are as defined herein.
- the composition further comprises a polymer conjugated lipid as one of the one or more additional lipids
- the polymer conjugated lipid comprises a polysarcosine-lipid conjugate or a conjugate of polysarcosine and a lipid-like material.
- the polysarcosine-lipid conjugate or conjugate of polysarcosine and a lipid-like material is a member selected from the group consisting of a polysarcosine-diacylglycerol conjugate, a polysarcosine-dialkyloxypropyl conjugate, a polysarcosine-phospholipid conjugate, a polysarcosine- ceramide conjugate, and a mixture thereof.
- the composition further comprises a polymer conjugated lipid as one of the one or more additional lipids
- the polymer conjugated lipid comprises from about 0.5 mol % to about 5 mol %, preferably from about 1 mol % to about 5 mol %, more preferably from about 1 mol % to about 4.5 mol % of the total lipid present in the composition.
- the neutral lipid is a phospholipid.
- the phospholipid is selected from the group consisting of phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols, phosphatidic acids, phosphatidyl serines and sphingomyelins.
- the phospholipid is selected from the group consisting of distearoylphosphatidylcholine (DSPC), dioleoylphosphatidylcholine (DOPC), dimyristoylphosphatidylcholine (DMPC), dipentadecanoylphosphatidylcholine, dilauroylphosphatidylcholine, dipalmitoylphosphatidylcholine (DPPC), diarachidoylphosphatidylcholine (DAPC), dibehenoylphosphatidylcholine (DBPC), ditricosanoylphosphatidylcholine (DTPC), dilignoceroylphatidylcholine (DLPC), palmitoyloleoyl- phosphatidylcholine (POPC), l,2-di-0-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC), 1- oleoyl-2-chol
- the composition further comprises a neutral lipid as one of the one or more additional lipids
- the neutral lipid comprises from about 5 mol % to about 40 mol %, preferably from about 5 mol % to about 20 mol %, more preferably from about 5 mol % to about 15 mol % of the total lipid present in the composition.
- the composition further comprises a steroid as one of the one or more additional lipids, the steroid is a sterol such as cholesterol.
- the composition further comprises a steroid as one of the one or more additional lipids
- the steroid comprises from about 10 mol % to about 65 mol %, preferably from about 20 mol % to about 60 mol %, more preferably from about 30 mol % to about 50 mol % of the total lipid present in the composition.
- the composition comprises a cationically ionizable lipid, a polymer conjugated lipid, a neutral lipid (e.g., a phospholipid), and a steroid, wherein the cationically ionizable lipid comprises from about 30 mol % to about 50 mol %, such as from about 40 mol % to about 50 mol %, of the total lipid present in the composition; the polymer conjugated lipid comprises from about 1 mol % to about 4.5 mol % of the total lipid present in the composition; the neutral lipid (e.g., phospholipid) comprises from about 5 mol % to about 15 mol % of the total lipid present in the composition; and the steroid comprises from about 30 mol % to about 50 mol % of the total lipid present in the composition.
- the cationically ionizable lipid comprises from about 30 mol % to about 50 mol %, such as from about 40 mol % to about 50 mol
- RNA and, if present, of one or more lipids is present in particles, such as lipid nanoparticles (LNPs), liposomes, and/or lipoplexes (LPXs).
- LNPs lipid nanoparticles
- LPXs lipoplexes
- the RNA is encapsulated within or associated with the particles.
- the particles comprise at least about 75% of the RNA comprised in the composition.
- the particles comprise at least about 76%, such as at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, or at least about 95% of the RNA comprised in the composition.
- the particles have a size of from about 30 nm to about 500 nm.
- the RNA is mRNA or inhibitory RNA.
- the RNA (such as mRNA) (i) comprises a modified nucleoside in place of uridine; (ii) has a coding sequence which is codon-optimized; and/or (iii) has a coding sequence whose G/C content is increased compared to the wild-type coding sequence.
- the modified nucleoside is selected from pseudouridine (y), N 1 -methyl-pseudouridine (m 1 y), and 5 -methyl-uridine (m5U).
- the RNA (such as mRNA) comprises at least one or more of the following: a 5’ cap; a 5’ UTR; a 3’ UTR; and a poly-A sequence.
- the RNA (such as mRNA) comprises all of the following: a 5’ cap; a 5’ UTR; a 3’ UTR; and a poly-A sequence.
- the poly-A sequence comprises at least 100 A nucleotides, wherein the poly-A sequence preferably is an interrupted sequence of A nucleotides.
- the 5’ cap is a capl or cap2 structure.
- the RNA (such as mRNA) encodes one or more polypeptides.
- the one or more polypeptides are pharmaceutically active polypeptides and/or comprise an epitope for inducing an immune response against an antigen in a subject.
- the pharmaceutically active polypeptide and/or the antigen or epitope is derived from or is a protein of a pathogen, an immunogenic variant of the protein, or an immunogenic fragment of the protein or the immunogenic variant thereof.
- the pathogen is a pathogen causing an infectious disease.
- the pharmaceutically active polypeptide and/or the antigen or epitope is derived from or is a SARS-CoV-2 spike (S) protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof.
- the RNA (such as mRNA) comprises an open reading frame (ORF) encoding an amino acid sequence comprising a SARS-CoV-2 S protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof.
- the SARS-CoV2 S protein variant has proline residue substitutions at positions 986 and 987 of SEQ ID NO: 1.
- the SARS-CoV2 S protein variant has at least 80% identity to the amino acid sequence of amino acids 17 to 1273 of SEQ ID NO: 7 or the amino acid sequence of amino acids 17 to 1273 of SEQ ID NO: 1.
- the fragment comprises the receptor binding domain (RBD) of the SARS-CoV-2 S protein.
- the fragment of (i) the SARS-CoV-2 S protein or (ii) the immunogenic variant of the SARS-CoV-2 S protein has at least 80% identity to the amino acid sequence of amino acids 327 to 528 of SEQ ID NO: 1.
- the RNA is inhibitory RNA (such as siRNA) and selectively hybridizes to and/or is specific for a target mRNA.
- the target mRNA comprises an ORF encoding a pharmaceutically active peptide or polypeptide, in particular a pharmaceutically active peptide or polypeptide whose expression (in particular increased expression, e.g., compared to the expression in a healthy subject) is associated with a disease.
- the target mRNA comprises an ORF encoding a pharmaceutically active peptide or polypeptide whose expression (in particular increased expression, e.g., compared to the expression in a healthy subject) is associated with cancer.
- the composition is in liquid form, preferably at a temperature of about 2°C to about 10°C.
- the RNA integrity of the composition after storage for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, at least three months, at least 4 months, or at least 6 months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is sufficient to produce the desired effect, e.g., to induce an immune response.
- the RNA integrity of the composition after storage for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, at least three months, at least 4 months, or at least 6 months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is at least 50%, such as at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 98%, compared to the RNA integrity before storage.
- the RNA integrity of the composition after storage for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, at least three months, at least 4 months, or at least 6 months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is at least 90%, compared to the RNA integrity before storage.
- the RNA integrity of the composition after storage for at least four weeks preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is at least 50%, such as at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 98%, compared to the RNA integrity before storage.
- the RNA integrity of the composition after storage for at least four weeks preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is at least 90%, compared to the RNA integrity before storage.
- the initial RNA integrity of the composition (/. ⁇ ?., after its preparation but before storage) is at least 50% and the RNA integrity of the composition after storage for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, or at least 3 months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is at least 90%, preferably at least 95%, more preferably at least 97%, more preferably at least 98%, of the initial RNA integrity.
- the initial RNA integrity of the composition (i.e., after its preparation but before storage) is at least 50% and the RNA integrity of the composition after storage for at least one week (such as for at least four weeks or at least 3 months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is at least 90% of the initial RNA integrity.
- a temperature of 0°C or higher such as about 2°C to about 8°C
- the size (Z average ) of the RNA particles after storage for at least one week (such as for at least four weeks or at least three months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm.
- the PDI of the RNA particles after storage for at least one week (such as for at least four weeks or at least three months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is less than 0.3, preferably less than 0.2, more preferably less than 0.1.
- the size (Z average ) of the RNA particles after storage for at least one week (such as for at least four weeks or at least three months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm, and the size (Z average ) (and/or size distribution and/or PDI) of the RNA particles after storage of the liquid composition for at least one week (such as for at least four weeks or at least three months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is essentially equal to the size (Z average ) (and/or size distribution and/or PDI) of the RNA particles before storage.
- the size (Z average ) of the RNA particles after storage of the liquid composition for at least one week (such as for at least four weeks or at least three months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm
- the PDI of the RNA particles after storage of the liquid composition for at least one week (such as for at least four weeks or at least three months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, e.g., at 0°C or higher, is less than 0.3 (preferably less than 0.2, more preferably less than 0.1).
- the composition is in frozen form ⁇ e.g., at -20°C).
- the composition comprises a cryoprotectant;
- the composition has a pH between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5; or
- the composition comprises a cryoprotectant and has a pH between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5.
- the cryoprotectant is (i) selected from the cryoprotectants disclosed herein; and/or (ii) is present in a concentration as disclosed herein.
- the cryoprotectant may be selected from the group consisting of sucrose, glucose, glycerol, 1 ,2-propanediol, and 1,3-propanediol, such as from the group consisting of sucrose, glycerol and glucose; and/or may be present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the cryoprotectant is glycerol, which is optionally present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the RNA integrity after thawing the frozen composition is at least 50%, such as at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, or substantially 100%, compared to the RNA integrity before the composition has been frozen. In some embodiments, the RNA integrity after thawing the frozen composition is at least 90%, at least 95%, at least 97%, at least 98%, or substantially 100%, compared to the RNA integrity before the composition has been frozen.
- the size (Z average ) and/or size distribution and/or polydispersity index (PDI) of RNA particles (in particular LNPs) after thawing the frozen composition is essentially equal to the size (Z ave ragc) and/or size distribution and/or PDI of the RNA particles before the composition has been frozen.
- the initial RNA integrity of the composition (i.e., after its preparation but before freezing) is at least 50% and the RNA integrity of the composition after thawing the frozen composition is at least 90%, preferably at least 95%, more preferably at least 97%, more preferably at least 98%, more preferably substantially 100%, of the initial RNA integrity.
- the size (Z average ) (and/or size distribution and/or polydispersity index (PDI)) of the RNA particles after thawing the frozen composition is essentially equal to the size (Z average ) (and/or size distribution and/or PDI) of the RNA particles before the composition has been frozen.
- the size (Z average ) of the RNA particles after thawing the frozen composition is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm.
- the PDI of the RNA particles after thawing the frozen composition is less than 0.3, preferably less than 0.2, more preferably less than 0.1.
- the size (Z average ) of the RNA particles after thawing the frozen composition is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm, and the size (Z aV erage) (and/or size distribution and/or PDI) of the RNA particles after thawing the frozen composition is essentially equal to the size (Z average ) (and/or size distribution and/or PDI) of the RNA particles before freezing.
- the size (Z av era g e) of the RNA particles after thawing the frozen composition is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm, and the PDI of the RNA particles after thawing the frozen composition is less than 0.3 (preferably less than 0.2, more preferably less than 0.1).
- the size of the RNA particles and the RNA integrity of the composition after one freeze/thaw cycle are substantially the same as (i.e., are essentially equal to) the size of the RNA particles and the RNA integrity of the initial composition ⁇ i.e., before the composition has been frozen for the first time).
- the present disclosure provides a method of preparing a composition comprising LNPs dispersed in a final aqueous phase, wherein the LNPs comprise a cationically ionizable lipid and RNA;
- the final aqueous phase comprises a buffer system comprising a final buffer substance, the final buffer substance having the formula N(R')(R 2 )(R 3 ), its N-oxide, or a protonated form thereof, wherein R 1 , R 2 , and R 3 are as defined in the first aspect; wherein the method comprises:
- step (II) optionally freezing the formulation to about -10°C or below, thereby obtaining the composition, wherein step (I) comprises:
- the final buffer substance is a tertiary amine (i.e ., none of R 1 , R 2 , and R 3 is H) or a protonated form thereof.
- each of R 1 , R 2 , and R 3 is independently selected from C 1 - 6 alkyl, Ci-6 alkylene-R 4 , CH(Ci-5 alkylene-R 4 )2, and C(C 1-5 alkylene- R 4 )j, wherein at most one of R 1 , R 2 , and R 3 is CH(C 1-5 alkylene-R 4 )2, or C(Ci_5 alkylene-R 4 ) ⁇ , as specified above.
- the tertiary amine is a monoamine. In some embodiments, the tertiary amine is selected from the group consisting of bis(2-hydroxyethyl)amino-tris(hydroxymethyl)methane (Bis-Tris-methane or BTM), triethanolamine (TEA), ethyldiethanolamine, 2-(diethylamino)ethan-l-ol, triethylamine, and 2-[2-(diethylamino)ethoxy]ethan- 1 -ol. In some embodiments, the tertiary amine comprises or is triethanolamine (TEA).
- TAA triethanolamine
- the final buffer substance is a cyclic amine (i.e. , N(R')(R 2 )(R 3 ), wherein two of R 1 , R 2 , and R 3 join together with the nitrogen atom to form a 5- or 6-membered N- heterocyclic ring which is optionally substituted with one or two R 5 ) or a protonated form thereof.
- R 1 and R 2 join together with the nitrogen atom to form a 5- or 6-membered N- heterocyclic ring which is optionally substituted with one or two R 5 , as specified above.
- the cyclic amine is selected from the group consisting of N,N'-bis(2- hydroxyethyl)piperazine and morpholine substituted with one or more Ci_ 6 alkylene-R 4 (such as 2- hydroxyethyl) moieties.
- the final buffer substance is a secondary amine (i.e., one of R 1 , R 2 , and R 3 is H) or a protonated form thereof.
- R 1 is H and each of R 2 and R 3 is independently selected from Ci-6 alkyl, C 1 - 6 alkylene-R 4 , CH(CTs alkylene-R 4 )2, and C(C 1-5 alkylene-R 4 )3, wherein at most one of R 2 and R 3 is CH(C 1-5 alkylene-R 4 )2, or C(Ci_5 alkylene-R 4 )3, as specified above.
- the final buffer substance comprises at least one C 1 - 6 alkylene- R 4 moiety.
- R 4 is OH
- the alkylene group has 2 to 6 carbon atoms, such as 2 to 4, e.g., 2, 3, or 4 carbon atoms.
- the at least one Ci-e alkylene-R 4 moiety preferably is C alkylene-OH, more preferably C2-4 alkylene-OH, more preferably C2-3 alkylene-OH, such as C2 alkylene-OH or 2-hydroxyethyl,
- the final buffer substance is selected from bis(2- hydroxyethyl)amino-tris(liydroxymethyl)methane (Bis-T ris-methane or BTM) and its protonated form, triethanolamine (TEA) and its protonated form, ethyldiethanolamine and its protonated form, 2- (diethylamino)ethan-l -ol and its protonated form, triethylamine and its protonated form, 2-[2- (diethylamino)ethoxy]ethan-l-ol and its protonated form, diethanolamine and its protonated form, N,N'- bis(2-hydroxyethyl)piperazine and its protonated form, N,N,N',N'-tetrakis(2- hydroxyethyl)ethylenediamine and its protonated form, and trimethylamine N-oxide and its protonated form.
- TAA triethanolamine
- the final buffer substance is selected from bis(2-hydroxyethyl)amino- tris(hydroxymethyl)methane (Bis-Tris-methane or BTM) and its protonated form, triethanolamine (TEA) and its protonated form, ethyldiethanolamine and its protonated form, 2-(diethylamino)ethan-l- ol and its protonated form, triethylamine and its protonated form, 2- [2-(diethylamino)ethoxy] ethan- 1 -ol and its protonated form, and N,N'-bis(2-hydroxyethyl)piperazine and its protonated form.
- the final buffer substance comprises or is triethanolamine (TEA) or its protonated form.
- the method of the third aspect comprises (II) freezing the formulation to about -10°C or below.
- conducting the method of the third aspect results in a composition in frozen form.
- the composition (a) comprises a cryoprotectant; (b) has a pH between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5; or (c) comprises a cryoprotectant and has a pH between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5.
- the cryoprotectant is (i) selected from the cryoprotectants disclosed herein; and/or (ii) is present in a concentration as disclosed herein.
- the cryoprotectant may be selected from the group consisting of sucrose, glucose, glycerol, 1 ,2-propanediol, and 1 ,3-propanediol, such as from the group consisting of sucrose, glycerol and glucose; and/or may be present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the cryoprotectant is glycerol, which is optionally present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the method of the third aspect does not comprise step (II).
- conducting the method of the third aspect results in a composition in liquid form.
- step (I) further comprises one or more steps selected from diluting and filtrating, such as tangential flow filtrating and diafiltrating, after step (c).
- a diluting step may comprise adding a dilution solution to an intermediate formulation.
- dilution solution may comprise one or more additional compounds and optionally the final buffer system, wherein the one or more additional compounds may comprise a cryoprotectant.
- the one or more filtrating steps may be used to remove unwanted compounds (e.g., ethanol and/or one or more di- and/or polybasic organic acids) from the intermediate formulation and/or for increasing the RNA concentration of the intermediate formulation and/or for changing the pH and/or the buffer system of the intermediate formulation.
- unwanted compounds e.g., ethanol and/or one or more di- and/or polybasic organic acids
- an aqueous buffer solution can be used, which does not contain the unwanted compounds (such that the unwanted compounds are washed out from the intermediate formulation and into the aqueous buffer solution) and/or which is hypertonic compared to the aqueous buffer solution (such that water flows from the intermediate formulation to the aqueous buffer solution) and/or which has a pH and/or buffer system other than the pH and/or buffer system of the intermediate formulation.
- step (I) comprises:
- step (f) optionally filtrating the first intermediate formulation prepared under (e') using a further aqueous buffer solution comprising a further buffer system, thereby preparing a further intermediate formulation comprising the LNPs dispersed in a further aqueous phase comprising the further buffer system, wherein the further aqueous buffer solution may be identical to or different from the first aqueous buffer solution;
- step (f) optionally repeating step (f) once or two or more times, wherein the further intermediate formulation comprising the LNPs dispersed in the further aqueous phase comprising the further buffer system obtained after step (f) of one cycle is used as the first intermediate formulation of the next cycle, wherein in each cycle the further aqueous buffer solution may be identical to or different from the first aqueous buffer solution;
- step (h 1 ) filtrating the first intermediate formulation obtained in step (e 1 ), if step (f ) is absent, or the further intermediate formulation obtained in step (f), if step (f ) is present and step (g') is not present, or the further intermediate formulation obtained after step (g'), if steps (f) and (g 1 ) are present, using a final aqueous buffer solution comprising the final buffer system;
- step (i') optionally diluting the formulation obtained in step (h') with a dilution solution; thereby preparing the formulation comprising the LNPs dispersed in the final aqueous phase.
- the concentration of the final buffer substance, in particular the total concentration of the final buffer substance and its protonated form, in the composition is between about 10 mM and about 200 mM, such as between about 20 mM and about 180 mM, between about 30 mM and about 170 mM, between about 40 mM and about 160 mM, between about 50 mM and about 50 mM, between about 60 mM and about 140 mM, between about 70 mM and about 130 mM, between about 80 mM and about 120 mM, between about 90 mM and about 110 mM.
- the concentration of the final buffer substance, in particular the total concentration of the final buffer substance and its protonated form, in the composition is between about 15 mM and about 100 mM, preferably between about 20 mM and about 80 mM, more preferably between about 40 mM and about 60 mM, such as about 50 mM.
- the final buffer system further comprises an anion, which is preferably selected from the group consisting of chloride, acetate, glycolate, lactate, and the anion of a di- or tricarboxylic acid, such as the anion of citric acid, succinic acid, malonic acid, glutaric acid, or adipic acid.
- an anion which is preferably selected from the group consisting of chloride, acetate, glycolate, lactate, and the anion of a di- or tricarboxylic acid, such as the anion of citric acid, succinic acid, malonic acid, glutaric acid, or adipic acid.
- the concentration of the anion in the composition is at least equal to the concentration of the final buffer substance in the composition.
- the concentration of the anion in the composition may be higher than the concentration of the final buffer substance in the composition.
- the concentration of the final buffer substance in the composition is x being within the range between about 10 mM and about 200 mM
- the concentration of the anion in the composition is at least equal to x, e.g., higher than x.
- cryoprotectant comprises one or more compounds selected from the group consisting of carbohydrates and alcohols (such as sugar alcohols or lower alcohols).
- the cryoprotectant may be selected from the group consisting of sucrose, glucose, glycerol, 1,2-propanediol, 1,3-propanediol, sorbitol, and a combination thereof (such as from the group consisting of sucrose, glucose, glycerol, 1 ,2-propanediol, 1 ,3-propanediol, and a combination thereof or from the group consisting of sucrose, glucose, glycerol, sorbitol, and a combination thereof).
- the formulation obtained in step (I) and/or the composition comprise(s) sucrose and/or glycerol as cryoprotectant.
- the concentration of the cryoprotectant in the formulation and/or composition is at least 1 % w/v, such as at least 2% w/v, at least 3% w/v, at least 4% w/v, at least 5% w/v, at least 6% w/v, at least 7% w/v, at least 8% w/v or at least 9% w/v.
- the concentration of the cryoprotectant in the formulation and/or composition is up to 25% w/v, such as up to 20% w/v, up to 19% w/v, up to 18% w/v, up to 17% w/v, up to 16% w/v, up to 15% w/v, up to 14% w/v, up to 13% w/v, up to 12% w/v, or up to 11% w/v.
- the concentration of the cryoprotectant in the formulation and/or composition is 1 % w/v to 20% w/v, such as 2% w/v to 19% w/v, 3% w/v to 18% w/v, 4% w/v to 17% w/v, 5% w/v to 16% w/v, 5% w/v to 15% w/v, 6% w/v to 14% w/v, 7% w/v to 13% w/v, 8% w/v to 12% w/v, 9% w/v to 11% w/v, or about 10% w/v.
- the formulation and/or composition comprise(s) a cryoprotectant (such as sucrose, glucose, glycerol, 1 ,2-propanediol, 1 ,3-propanediol, or a combination thereof, in particular, sucrose and/or glycerol) in a concentration of from 5% w/v to 15% w/v, such as from 6% w/v to 14% w/v, from 7% w/v to 13% w/v, from 8% w/v to 12% w/v, or from 9% w/v to 11% w/v, or in a concentration of about 10% w/v.
- a cryoprotectant such as sucrose, glucose, glycerol, 1 ,2-propanediol, 1 ,3-propanediol, or a combination thereof, in particular, sucrose and/or glycerol
- the method of the third aspect may comprise a diluting step using a dilution solution, wherein the dilution solution comprises a sufficient amount of a cryoprotectant in order to achieve the above concentrations of cryoprotectant in the formulation obtained in step (I) and/or the composition.
- the cryoprotectant is present in a concentration resulting in an osmolality of the composition in the range of from about 50 x lO '3 osmol/kg to about 1000 x 10 '3 osmol/kg (such as from about 50 x 10 3 osmol/kg to about 500 x 10 '3 osmol/kg, from about 50 x 10 ⁇ 3 osmol/kg to about 480 x 10 3 osmol/kg, from about 60 x 10 "3 osmol/kg to about 460 x 10 ⁇ 3 osmol/kg, from about 70 x 10 '3 osmol/kg to about 440 x 10 '3 osmol/kg, from about 80 x 10 '3 osmol/kg to about 420 x 10 '3 osmol/kg, from about 90 x 10 '3 osmol/kg to about 420 x 10 '3 osmol/kg, from about 90 x 10
- the method of the third aspect may comprise a diluting step using a dilution solution, wherein the dilution solution comprises a sufficient amount of a cryoprotectant in order to achieve the above osmolality values in the formulation obtained in step (I) and/or the composition.
- the formulation obtained in step (I) and/or the composition is/are substantially free of a cryoprotectant.
- the pH of the final buffer system is between about 4.0 and about 8.0.
- the pH of the final buffer system may be between about 4.5 and about 8.0, such as between about 5.0 and about 8.0, between about 5.5 and about 8.0, between about 6.0 and about 8.0, between about 6.5 and about 8.0, between about 6.8 and about 7.9, between about 7.0 and about 7.8 or about 7.5.
- the first buffer system (and the pH of the RNA solution obtained in step (a)) has a pH of below 6.0, preferably at most about 5.5, such as at most about 5.0, at most about 4.9, at most about 4.8, at most about 4.7, at most about 4.6, or at most about 4.5.
- the pH of first buffer system (and the pH of the RNA solution obtained in step (a)) may be between about 3.5 and about 5.9, such as between about 4.0 and about 5.5, or between about 4.5 and about 5.0.
- the RNA solution obtained in step (a) may further comprises one or more di- and/or polybasic organic acids (e.g., citrate anions and/or anions of EDTA).
- step (d) is conducted under conditions which remove one or more unwanted substances (e.g., ethanol and/or the one or more di- and/or polybasic organic acids) resulting in the formulation comprising the LNPs dispersed in a final aqueous phase with the final aqueous phase being substantially free of such one or more unwanted substances.
- such conditions can include subjecting the intermediate formulation comprising the LNPs dispersed in the intermediate aqueous phase obtained in step (c) to at least one step of filtrating, such as tangential flow filtrating or diafiltrating, using a final buffer solution comprising the final buffer system (i.e., the final buffer substance), wherein the final buffer solution does not contain the one or more unwanted substances.
- such conditions can include (i) subjecting the intermediate formulation comprising the LNPs dispersed in the intermediate aqueous phase obtained in step (c) (i.e., a first intermediate formulation) to at least one step of filtrating, such as tangential flow filtrating or diafiltrating, using a further aqueous buffer solution comprising a further buffer system, thereby preparing a further intermediate formulation comprising the LNPs dispersed in a further aqueous phase comprising the further buffer system, wherein the further buffer system of the further aqueous buffer solution may be identical to or different from the buffer system used in step (a); (ii) optionally repeating step (i) once or two or more times, wherein the further intermediate formulation comprising the LNPs dispersed in the further aqueous phase obtained after step (i) of one cycle is used as the first intermediate formulation of the next cycle, wherein in each cycle the further buffer system of the further aqueous buffer solution may be identical to or different from the first buffer system used in step (a);
- the first aqueous buffer solution (and the pH of the RNA solution obtained under step (c')) has a pH of below 6.0, preferably at most about 5.5, such as at most about 5.0, at most about 4.9, at most about 4.8, at most about 4.7, at most about 4.6, or at most about 4.5.
- the pH of the first aqueous buffer solution (and the pH of the RNA solution obtained under step (c 1 )) may be between about 3.5 and about 5.9, such as between about 4.0 and about 5.5, or between about 4.5 and about 5.0.
- the first aqueous buffer solution provided under (b 1 ) (and the first aqueous phase) may further comprises one or more di- and/or polybasic organic acids (e.g., citrate anions and/or anions ofEDTA).
- steps (f) to (h') is conducted under conditions which remove one or more unwanted substances (e.g., ethanol and/or the one or more di- and/or polybasic organic acids) from the first intermediate formulation and/or from the further intermediate formulation resulting in a further inter formulation comprising the LNPs dispersed in a further aqueous phase or in the final aqueous phase with the further and/or final aqueous phase being substantially free of the one or more unwanted substances.
- one or more unwanted substances e.g., ethanol and/or the one or more di- and/or polybasic organic acids
- such conditions can include using a further aqueous buffer solution and/or a final buffer solution, wherein at least one of the further aqueous buffer solution(s) and the final buffer solution (preferably all of the further aqueous buffer solution(s) and the final buffer solution) does not contain the one or more unwanted substances .
- the filtrating steps can be tangential flow filtrating or diafiltrating, preferably tangential flow filtrating.
- the first buffer system used in step (a) comprises the final buffer substance used in step (d), preferably the buffer system and pH of the first buffer system used in step (a) are identical to the buffer system and pH of the final aqueous buffer solution used in step (d). For example, only one aqueous buffer solution is used in this embodiment of the third aspect.
- step (I) comprises steps (a') to (e 1 ) and (h') (and optionally one or more of steps (f), (g 1 ) and (i’)
- each of the first buffer system and every further buffer system used in steps (b 1 ), (f) and (g') comprises the final buffer substance used in step (h 1 ), preferably the buffer system and pH of each of the first aqueous buffer solution and of every further aqueous buffer solution used in steps (b 1 ), (f) and (g 1 ) are identical to the buffer system and pH of the final aqueous buffer solution.
- the aqueous buffer solutions used in steps (b'), (f), if present, (g 1 ), if present, and (h') of this embodiment of the third aspect are identical.
- the formulation and/or composition comprise(s) water as the main component and/or the total amount of solvent(s) other than water contained in the composition is less than about 1.0% (v/v), such as less than about 0.5% (v/v).
- the amount of water contained in the formulation and/or composition may be at least 50% (w/w), such as at least at least 55% (w/w), at least 60% (w/w), at least 65% (w/w), at least 70% (w/w), at least 75% (w/w), at least 80% (w/w), at least 85% (w/w), at least 90% (w/w), or at least 95% (w/w).
- the amount of water contained in the formulation and/or composition comprise(s) may be at least 50% (w/w), such as at least at least 55% (w/w), at least 60% (w/w), at least 65% (w/w), at least 70% (w/w), at least 75% (w/w), at least 80% (w/w), at least 85% (w/w), or at least 90% (w/w). If the formulation and/or composition is/are substantially free of a cryoprotectant, the amount of water contained in the formulation and/or composition may be at least 95% (w/w).
- the total amount of solvent(s) other than water contained in the composition may be less than about 1.0% (v/v), such as less than about 0.9% (v/v), less than about 0.8% (v/v), less than about 0.7% (v/v), less than about 0.6% (v/v), less than about 0.5% (v/v), less than about 0.4% (v/v), less than about 0.3% (v/v), less than about 0.2% (v/v), less than about 0.1% (v/v), less than about 0.05% (v/v), or less than about 0.01% (v/v).
- a cryoprotectant which is liquid under normal conditions will not be considered as a solvent other than water but as cryoprotectant.
- the total amount of solvent(s) other than water contained in the composition may be less than about 1.0% (v/v), such as less than about 0.5% (v/v), does not apply to cryoprotectants which are liquids under normal conditions.
- the osmolality of the composition is at most about 1000 x 10 "3 osmol/kg, such as between about 100 x 10 ⁇ 3 osmol/kg and about 750 x 10 '3 osmol/kg.
- the osmolality of the composition is at most about 500 x 10 3 osmol/kg, such as at most about 490 x 10 " 3 osmol/kg, at most about 480 x 10 3 osmol/kg, at most about 470 x 10 ‘3 osmol/kg, at most about 460 x 10 '3 osmol/kg, at most about 450 x 10 3 osmol/kg, at most about 440 x 10 ‘3 osmol/kg, at most about 430 x 10 3 osmol/kg, at most about 420 x 10 '3 osmol/kg, at most about 410 x 10 '3 osmol/kg, at most about 400 x 10 "3 osmol/kg, at most about 390 x 10 "3 osmol/kg, at most about 380 x 10 "3 osmol/kg, at most about 370 x 10 "3 osmol/kg, at most about
- the osmolality of the composition may be below 300 x 10 ⁇ 3 osmol/kg, such as at most about 250 x 10 '3 osmol/kg, at most about 200 x 10 '3 osmol/kg, at most about 150 x 10 ‘3 osmol/kg, at most about 100 x 10 "3 osmol/kg, at most about 50 x 10 '3 osmol/kg, at most about 40 x 10 3 osmol/kg, or at most about 30 x 10 '3 osmol/kg.
- the composition comprises a cryoprotectant
- the main part of the osmolality of the composition is provided by the cryoprotectant.
- the cryoprotectant may provide at least 50%, such as at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, or at least 90%, of the osmolality of the composition.
- the concentration of the RNA in the composition is about 5 mg/1 to about 500 mg/1, such as about 10 mg/1 to about 400 mg/1, about 10 mg/1 to about 300 mg/1, about 10 mg/1 to about 200 mg/1, about 10 mg/1 to about 150 mg/1, or about 10 mg/1 to about 100 mg/1, preferably about 10 mg/1 to about 140 mg/1, more preferably about 20 mg/1 to about 130 mg/1, more preferably about 30 mg/1 to about 120 mg/1. In some embodiments, the concentration of the RNA in the composition is about 5 mg/1 to about 150 mg/1.
- the concentration of the RNA in the composition may be about 10 mg/1 to about 140 mg/1, such as about 20 mg/1 to about 130 mg/1, about 25 mg/1 to about 125 mg/1, about 30 mg/1 to about 120 mg/1, about 35 mg/1 to about 115 mg/1, about 40 mg/1 to about 110 mg/1, about 45 mg/1 to about 105 mg/1, or about 50 mg/1 to about 100 mg/1.
- the final buffer substance comprises a tertiary amine as defined herein (i.e., none of R 1 , R 2 , and R 3 is H) or its protonated form
- the pH of the composition is between about 4.0 and about 8.0
- the concentration of the RNA in the composition is about 5 mg/1 to about 500 mg/1.
- it is preferred that the pH of the composition is between about 4.5 and about 8.0 and the concentration of the RNA in the composition is about 20 mg/1 to about 130 mg/1, such as about 30 mg/1 to about 120 mg/1.
- the final buffer substance comprises a tertiary amine as defined herein or its protonated form; the pH of the composition is between about 5.0 and about 8.0; the concentration of the RNA in the composition is about 30 mg/1 to about 120 mg/1; and the composition comprises a cryoprotectant.
- the final buffer substance comprises a tertiary amine as defined herein or its protonated form; the pH of the composition is between about 5.0 and about 8.0; the concentration of the RNA in the composition is about 30 mg/1 to about 120 mg/1; and the composition is substantially free of a cryoprotectant.
- the tertiary amine is a monoamine.
- the tertiary amine is selected from the group consisting of bis(2-hydroxyethyl)amino- tris(hydroxymethyl)methane (B is-Tris-methane or BTM), triethanolamine (TEA), ethyldiethanolamine, 2-(diethylamino)ethan-l-ol, triethylamine, and 2-[2-(diethylamino)ethoxy]ethan-l-ol.
- B is-Tris-methane or BTM
- TAA triethanolamine
- ethyldiethanolamine 2-(diethylamino)ethan-l-ol
- triethylamine 2-[2-(diethylamino)ethoxy]ethan-l-ol.
- the tertiary amine comprises or is triethanolamine (TEA).
- the final buffer substance comprises a cyclic amine as defined herein (i.e., N(R*)(R 2 )(R 3 ), wherein two of R 1 , R 2 , and R 3 join together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring which is optionally substituted with one or two R 5 ) or its protonated form, the pH of the composition is between about 4.0 and about 8.0, and the concentration of the RNA in the composition is about 5 mg/1 to about 500 mg/1.
- a cyclic amine as defined herein i.e., N(R*)(R 2 )(R 3 ), wherein two of R 1 , R 2 , and R 3 join together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring which is optionally substituted with one or two R 5 ) or its protonated form
- the pH of the composition is between about 4.0 and about 8.0
- the pH of the composition is between about 4.5 and about 8.0 and the concentration of the RNA in the composition is about 20 mg/1 to about 130 mg/1, such as about 30 mg/1 to about 120 mg/1.
- the final buffer substance comprises a cyclic amine as defined herein or its protonated form; the pH of the composition is between about 5.0 and about 8.0; the concentration of the RNA in the composition is about 30 mg/1 to about 120 mg/1; and the composition comprises a cryoprotectant.
- the final buffer substance comprises a cyclic amine as defined herein or its protonated form; the pH of the composition is between about 5.0 and about 8.0; the concentration of the RNA in the composition is about 30 mg/1 to about 120 mg/1; and the composition is substantially free of a cryoprotectant.
- the cyclic amine is selected from the group consisting of N,N'-bis(2-hydroxyethyl)piperazine and morpholine substituted with one or more C 1 - 6 alkylene-R 4 (such as 2-hydroxyethyl) moieties.
- the cationically ionizable lipid comprises a head group which includes at least one nitrogen atom which is capable of being protonated under physiological conditions.
- the cationically ionizable lipid has the structure of Formula
- the cationically ionizable lipid is selected from the following: structures X-l to X-36 (shown herein); and/or structures A to F (shown herein); and/or N,N-dimethyl-2,3-dioleyloxypropylamine (DODMA), 1 ,2-dioleoyl-3- dimethylammonium-propane (DODAP), heptatriaconta-6,9,28,31 -tetraen-19-yl-4-
- DODMA N,N-dimethyl-2,3-dioleyloxypropylamine
- DODAP 1 ,2-dioleoyl-3- dimethylammonium-propane
- the cationically ionizable lipid is the lipid having the structure X-3.
- the cationically ionizable lipid has the structure of Formula
- the cationically ionizable lipid is selected from the structures (XIV- 1), (XIV-2), and (XIV -3) (shown herein).
- the cationically ionizable lipid comprises from about 20 mol % to about 80 mol %, preferably from about 25 mol % to about 65 mol %, more preferably from about 30 mol % to about 50 mol %, such as from about 40 mol % to about 50 mol %, of the total lipid present in the composition.
- the ethanolic solution prepared in step (b) or (d') further comprises one or more additional lipids and the LNPs further comprise the one or more additional lipids.
- the one or more additional lipids are selected from the group consisting of polymer conjugated lipids, neutral lipids, steroids, and combinations thereof.
- the one or more additional lipids comprise a polymer conjugated lipid (e.g., a pegylated lipid; or a polysarcosine-1 ipi d conjugate or a conjugate of polysarcosine and a lipid-like material), a neutral lipid (e.g., a phospholipid, such as DSPC), and a steroid (e.g., cholesterol), such that the LNPs comprise the cationically ionizable lipid as described herein, a polymer conjugated lipid (e.g., a pegylated lipid; or a polysarcosine-lipid conjugate or a conjugate of polysarcosine and a lipid-like material), a neutral lipid (e.g., a phospholipid, such as DSPC), and a steroid (e.g., cholesterol).
- a polymer conjugated lipid e.g., a pegylated lipid;
- the polymer conjugated lipid is a pegylated lipid.
- the pegylated lipid is selected from the group consisting of DSPE-PEG, DOPE-PEG, DPPE-PEG, and DMPE-PEG.
- the pegylated lipid may have the following structure: or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein R 12 , R 13 , and w are as defined herein.
- the polymer conjugated lipid is a polysarcosine-lipid conjugate or a conjugate of polysarcosine and a lipid-like material.
- the polysarcosine-lipid conjugate or conjugate of polysarcosine and a lipid-like material may be a member selected from the group consisting of a polysarcosine-diacylglycerol conjugate, a polysarcosine-dialkyloxypropyl conjugate, a polysarcosine- phospholipid conjugate, a polysarcosine-ceramide conjugate, and a mixture thereof.
- the polymer conjugated lipid comprises from about 0,5 mol % to about 5 mol %, preferably from about 1 mol % to about 5 mol %, more preferably from about 1 mol % to about 4.5 mol % of the total lipid present in the composition.
- the neutral lipid is a phospholipid.
- phospholipid is preferably selected from the group consisting of phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols, phosphatidic acids, phosphatidylserines and sphingomyelins.
- phospholipids include distearoylphosphatidylcholine (DSPC), dioleoylphosphatidylcholine (DOPC), dimyristoylphosphatidylcholine (DMPC), dipentadecanoylphosphatidylcholine, dilauroylphosphatidylcholine, dipalmitoylphosphatidylcholine (DPPC), diarachidoylphosphatidylcholine (DAPC), dibehenoylphosphatidylcholine (DBPC), ditricosanoylphosphatidylcholine (DTPC), dilignoceroylphatidylcholine (DLPC), palmitoyloleoyl- phosphatidylcholine (POPC), 1 ,2-di-0-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC), 1 - oleoyl-2-cholesterylhemisuccino
- the neutral lipid comprises from about 5 mol % to about 40 mol %, preferably from about 5 mol % to about 20 mol %, more preferably from about 5 mol % to about 15 mol % of the total lipid present in the composition.
- the steroid is a sterol such as cholesterol.
- the steroid comprises from about 10 mol % to about 65 mol %, preferably from about 20 mol % to about 60 mol %, more preferably from about 30 mol % to about 50 mol % of the total lipid present in the composition.
- the ethanolic solution comprises the cationically ionizable lipid, the polymer conjugated lipid, the neutral lipid (e.g., a phospholipid), and the steroid in a molar ratio of 20% to 60% of the cationically ionizable lipid, 0.5% to 15% of the polymer conjugated lipid, 5% to 25% of the neutral lipid, and 25% to 55% of the steroid, based on the total molar amount of lipids in the ethanolic solution.
- the neutral lipid e.g., a phospholipid
- the molar ratio may be 40% to 55% of the cationically ionizable lipid, 1 .0% to 10% of the polymer conjugated lipid, 5% to 15% of the neutral lipid, and 30% to 50% of the steroid, such as 45% to 55% of the cationically ionizable lipid, 1.0% to 5% of the polymer conjugated lipid, 8% to 12% of the neutral lipid, and 35% to 45% of the steroid, based on the total molar amount of lipids in the ethanolic solution.
- the LNPs comprise at least about 75% of the RNA comprised in the composition.
- the LNPs may comprise at least about 76%, such as at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, or at least about 95% of the RNA comprised in the composition.
- the RNA is mRNA.
- the RNA (such as mRNA) is encapsulated within or associated with the LNPs.
- the RNA (such as mRNA) (i) comprises a modified nucleoside in place of uridine; (ii) has a coding sequence which is codon-optimized; and/or (iii) has a coding sequence whose G/C content is increased compared to the wild-type coding sequence.
- the modified nucleoside is selected from pseudouridine (y), N 1 -methyl-pseudouridine (m 1 y), and 5-methyl-uridine (m5U).
- the RNA (such as mRNA) comprises one or more of the following (a) a 5’ cap, such as a capl or cap2 structure; (b) a 5’ UTR; (c) a 3’ UTR; and (d) a poly-A sequence.
- the poly-A sequence comprises at least 100 A nucleotides, wherein the poly-A sequence preferably is an interrupted sequence of A nucleotides.
- the RNA (such as mRNA) encodes one or more polypeptides.
- the one or more polypeptides are pharmaceutically active polypeptides and/or comprise an epitope for inducing an immune response against an antigen in a subject.
- the pharmaceutically active polypeptide and/or the antigen or epitope is derived from or is a protein of a pathogen, an immunogenic variant of the protein, or an immunogenic fragment of the protein or the immunogenic variant thereof.
- the pathogen is a pathogen causing an infectious disease.
- the pharmaceutically active polypeptide and/or the antigen or epitope is derived from or is a SARS-CoV-2 spike (S) protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof.
- the RNA (such as mRNA) comprises an open reading frame (ORF) encoding an amino acid sequence comprising a SARS-CoV-2 S protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof.
- the SARS-CoV2 S protein variant has proline residue substitutions at positions 986 and 987 of SEQ ID NO: 1.
- the SARS-CoV2 S protein variant has at least 80% identity to the amino acid sequence of amino acids 17 to 1273 of SEQ ID NO:7 or the amino acid sequence of amino acids 17 to 1273 of SEQ ID NO: 1.
- the fragment comprises the receptor binding domain (RED) of the SARS-CoV-2 S protein.
- the fragment of (i) the SARS-CoV-2 S protein or (ii) the immunogenic variant of the SARS-CoV-2 S protein has at least 80% identity to the amino acid sequence of amino acids 327 to 528 of SEQ ID NO: 1.
- the present disclosure provides a method of preparing an aqueous RNA composition, wherein the method comprises (I) preparing a formulation comprising RNA and an aqueous phase, wherein the aqueous phase comprises a buffer substance, the buffer substance having the formula N(R’)(R 2 )(R 3 ), its N-oxide, or a protonated form thereof, wherein R ⁇ R 2 , and R 3 are as defined in the first aspect; and (II) optionally freezing the formulation to about -10°C or below, thereby obtaining the composition.
- the method comprises step (II) (i.e, freezing the formulation to about -10°C or below).
- the composition (a) comprises a cryoprotectant; (b) has a pH between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5; or (c) comprises a cryoprotectant and has a pH between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5.
- the cryoprotectant is (i) selected from the cryoprotectants disclosed herein; and/or (ii) is present in a concentration as disclosed herein.
- the cryoprotectant may be selected from the group consisting of sucrose, glucose, glycerol, 1,2-propanediol, 1,3 -propanediol, and a combination thereof, such as from the group consisting of sucrose, glycerol and glucose; and/or may be present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the cryoprotectant is glycerol, which is optionally present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the buffer substance is selected from BTM and its protonated form, TEA and its protonated form, ethyldiethanolamine and its protonated form, 2- (diethylamino)ethan-l -ol and its protonated form, triethylamine and its protonated form, 2-[2- (diethylamino)ethoxy]ethan-l -ol and its protonated form, diethanolamine and its protonated form, N,N'- bis(2-hydroxyethyl)piperazine and its protonated form, N,N,N',N'-tetrakis(2- hydroxyethyl)ethylenediamine and its protonated form, and trimethylamine N-oxide and its protonated form.
- the buffer substance comprises or is triethanolamine (TEA) or its protonated form.
- the present disclosure provides a method of storing a composition, comprising preparing a composition according to the method of the third aspect and storing the composition at a temperature ranging from about -90°C to about -10°C, such as from about -90°C to about -40°C or from about -40°C to about -25°C or from about -25 °C to about -10°C, or a temperature of about -20°C.
- storing the frozen composition is for at least 1 week, such as at least 2 weeks, at least 3 weeks, at least 4 weeks, at least 1 month, at least 2 months, at least 3 months, at least 6 months, at least 12 months, at least 24 months, or at least 36 months, preferably at least 4 weeks.
- storing the frozen composition is for at least 4 weeks, preferably at least 1 month, more preferably at least 2 months, more preferably at least 3 months, more preferably at least 6 months at -20°C.
- the composition can be stored at -70°C.
- the composition (a) comprises a cryoprotectant; (b) has a pH between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5; or (c) comprises a cryoprotectant and has a pH between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5.
- the cryoprotectant is (i) selected from the cryoprotectants disclosed herein; and/or (ii) is present in a concentration as disclosed herein.
- the cryoprotectant may be selected from the group consisting of sucrose, glucose, glycerol, 1,2-propanediol, 1,3-propanediol, and a combination thereof, such as from the group consisting of sucrose, glycerol and glucose; and/or may be present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the cryoprotectant is glycerol, which is optionally present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the buffer substance is selected from BTM and its protonated form, TEA and its protonated form, ethyldiethanolamine and its protonated form, 2- (diethylamino)ethan-l-ol and its protonated form, triethylamine and its protonated form, 2-[2- (diethylamino)ethoxy]ethan-l-ol and its protonated form, diethanolamine and its protonated form, N,N'- bis(2-hydroxyethyl)piperazine and its protonated form, N,N,N',N’-tetrakis(2- hydroxyethyl)ethylenediamine and its protonated form, and trimethylamine N -oxide and its protonated form.
- the buffer substance comprises or is triethanolamine (TEA) or its protonated form.
- the method of storing a composition comprises preparing a composition according to the method of the third aspect comprising step (II) (i.e., freezing the formulation to about -10°C or below); storing the frozen composition at a temperature ranging from about -90°C to about -10°C for a certain period of time (e.g., at least one week, such as at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, at least three months, at least 4 months, at least 6 months, at least 12 months, at least 24 months, or at least 36 months); and storing the frozen composition a temperature ranging from about 0°C to about 20°C for a certain period of time (e.g., at least four weeks, such as at least one month, at least two months, at least three months, at least 4 months, or at least 6 months).
- step (II) i.e., freezing the formulation to about -10°C or below
- step (II) i.e., freezing the
- the present disclosure provides a method of storing a composition, comprising preparing a liquid composition according to the method of the third aspect and storing the liquid composition at a temperature ranging from about 0°C to about 20°C, such as from about 1°C to about 15°C, from about 2°C to about 10°C, or from about 2°C to about 8°C, or at a temperature of about 5°C.
- storing the liquid composition is for at least 1 week, such as at least 2 weeks, at least 3 weeks, at least 4 weeks, at least 1 month, at least 2 months, at least 3 months, at least 6 months, at least 12 months, or at least 24 months, preferably at least 4 weeks.
- storing the liquid composition is for at least 4 weeks, preferably at least 1 month, more preferably at least 2 months, more preferably at least 3 months, more preferably at least 6 months at 5°C.
- the method of storing a composition comprises preparing a composition according to the method of the third aspect comprising step (II) (i.e ., freezing the formulation to about -10°C or below); and storing the frozen composition at a temperature ranging from about 0°C to about 20°C for a certain period of time (e.g., at least four weeks).
- the buffer substance is selected from BTM and its protonated form, TEA and its protonated form, ethyldiethanolamine and its protonated form, 2- (diethylamino)ethan-l -ol and its protonated form, triethylamine and its protonated form, 2-[2- (diethylamino)ethoxy]ethan-l -ol and its protonated form, diethanolamine and its protonated form, N,N'- bis(2-hydroxyethyl)piperazine and its protonated form, N,N,N',N'-tetrakis(2- hydroxyethyl)ethylenediamine and its protonated form, and trimethylamine N -oxide and its protonated form.
- the buffer substance comprises or is triethanolamine (TEA) or its protonated form.
- the present disclosure provides a composition preparable by the method of the, third, fourth, fifth, or sixth aspect.
- the composition can be in frozen form which, preferably, can be stored at a temperature of about -90°C or higher, such as about -90°C to about -10°C.
- the frozen composition of the seventh aspect can be stored at a temperature ranging from about -90°C to about -40°C or from about -40°C to about -25°C or from about -25°C to about -10°C, or a temperature to about -20°.
- the composition can be stored for at least 1 week, such as at least 2 weeks, at least 3 weeks, at least 4 weeks, at least 1 month, at least 2 months, at least 3 months, at least 6 months, at least 12 months, at least 24 months, or at least 36 months, preferably at least 4 weeks.
- the frozen composition can be stored for at least 4 weeks, preferably at least 1 month, more preferably at least 2 months, more preferably at least 3 months, more preferably at least 6 months at -20°C.
- the composition comprises a cryoprotectant; (b) has a pH between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5; or (c) comprises a cryoprotectant and has a pH between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5.
- the cryoprotectant is (i) selected from the cryoprotectants disclosed herein; and/or (ii) is present in a concentration as disclosed herein.
- the ciyoprotectant may be selected from the group consisting of sucrose, glucose, glycerol, 1 ,2-propanediol, 1 ,3-propanediol, and a combination thereof, such as from the group consisting of sucrose, glycerol and glucose; and/or may be present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the cryoprotectant is glycerol, which is optionally present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the buffer substance is selected from BTM and its protonated form, TEA and its protonated form, ethyldiethanolamine and its protonated form, 2- (diethylamino)ethan-l-ol and its protonated form, triethylamine and its protonated form, 2-[2- (diethylamino)ethoxy]ethan-l -ol and its protonated form, diethanolamine and its protonated form, N,N'- bis(2-hydroxyethyl)piperazine and its protonated form, N,N,N',N'-tetrakis(2- hydroxyethyl)ethylenediamine and its protonated form, and trimethylamine N-oxide and its protonated form.
- the buffer substance comprises or is triethanolamine (TEA) or its protonated form.
- the RNA integrity after thawing the frozen composition is at least 50%, such as at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98% or substantially 100%, e.g., after thawing the frozen composition which has been stored at -20°C, compared to the RNA integrity of the composition before the composition has been frozen.
- the initial RNA integrity of the composition (i.e., after its preparation but before freezing) is at least 50% and the RNA integrity of the composition after thawing the frozen composition is at least 90%, preferably at least 95%, more preferably at least 97%, more preferably at least 98%, more preferably substantially 100%, of the initial RNA integrity.
- the size (Zaverage) (and/or size distribution and/or polydispersity index (PDI)) of the RNA particles after thawing the frozen composition is essentially equal to the size (Z average ) (and/or size distribution and/or PDI) of the RNA particles before the composition has been frozen.
- the size (Z average ) of the RNA particles after thawing the frozen composition is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm.
- the PDI of the RNA particles after thawing the frozen composition is less than 0.3, preferably less than 0.2, more preferably less than 0.1.
- the size (Z aVerage ) of the RNA particles after thawing the frozen composition is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 rnn, and the size (Z average ) (and/or size distribution and/or PDI) of the RNA particles after thawing the frozen composition is essentially equal to the size (Z average ) (and/or size distribution and/or PDI) of the RNA particles before freezing.
- the size (Z avcragc ) of the RNA particles after thawing the frozen composition is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm, and the PDI of the RNA particles after thawing the frozen composition is less than 0.3 (preferably less than 0.2, more preferably less than 0.1).
- the size of the RNA particles and the RNA integrity of the composition after one freeze/thaw cycle are substantially the same as (i.e., are essentially equal to) the size of the RNA particles and the RNA integrity of the initial composition ⁇ i.e., before the composition has been frozen for the first time).
- the composition is in liquid form.
- the RNA integrity of the liquid composition when stored, e.g., at 0°C or higher for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, at least three months, at least 4 months, or at least 6 months), is sufficient to produce the desired effect, e.g., to induce an immune response.
- the RNA integrity of the liquid composition when stored, e.g., at 0°C or higher for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, at least three months, at least 4 months, or at least 6 months), may be at least 50%, such as at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 98%, compared to the RNA integrity before storage.
- the RNA integrity of the liquid composition when stored, e.g., at 0°C or higher for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, at least three months, at least 4 months, or at least 6 months), may be at least 90%, at least 95%, at least 97% or at least 98%, compared to the RNA integrity before storage.
- the RNA integrity of the composition after storage for at least four weeks preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is at least 50%, such as at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97% or at least 98%, compared to the RNA integrity before storage.
- the RNA integrity of the composition after storage for at least four weeks preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is at least 90%, at least 95%, at least 97% or at least 98%, compared to the RNA integrity before storage.
- the initial RNA integrity of the liquid composition is at least 50% and the RNA integrity of the liquid composition after storage for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, or at least 3 months), preferably at a temperature of 0°C or higher, such as about 2°C to about 8°C, is at least 90%, preferably at least 95%, more preferably at least 97%, more preferably at least 98%, of the initial RNA integrity.
- the initial RNA integrity of the liquid composition (i.e., after its preparation but before storage) is at least 50% and the RNA integrity of the liquid composition after storage for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, or at least 3 months), preferably at a temperature of 0 °C or higher, such as about 2°C to about 8°C, is at least 90% of the initial RNA integrity.
- the size (Z average ) (and/or size distribution and/or polydispersity index (PDI)) of the RNA particles of the liquid composition when stored, e.g., at 0°C or higher for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, at least three months, at least 4 months, or at least 6 months), is sufficient to produce the desired effect, e.g., to induce an immune response.
- the size (Za verage ) (and/or size distribution and/or polydispersity index (PDI)) of the RNA particles of the liquid composition when stored, e.g., at 0°C or higher for at least one week (such as for at least 2 weeks, at least three weeks, at least four weeks, at least one month, at least two months, at least three months, at least 4 months, or at least 6 months), is essentially equal to the size (Z avemge ) (and/or size distribution and/or PDI) of the RNA particles of the initial composition, i.e., before storage.
- the size (Z average ) of the RNA particles after storage of the liquid composition is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm.
- the PDI of the RNA particles after storage of the liquid composition e.g., at 0°C or higher for at least one week (such as for at least four weeks or at least three months) is less than 0.3, preferably less than 0.2, more preferably less than 0.1.
- the size (Z average ) of the RNA particles after storage of the liquid composition is between about 50 nm and about 500 nm, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm, and the size (Z average ) (and/or size distribution and/or PDI) of the RNA particles after storage of the liquid composition, e.g., at 0°C or higher for at least one week (such as for at least four weeks or at least three months) is essentially equal to the size (Z average ) (and/or size distribution and/or PDI) of the RNA particles before storage.
- the size (Z average ) of the RNA particles after storage of the liquid composition is between about 50 ran and about 500 run, preferably between about 40 nm and about 200 nm, more preferably between about 40 nm and about 120 nm
- the PDI of the RNA particles after storage of the liquid composition is less than 0.3 (preferably less than 0.2, more preferably less than 0.1).
- the present disclosure provides a method for preparing a ready-to-use pharmaceutical composition, the method comprising the steps of providing a frozen composition prepared by the method of the third, fourth, or fifth aspect and thawing the frozen composition thereby obtaining the ready-to-use pharmaceutical composition.
- the present disclosure provides a method for preparing a ready-to-use pharmaceutical composition, the method comprising the steps of providing a liquid composition prepared by the method of the third, fourth, or sixth aspect thereby obtaining the ready-to-use pharmaceutical composition.
- the present disclosure provides a ready-to-use pharmaceutical composition preparable by the method of the eighth or ninth aspect.
- any embodiment described herein in the context of the first, second, third, fourth, fifth, sixth, seventh, eighth, or ninth aspect may also apply to any embodiment of the tenth aspect.
- the present disclosure provides a composition of any one of the first, seventh, and tenth aspect for use in therapy.
- any embodiment described herein in the context of the first, second, third, fourth, fifth, sixth, seventh, eighth, ninth, or tenth aspect may also apply to any embodiment of the eleventh aspect.
- the present disclosure provides a composition of any one of the first, seventh, and tenth aspect for use in inducing an immune response.
- any embodiment described herein in the context of the first, second, third, fourth, fifth, sixth, seventh, eighth, ninth, tenth, or eleventh aspect may also apply to any embodiment of the twelfth aspect.
- the present disclosure provides a method of transfecting cells, comprising adding a composition of any one of the first, second, seventh or tenth aspect to cells; and incubating the mixture of the composition and cells for a sufficient amount of time.
- the RNA such as mRNA
- the mixture of the composition and cells is incubated for a time sufficient to allow the expression of the pharmaceutically active protein.
- the RNA is inhibitory RNA (such as siRNA) directed against a target mRNA
- the mixture of the composition and cells is incubated for a time sufficient to allow the inhibition of the transcription and/or translation of the target mRNA.
- the sufficient amount of time is at least one hour (such at least about 2 hours, at least about 3 hours, at least about 4 hours, at least about 5 hours, at least about 6 hours, at least about 9 hours, at least about 12 hours) and/or up to about 48 hours (such as up to about 36 or up to about 24 hours).
- the method is conducted in vivo (i.e., the cells form part of an organ, a tissue and/or an organism of a subject).
- the method is conducted in vitro (i.e., the cells do not form part of an organ, a tissue and/or an organism of a subject, e.g., the cells are an ex vivo cell culture).
- any embodiment described herein in the context of the first, second, third, fourth, fifth, sixth, seventh, eighth, ninth, tenth, eleventh or twelfth aspect may also apply to any embodiment of the thirteenth aspect.
- the present disclosure provides a use of a composition of any one of the first, second, seventh or tenth aspect for transfecting cells.
- the use is an in vivo use (i.e., the cells form part of an organ, a tissue and/or an organism of a subject).
- the use is an in vitro use (i.e., the cells do not form part of an organ, a tissue and/or an organism of a subject, e.g., the cells are an ex vivo cell culture).
- the present disclosure provides a kit comprising a composition of any one of the first, second, seventh, tenth, eleventh, or twelfth aspect or a pharmaceutical composition as described herein.
- the kit is for use in therapy, such as for inducing an immune response, hi some embodiments, the kit is for use in inducing an immune response against a pathogen, such as for treating or preventing an infectious disease.
- a composition comprising (i) RNA; (ii) a cationically ionizable lipid; and (iii) an aqueous phase, wherein the aqueous phase comprises a buffer system comprising a buffer substance having the formula N(R’)(R 2 )(R 3 ), its N-oxide, or a protonated form thereof, wherein: each of R 1 , R 2 , and R 3 is independently selected from H, C 1 - 6 alkyl, C 1 - 6 alkylene-R 4 , CH(C 1-5 alkylene- R 4 )2, and C(C 1-5 alkylene-R 4 )3, wherein at most one of R 1 , R 2 , and R 3 is H, CH(C M alkylene-R 4 )2, or C(C 1-5 alkylene-R 4 ) ⁇ ; or two of R 1 , R 2 , and R 3 join together with the nitrogen atom to form a 5- or 6- membered N -heterocycl
- each of R 1 , R 2 , and R 3 is independently selected from C M alkyl, C 1 - 6 alkylene-R 4 , CH(CM alkylene-R 4 )2, and C(CM alkylene-R 4 ) ⁇ , wherein at most one of R 1 , R 2 , and R 3 is CH(CM alkylene-R 4 )2 or C(CM alkylene-R 4 )3, preferably each of R 1 , R 2 , and R 3 is independently selected from C M alkyl, C M alkylene-R 4 , CH(C M alkylene-R 4 )2, and C(C M alkylene- R 4 )3, wherein at most one of R 1 , R 2 , and R 3 is CH(CM alkylene-R 4 ) ⁇ or C(C M alkylene-R 4 )3, more preferably each of R 1 , R 2 , and R 3 is independently selected from CM alkyl, CM alkylene-R 4 ,
- each R 4 is independently selected from -OH, -0-(Ci- 4 alkylene-OH), and -N(R 6 ) Z -(C I -4 alkylene-OH) 2-z , wherein each z is independently selected from 0 and 1 ; and each R 6 is independently selected from H and C1-3 alkyl, preferably each R 4 is independently selected from -OH, -0-(Ci_ 3 alkylene-OH), and -N(R 6 ) Z -(CI- 3 alkylene-OH) 2-z , wherein each z is independently selected from 0 and 1; and each R 6 is independently selected from H and C1-3 alkyl, more preferably each R 4 is independently selected from -OH, -0-(Ci_ 2 alkylene-OH), and -N(R 6 ) Z - (C1-2 alkylene-OH) 2-z , wherein each z is independently selected from 0 and 1; and each R 6 is independently selected from H
- each R 4 is independently selected from -OH, -0-(Ci- 4 alkylene-OH), and -N(CM alkylene-OH) 2 , preferably each R 4 is independently selected from -OH, -0-(C,- 3 alkylene-OH), and -N(C I-3 alkylene-OH) 2 , more preferably each R 4 is independently selected from -OH, -0-(C 1-2 alkylene-OH), and -N(C I.2 alkylene-OH) 2 .
- each of R 1 , R 2 , and R 3 is independently selected from methyl, ethyl, 2-hydroxyethyl, 2-(2-hydroxyethoxy)ethyl, 2-[bis(2- hydroxyethyl)amino] ethyl, and 1 ,5-dihydroxy-3-(2-hydroxyethyl)pentan-3-yl.
- composition of item 9 wherein all of R 1 , R 2 , and R 3 are methyl, ethyl, or 2-hydroxyethyl.
- composition of item 11 or 12, wherein R 3 is selected from methyl, ethyl, 2-hydroxyethyl, 2-(2-hydroxyethoxy)ethyl, 2-[bis(2-hydroxyethyl)amino]ethyl, and 1 ,5-dihydroxy-3-(2- hydroxyethyl)pentan-3 -yl .
- composition of item 1 wherein R 1 and R 2 j oin together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring which is optionally substituted with one or two R 5 .
- R 3 is selected from C 1 _ 6 alkyl, C 1 _ 6 alkylene-R 4 , and C(C 1-5 alkylene-R 4 )3, preferably R 3 is selected from C 1-4 alkyl, C 1-4 alkylene-R 4 , and C(C K 3 alkylene-R 4 )3, more preferably R 3 is selected from C 1.3 alkyl, C 1 -3 alkylene-R 4 , and C(Ci-3 alkylene-R 4 )3, more preferably R 3 is selected from C 1-2 alkyl, C 1-2 alkylene-R 4 , and C( C 1-2 alkylene-R 4 )3, more preferably R 3 is selected from selected from methyl, ethyl, 2-hydroxyethyl, 2-(2-hydroxyethoxy)ethyl, and 2-[bis(2- hydroxyethyl)amino]ethyl.
- N-heterocyclic ring is a monocyclic ring containing at least one nitrogen ring atom and optionally one further ring heteroatom selected from O and S.
- N-heterocyclic ring is a monocyclic ring containing (i) one nitrogen ring atom; (ii) two nitrogen ring atoms; (iii) one nitrogen ring atom and one oxygen ring atom; (iv) one nitrogen ring atom and one sulfur ring atom; or (v) three nitrogen ring atoms.
- N-heterocyclic ring is a monocyclic 5- or 6-membered N-heterocyclic ring, such as is a monocyclic 6-membered N-heterocyclic ring.
- composition of any one of items 14 to 18, wherein the N-heterocyclic ring is selected from pyrrolidinyl, imidazolidinyl, pyrazolidinyl, oxazolidinyl, thiazolidinyl, piperidinyl, piperazinyl, 1,2- diazinanyl, 1,3-diazinanyl, 1,3,5-triazinanyl, morpholinyl, and thiomorpholinyl, preferably selected from piperidinyl, piperazinyl, 1 ,2-diazinanyl, 1,3-diazinanyl, morpholinyl, and thiomorpholinyl.
- R 2 and R 3 is CH(C ]-3 alkylene-R 4 ) ? or C(Ci- ? alkylene-R 4 ) ? , more preferably each of R 2 and R 3 is independently selected from C M alkyl, C 1-3 alkylene-R 4 , CH(C M alkyl ene-R 4 )2, and C(C M alkylene-R 4 )?, wherein at most one of R 2 and R 3 is CH(CI-3 alkylene-R 4 )2 or C(Ci- 3 alkylene-R 4 )3, more preferably each of R 2 and R 3 is independently selected from C 1-2 alkyl, C 1.2 alkylene-R 4 , CH(C I -2 alkylene-R 4 )2, and C(Ci-2 alkylene-R 4 ) ? , wherein at most one of R 2 and R 3 is CH(C I -2 alkylene-R 4 ) ? or C(C,- 2 alkyl
- each of R 2 and R 3 is independently selected from C 1.4 alkyl, C 1-4 alkylene-R 4 , and C(Ci- 3 alkylene-R 4 )?, wherein at most one of R 2 and R 3 is C(Ci- 3 alkylene-R 4 )3, more preferably each of R 2 and R 3 is independently selected from C 1-3 alkyl, C 1 -3 alkylene-R 4 , and C(Ci_ 3 alkylene-R 4 )3, wherein at most one of R 2 and R 3 is C(C K? alkylene-R 4 ) ?
- each of R 2 and R 3 is independently selected from C 1-2 alkyl, C 1-2 alkylene-R 4 , and C(C 1-2 alkylene-R 4 ) ? , wherein at most one of R 2 and R 3 is C(C 1-2 alkylene-R 4 )3.
- each R 4 is independently selected from -OH, -0-(Ci- 4 alkylene-OH), and -N(C M alkylene-OH)2, preferably each R 4 is independently selected from -OH, -0-(C K? alkylene-OH), and -N(C M alkylene-OH) ? , more preferably each R 4 is independently selected from -OH, -0-(C 1-2 alkylene-OH), and -N(Ci-2 alkylene-GH)2.
- composition of any one of items 30 to 34, wherein each R 4 is independently selected from -OH, 2-hydroxyethoxy, and bis(2-hydroxyethyl)amino.
- each of R 2 and R 3 is independently selected from methyl, ethyl, 2-hydroxyethyl, 2-(2 -hydroxyethoxy)ethyl , 2-[bis(2- hydroxyethyl)amino]ethyl, and l,5-dihydroxy-3-(2-hydroxyethyl)pentan-3-yl, preferably, both of R 2 and R 3 are 2-hydroxyethyl or 2-(2-hydroxyethoxy)ethyl.
- the buffer substance is selected from bis(2-hydroxye
- a composition comprising (i) RNA; and (ii) an aqueous phase, wherein the aqueous phase comprises a buffer system comprising a buffer substance having the formula N(R')(R 2 )(R 3 ), its N-oxide, or a protonated form thereof, wherein: each of R 1 , R 2 , and R 3 is independently selected from H, C M alkyl, Ci-6 alkylene-R 4 , CH(CI-5 alkylene- R 4 )2, and C(Ci 5 alkylene-R 4 )3, wherein at most one of R 1 , R 2 , and R 3 is H, CH(C 1-5 alkylene-R 4 )2, or C(C 1-5 alkylene-R 4 )3; or two of R 1 , R 2 , and R 3 join together with the nitrogen atom to form a 5- or 6- membered N-heterocyclic ring which is optionally substituted with one or two R 5 ; each R 4 is independently selected from -
- each of R 1 , R 2 , and R 3 is independently selected from CM alkyl, C 1 - 6 alkylene-R 4 , CH(C M alkylene-R 4 )2, and C(C 1-5 alkylene-R 4 )3, wherein at most one of R 1 , R 2 , and R 3 is CH(C M alkylene-R 4 )2 or C(CM alkylene-R 4 )3, preferably each of R 1 , R 2 , and R 3 is independently selected from C M alkyl, C M alkylene-R 4 , CH(Ci-3 alkylene-R 4 )2, and C(CM alkylene- R 4 ) 3 , wherein at most one of R 1 , R 2 , and R 3 is CH(Ci-3 alkylene-R 4 )2 or C(Ci- 3 alkylene-R 4 )3, more preferably each of R 1 , R 2 , and R 3 is independently selected from C1-3 alkyl
- each of R 1 , R 2 , and R 3 is independently selected from Ci - 6 alkyl, C 1 - 6 alkylene-R 4 , and C(C 1-5 alkylene-R 4 ) 3 , wherein at most one of R 1 , R 2 , and R 3 is C(C 1-5 alkylene-R 4 ) 3 , preferably each of R 1 , R 2 , and R 3 is independently selected from C 1-4 alkyl, C 1-4 alkylene- R 4 , and C(Ci- 3 alkylene-R 4 ) 3 , wherein at most one of R 1 , R 2 , and R 3 is C(Ci- 3 alkylene-R 4 ) 3 , more preferably each of R 1 , R 2 , and R 3 is independently selected from C 1-3 alkyl, C 1-3 alkylene-R 4 , and C(Ci- 3 alkylene-R 4 ) 3 , wherein at most one of R 1
- composition of item 49 wherein each of R 1 and R 2 is 2-hydroxyethyl, ethyl, or methyl.
- composition of item 39 wherein R 1 and R 2 join together with the nitrogen atom to form a 5- or 6-membered N-heterocyclic ring which is optionally substituted with one or two R 5 .
- composition of item 52 wherein R 3 is selected from CM alkyl, C 1 - 6 alkylene-R 4 , and C(CM alkylene-R 4 )3, preferably R 3 is selected from C 1-4 alkyl, C 1-4 alkylene-R 4 , and C(CM alkylene-R 4 )3, more preferably R 3 is selected from CM alkyl, CM alkylene-R 4 , and C(CM alkylene-R 4 )3, more preferably R 3 is selected from CM alkyl, CM alkylene-R 4 , and C(CM alkylene-R 4 )3, more preferably R 3 is selected from selected from methyl, ethyl, 2-hydroxyethyl, 2-(2-hydroxyethoxy)ethyl, and 2-[bis(2- hydroxyethyl)amino]ethyl.
- N-heterocyclic ring is a monocyclic ring containing at least one nitrogen ring atom and optionally one further ring heteroatom selected from O and S.
- N-heterocyclic ring is a monocyclic ring containing (i) one nitrogen ring atom; (ii) two nitrogen ring atoms; (iii) one nitrogen ring atom and one oxygen ring atom; (iv) one nitrogen ring atom and one sulfur ring atom; or (v) three nitrogen ring atoms.
- composition of any one of items 52 to 53c, wherein the N-heterocyclic ring is selected from pyrrolidinyl, imidazolidinyl, pyrazolidinyl, oxazolidinyl, thiazolidinyl, piperidinyl, piperazinyl, 1,2- diazinanyl, 1 ,3-diazinanyl, 1,3,5-triazinanyl, morpholinyl, and thiomorpholinyl, preferably selected from piperidinyl, piperazinyl, 1 ,2-diazinanyl, 1 ,3-diazinanyl, morpholinyl, and thiomorpholinyl.
- composition of any one of items 52 to 53d wherein, if the N-heterocyclic ring contains only one nitrogen ring atom, this nitrogen ring atom is substituted with R 3 , R 3 being other than H, or, if the N-heterocyclic ring contains more than one nitrogen ring atom, one nitrogen ring atom is substituted with R 3 , R 3 being other than H, and at least one of the other nitrogen ring atoms, preferably each of the other nitrogen ring atoms, is substituted with R 5 .
- composition of item 57 wherein both ring N atoms are substituted and R 5 is selected from C 1 - 6 alkyl, CM alkylene-R 4 , and C(CM alkylene-R 4 )3, preferably R 5 is selected from C 1-4 alkyl, C M alkylene-R 4 , and C(CM alkylene-R 4 )?, more preferably R 5 is selected from CM alkyl, CM alkylene-R 4 , and C(CM alkylene-R 4 )?, more preferably R 5 is selected from CM alkyl, CM alkylene-R 4 , and C(CM alkylene-R 4 )3, more preferably R 5 is selected from selected from methyl, ethyl, 2-hydroxyethyl, 2-(2- hydroxyethoxy)ethyl, and 2-[bis(2-hydroxyethyl)amino]ethyl.
- both of R 3 and R 5 are 2-hydroxyethyl.
- each of R 2 and R 3 is independently selected from C M alkyl, C 1 - 6 alkylene-R 4 , CH(C M alkylene-R 4 ) 2 , and C(C M alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is CH(C 1-5 alkylene-R 4 ) 2 or C(Ci 5 alkylene-R 4 ) 3 , preferably each of R 2 and R 3 is independently selected from C 1-4 alkyl, C 1-4 alkylene-R 4 , CH(CI- 3 alkylene-R 4 ) 2 , and C(Ci.
- R 2 and R 3 alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is CH(Ci- 3 alkylene-R 4 ) 2 or C(Ci- 3 alkylene-R 4 ) 3 , more preferably each of R 2 and R 3 is independently selected from C 1-3 alkyl, C 1-3 alkylene-R 4 , CH(Ci- 3 alkylene-R 4 ) 2 , and C(C,, 3 alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is CH(C I-3 alkylene-R 4 ) 2 or C(Ci- 3 alkylene-R 4 ) 3 , more preferably each of R 2 and R 3 is independently selected from C 1-2 alkyl, Ci_ 2 alkylene-R 4 , CH(C I-2 alkylene-R 4 )2, and C(Ci- 2 alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is CH(C I.2
- each of R 2 and R 3 is independently selected from C M alkyl, C M alkylene-R 4 , and C(C M alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is C(C M alkylene-R 4 ) 3 , preferably each of R 2 and R 3 is independently selected from C 1-4 alkyl, C 1-4 alkylene-R 4 , and C(Ci- 3 alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is C(Ci- 3 alkylene-R 4 ) 3 , more preferably each of R 2 and R 3 is independently selected from Ci- 3 alkyl, C 1-3 alkylene-R 4 , and C(Ci- 3 alkylene-R 4 ) 3 , wherein at most one of R 2 and R 3 is C(Ci- 3 alkylene-R 4 ) 3 , more preferably each of R 2 and R 3
- each R 4 is independently selected from -OH, -0-(Ci- 4 alkylene-OH), and -N(C I-4 alkylene-OH)2, preferably each R 4 is independently selected from -OH, -0-(C]- 3 alkylene-OH), and -N(C I -3 alkylene-OII)2, more preferably each R 4 is independently selected from -OH, -0-(C 1-2 alkylene-OH), and -N(CI-2 alkylene-OH)2.
- BTM Bis(
- concentration of the buffer substance in the composition is between about 10 mM and about 200 mM, preferably between about 15 inM and about 100 mM, more preferably between about 20 mM and about 80 mM, more preferably between about 40 mM and about 60 mM, such as about 50 mM.
- composition of any one of items 1 to 67, wherein the pH of the composition is between about 4.0 and about 8.0, preferably between about 4.5 and about 8.0, such as between about 5.0 and about 8.0, between about 5.5 and about 8.0, between about 6.0 and about 8.0, between about 6.5 and about 8.0, between about 6.8 and about 7.9, or between about 7.0 and about 7.8.
- composition of any one of items 1 to 69, wherein the osmolality of the composition is at most about 1000 x 10 ⁇ 3 osmol/kg, preferably between about 100 x 10 "3 osmol/kg and about 750 x 10 3 osmol/kg, such as between about 100 x 10 ‘3 osmol/kg and about 500 x 10 3 osmol/kg, more preferably about 300 x 10 3 osmol/kg.
- composition of any one of items 1 to 70, wherein the concentration of the RNA in the composition is about 5 mg/1 to about 500 mg/1, such as about 10 mg/1 to about 400 mg/1, about 10 mg/1 to about 300 mg/1, about 10 mg/1 to about 200 mg/1, about 10 mg/1 to about 150 mg/1, or about 10 mg/1 to about 100 mg/1, preferably about 10 mg/1 to about 140 mg/1, more preferably about 20 mg/1 to about 130 mg/1, more preferably about 30 mg/1 to about 120 mg/1.
- composition of any one of items 1 to 38 and 66 to 72, wherein the cationically ionizable lipid comprises a head group which includes at least one nitrogen atom which is capable of being protonated under physiological conditions.
- G 1 and G 2 are each independently unsubstituted C1-C12 alkylene or C2-12 alkenylene;
- G 3 is Ci - 24 alkylene, C2-24 alkenylene, C3-8 cycloalkylene, or C3-8 cycloalkenylene;
- R a is H or Ci-12 alkyl
- R 35 and R 36 are each independently Ce-24 alkyl or Ce-24 alkenyl
- R 40 is Ci-12 alkyl
- R 50 is H or C 1 - 6 alkyl; and x is 0, 1 or 2.
- the cationically ionizable lipid is selected from the following structures X-l to X-36:
- the cationically ionizable lipid is selected from the following structures A to G: or
- the cationically ionizable lipid is the lipid having the structure X-3. 75.
- the composition of any one of items 1 to 38 and 66 to 73, wherein the cationic or cationically ionizable lipid has the structure of Formula (XI): wherein each of Ri and R 2 is independently R 5 or -Gi-Li-R 6 , wherein at least one of Ri and R 2 is -G I -LI-R 6 ; each of R 3 and R 4 is independently selected from the group consisting of Ci_ 6 alkyl, C 2-6 alkenyl, aryl, and C 3-10 cycloalkyl; each of R 5 and R 6 is independently a non-cyclic hydrocarbyl group having at least 10 carbon atoms; each of Gi and G 2 is independently unsubstituted Ci-i 2 alkylene or C 2 -i 2 alkenylene; each of Li and L 2 is independently selected from the group consisting of -0(C O)-,
- Ra is H or C MI alkyl; m is 0, 1, 2, 3, or 4; and x is 0, 1 or 2.
- composition of any one of items 1 to 38, 66 to 73, and 75, wherein the cationically ionizable lipid is selected from the following structures (XIV- 1), (X1V-2), and (XIV-3): 76.
- the composition of any one of items 1 to 38 and 66 to 75a, wherein the cationically ionizable lipid comprises from about 20 mol % to about 80 mol %, preferably from about 25 mol % to about 65 mol %, more preferably from about 30 mol % to about 50 mol %, such as from about 40 mol % to about 50 mol %, of the total lipid present in the composition. 77.
- composition of any one of items 1 to 76 which further comprises one or more additional lipids, preferably selected from the group consisting of polymer conjugated lipids, neutral lipids, steroids, and combinations thereof, more preferably the composition comprises the cationically ionizable lipid, a polymer conjugated lipid, a neutral lipid (e.g., a phospholipid), and a steroid.
- additional lipids preferably selected from the group consisting of polymer conjugated lipids, neutral lipids, steroids, and combinations thereof, more preferably the composition comprises the cationically ionizable lipid, a polymer conjugated lipid, a neutral lipid (e.g., a phospholipid), and a steroid.
- composition of item 77, wherein the polymer conjugated lipid comprises a pegylated lipid, wherein the pegylated lipid preferably (i) is selected from the group consisting of DSPE-PEG, DOPE- PEG, DPPE-PEG, and DMPE-PEG; or (ii) has the following structure: or a pharmaceutically acceptable salt, tautomer or stereoisomer thereof, wherein:
- R 12 and R 13 are each independently a straight or branched, saturated or unsaturated alkyl chain containing from 10 to 30 carbon atoms, wherein the alkyl chain is optionally interrupted by one or more ester bonds; and w has a mean value ranging from 30 to 60.
- composition of item 77, wherein the polymer conjugated lipid comprises a polysarcosine- lipid conjugate or a conjugate of polysarcosine and a lipid-like material
- the polysarcosine-lipid conjugate or conjugate of polysarcosine and a lipid-like material preferably is a member selected from the group consisting of a polysarcosine-diacylglycerol conjugate, a polysarcosine-dialkyloxypropyl conjugate, a polysarcosine-phospholipid conjugate, a polysarcosine-ceramide conjugate, and a mixture thereof.
- composition of any one of items 77 to 79, wherein the polymer conjugated lipid comprises from about 0.5 mol % to about 5 mol %, preferably from about 1 mol % to about 5 mol %, more preferably from about 1 mol % to about 4.5 mol % of the total lipid present in the composition.
- composition of any one of items 77 to 81, wherein the neutral lipid comprises from about 5 mol % to about 40 mol %, preferably from about 5 mol % to about 20 mol %, more preferably from about 5 mol % to about 15 mol % of the total lipid present in the composition.
- composition of any one of items 77 to 84 which comprises a cationically ionizable lipid, a polymer conjugated lipid, a neutral lipid (e.g., a phospholipid), and a steroid, wherein the cationically ionizable lipid comprises from about 30 mol % to about 50 mol %, such as from about 40 mol % to about 50 mol %, of the total lipid present in the composition; the polymer conjugated lipid comprises from about 1 mol % to about 4.5 mol % of the total lipid present in the composition; the neutral lipid (e.g., phospholipid) comprises from about 5 mol % to about 15 mol % of the total lipid present in the composition; and the steroid comprises from about 30 mol % to about 50 mol % of the total lipid present in the composition.
- the cationically ionizable lipid comprises from about 30 mol % to about 50 mol %, such as from about 40
- LNPs lipid nanoparticles
- LPXs lipoplexes
- composition of item 86, the particles comprise at least about 75%, preferably at least about
- RNA comprises a modified nucleoside in place of uridine, wherein the modified nucleoside is preferably selected from pseudouridine (y), N 1 -methyl -pseudouridine (hi ⁇ y), and 5 -methyl-uridine (m5U);
- y pseudouridine
- hi ⁇ y N 1 -methyl -pseudouridine
- m5U 5 -methyl-uridine
- ii) has a coding sequence which is codon-optimized
- iii has a coding sequence whose G/C content is increased compared to the wild-type coding sequence.
- composition of any one of items 1 to 89, wherein the RNA comprises at least one of the following, preferably all of the following: a 5’ cap; a 5’ UTR; a 3’ UTR; and a poly-A sequence.
- the poly-A sequence comprises at least 100 A nucleotides, wherein the poly-A sequence preferably is an interrupted sequence of A nucleotides.
- composition of item 90 or 91, wherein the 5’ cap is a capl or cap2 structure.
- composition of item 93, wherein the pharmaceutically active polypeptide and/or the antigen or epitope is derived from or is a protein of a pathogen, an immunogenic variant of the protein, or an immunogenic fragment of the protein or the immunogenic variant thereof.
- composition of item 93 or 94, wherein the pharmaceutically active polypeptide and/or the antigen or epitope is derived from or is a SARS-CoV-2 spike (S) protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof.
- S SARS-CoV-2 spike
- composition of item 94 or 95, wherein the RNA comprises an open reading frame (ORF) encoding an amino acid sequence comprising a SARS-CoV-2 S protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof.
- ORF open reading frame
- composition of item 95 or 95a, wherein the SARS-CoV2 S protein variant has proline residue substitutions at positions 986 and 987 of SEQ ID NO: 1.
- composition of any one of items 95 to 95c, wherein the fragment comprises the receptor binding domain (RBD) of the SARS-CoV-2 S protein.
- RBD receptor binding domain
- composition of item 95d wherein the fragment of (i) the SARS-CoV-2 S protein or (ii) the immunogenic variant of the SARS-CoV-2 S protein has at least 80% identity to the amino acid sequence of amino acids 327 to 528 of SEQ ID NO: 1.
- size (Z aV era g e) and/or size distribution and/or polydispersity index (PDI) of RNA particles (in particular LNPs) after storage of the composition is essentially equal to the size (Z average ) and/or size distribution and/or PDI of the RNA particles before storage.
- composition of item 99 wherein the pH of the composition is between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5.
- composition of item 99 or 99a, further comprising a cryoprotectant comprising
- composition of item 99b, wherein the cryoprotectant is selected from the group consisting of sucrose, glucose, glycerol, 1 ,2-propanediol, 1 ,3-propanediol, and a combination thereof, such as from the group consisting of sucrose, glycerol and glucose, for example the cryoprotectant is glycerol.
- a method of preparing a composition comprising LNPs dispersed in a final aqueous phase, wherein the LNPs comprise a cationically ionizable lipid and RNA;
- the final aqueous phase comprises a final buffer system comprising a final buffer substance, the final buffer substance having the formula NCR'XR 2 ) ⁇ 3 ), its N-oxide, or a protonated form thereof, wherein R 1 , R 2 , and R 3 are as defined in any one of items 1 to 38; wherein the method comprises:
- step (II) optionally freezing the formulation to about -10°C or below, thereby obtaining the composition, wherein step (I) comprises:
- step (I) comprises:
- step (f) optionally filtrating the first intermediate formulation prepared under (e') using a further aqueous buffer solution comprising a further buffer system, thereby preparing a further intermediate formulation comprising the LNPs dispersed in a further aqueous phase comprising the further buffer system, wherein the further aqueous buffer solution may be identical to or different from the first aqueous buffer solution;
- step (f) optionally repeating step (f ) once or two or more times, wherein the further intermediate formulation comprising the LNPs dispersed in the further aqueous phase comprising the further buffer system obtained after step (f) of one cycle is used as the first intermediate formulation of the next cycle, wherein in each cycle the further aqueous buffer solution may be identical to or different from the first aqueous buffer solution;
- step (h') filtrating the first intermediate formulation obtained in step (e'), if step (f) is absent, or the further intermediate formulation obtained in step (f), if step (f ) is present and step (g') is not present, or the further intermediate formulation obtained after step (g'), if steps (f) and (g 1 ) are present, using a final aqueous buffer solution comprising the final buffer system;
- step (i') optionally diluting the formulation obtained in step (h') with a dilution solution; thereby preparing the formulation comprising the LNPs dispersed in the final aqueous phase.
- the method of item 106 wherein the pH of the composition is between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5.
- 107 The method of item 106 or 106a, further comprising a cryoprotectant (preferably the formulation obtained in step (I) and/or the composition comprise(s) a cryoprotectant).
- a cryoprotectant preferably the formulation obtained in step (I) and/or the composition comprise(s) a cryoprotectant.
- cryoprotectant is selected from the group consisting of sucrose, glucose, glycerol, 1,2-propanediol, 1,3 -propanediol, and a combination thereof, such as from the group consisting of sucrose, glycerol and glucose, for example the cryoprotectant is glycerol.
- cryoprotectant is present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- the final buffer system further comprises an anion, preferably selected from the group consisting of chloride, acetate, glycolate, lactate, the anion of morpholinoethanesulfonic acid (MES), the anion of 3-(N-morpholino)propanesulfonic acid (MOPS), the anion of 2-[4-(2-hydroxyethyl)piperazin-l -yljethanesulfonic acid (HEPES), and the anion of a di- or tricarboxylic acid, such as the anion of citric acid, succinic acid, malonic acid, glutaric acid, or adipic acid.
- an anion preferably selected from the group consisting of chloride, acetate, glycolate, lactate, the anion of morpholinoethanesulfonic acid (MES), the anion of 3-(N-morpholino)propanesulfonic acid (MOPS), the anion of 2-[4-(2-hydroxyethyl)piperazin-l -y
- concentration of the final buffer substance in the composition is between about 10 mM to about 200 mM, preferably between about 15 mM to about 100 mM, more preferably between about 20 mM to about 80 mM, more preferably between about 40 mM to about 60 mM, such as about 50 mM.
- RNA solution obtained in step (a) has a pH of below 6.0, preferably at most about 5.0, more preferably at most about 4.5; or (ii) the first aqueous buffer solution has a pH of below 6.0, preferably at most about 5.0, more preferably at most about 4.5.
- the first buffer system used in step (a) comprises the final buffer substance used in step (d), preferably the buffer system and pH of the first buffer system used in step (a) are identical to the buffer system and pH of the final aqueous buffer solution used in step (d); or (ii) each of the first buffer system and every further buffer system used in steps (b'), (f ) and (g 1 ) comprises the final buffer substance used in step (h'), preferably the buffer system and pH of each of the first aqueous buffer solution and of every further aqueous buffer solution used in steps (b 1 ), (f) and (g') are identical to the buffer system and pH of the final aqueous buffer solution.
- any one of items 102 to 111 wherein the pH of the composition is between about 4.0 and about 8.0, preferably between about 4.5 and about 8.0, such as between about 5.0 and about 8.0, between about 5.5 and about 8.0, between about 6.0 and about 8.0, between about 6.5 and about 8.0, between about 6.8 and about 7.9, or between about 7.0 and about 7. 113.
- the method of any one of items 102 to 112, wherein water is the main component in the formulation and/or composition and/or the total amount of solvent(s) other than water contained in the composition is less than about 0.5% (v/v).
- any one of items 102 to 113, wherein the osmolality of the composition is at most about 1000 x 10 '3 osmol/kg, preferably between about 100 x 10 '3 osmol/kg and about 750 x 10 "3 osmol/kg, such as between about 100 x 10 3 osmol/kg and about 500 x 10 '3 osmol/kg, more preferably about 300 x 10 '3 osmol/kg.
- RNA in the composition is about 5 mg/1 to about 500 mg/1, such as about 10 mg/1 to about 400 mg/1, about 10 mg/1 to about 300 mg/1, about 10 mg/1 to about 200 mg/1, about 10 mg/1 to about 150 mg/1, or about 10 mg/1 to about 100 mg/1, preferably about 10 mg/1 to about 140 mg/1, more preferably about 20 mg/1 to about 130 mg/1, more preferably about 30 mg/1 to about 120 mg/1.
- step (I) further comprises diluting the formulation prepared under (d) with a dilution solution, or step (i') is present, wherein the dilution solution comprises a cryoprotectant; and/or (ii) the fonnulation obtained in step (I) and the composition comprise a cryoprotectant, preferably in a concentration of at least about 1% w/v, wherein the cryoprotectant preferably comprises one or more selected from the group consisting of carbohydrates and alcohols (such as sugar alcohols or lower alcohols), more preferably the cryoprotectant is selected from the group consisting of sucrose, glucose, glycerol, 1, 2-propanediol, 1,3-propanediol, sorbitol, and a combination thereof (such as from the group consisting of sucrose, glucose, glycerol, 1 ,2-propanediol, 1,3-propanediol
- cationically ionizable lipid comprises a head group which includes at least one nitrogen atom which is capable of being protonated under physiological conditions.
- 116a The method of any one of items 102 to 116, wherein the cationically ionizable lipid is as defined in any one of items 73 to 75 a.
- 117. The method of any one of items 102 to 116a, wherein the ethanolic solution prepared in step (b) or (d') further comprises one or more additional lipids and the LNPs further comprise the one or more additional lipids, wherein the one or more additional lipids are preferably selected from the group consisting of polymer conjugated lipids, neutral lipids, steroids, and combinations thereof, more preferably the one or more additional lipids comprise a polymer conjugated lipid, a neutral lipid (e.g., a phospholipid), and a steroid.
- a neutral lipid e.g., a phospholipid
- lipid is a phospholipid, preferably selected from the group consisting of phosphatidylcholines, phosphatidylethanolamines, phosphatidylglycerols, phosphatidic acids, phosphatidylserines and sphingomyelins, more preferably selected from the group consisting of distearoylphosphatidylcholine (DSPC), dioleoylphosphatidylcholine (DOPC), dimyristoylphosphatidylcholine (DMPC), dipentadecanoylphosphatidylcholine, dilauroylphosphatidylcholine, dipalmitoylphosphatidylcholine (DPPC), diarachidoylphosphatidylcholine (DAPC), dibehenoylphosphatidylcholine (DBPC), ditricosanoylphosphatidylcholine (DTPC), di
- DSPC distearoylphosphatidylcholine
- RNA is as defined in any one of items 88 and 89 to 95e.
- step (II) The method of any one of items 102 to 105 and 107 to 119, which does not comprise step (II).
- a method of preparing an aqueous RNA composition comprising:
- aqueous phase comprises a buffer substance, the buffer substance having the formula N(R')(R 2 )(R 3 ), its N-oxide, or a protonated form thereof, wherein R 1 , R 2 , and R 3 are as defined in any one of items 1 to 38; and
- cryoprotectant is selected from the group consisting of sucrose, glycerol, glucose, 1,2-propanediol, 1,3 -propanediol, and a combination thereof, such as from the group consisting of sucrose, glycerol and, glucose, for example the cryoprotectant is glycerol.
- cryoprotectant is present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- step (II) The method of item 121, which does not comprise step (II).
- the buffer substance is selected from BTM and its protonated form, TEA and its protonated form, ethyldiethanolamine and its protonated form, 2- (diethylamino)ethan-l-ol and its protonated form, triethylamine and its protonated form, 2-[2- (diethylamino)ethoxy]ethan-l-ol and its protonated form, diethanolamine and its protonated form, N,N'- bis(2-hydroxyethyl)piperazine and its protonated form, N,N,N',N'-tetrakis(2- hydroxyethyl)ethylenediamine and its protonated form, and trimethylamine N-oxide and its protonated form.
- a method of storing a composition comprising preparing a composition according to the method of any one of items 102 to 119, 121, 122, and 125 and storing the composition at a temperature ranging from about -90°C to about -10°C, such as from about -90°C to about -40°C or from about -25 °C to about -10°C.
- cryoprotectant is selected from the group consisting of sucrose, glucose, glycerol, 1 ,2-propanediol, 1,3-propanediol, and a combination thereof, such as from the group consisting of sucrose, glycerol and glucose, for example the cryoprotectant is glycerol.
- cryoprotectant is present in a concentration of between about 100 mM and about 600 mM, preferably between about 200 mM and about 600 mM and more preferably between about 300 mM and about 500 mM.
- any one of items 126 to 127b, wherein storing the composition is for at least 1 month, such as at least 2 months, at least 3 months, at least 6 months, at least 12 months, at least 24 months, or at least 36 months.
- a method of storing a composition comprising preparing a composition according to the method of any one of items 102 to 128 and storing the composition at a temperature ranging from about 0°C to about 20°C, such as from about 1°C to about 15°C, from about 2°C to about 10°C, or from about 2°C to about 8°C, or at a temperature of about 5°C.
- composition for at least 1 week, such as at least 2 weeks, at least 3 weeks, at least 4 weeks, at least 1 month, at least 2 months, at least 3 months, at least 6 months, at least 12 months, or at least 24 months.
- composition of item 131 which is in frozen form.
- 132a The composition of item 132, wherein the pH of the composition is between 4.0 and 8.0, preferably between 5.0 and 7.0, more preferably between 5.5 and 6.5 and most preferably about 5.5.
- composition of item 132 or 132a, further comprising a cryoprotectant is provided.
- cryoprotectant is selected from the group consisting of sucrose, glucose, glycerol, 1 ,2-propanediol, 1,3-propanediol, and a combination thereof, such as from the group consisting of sucrose, glycerol and glucose, for example the cryoprotectant is glycerol.
- composition of any one of items 132 to 134, wherein the size (Z average ) and/or size distribution and/or polydispersity index (PDI) of RNA particles after thawing the frozen composition is essentially equal to the size (Z average ) and/or size distribution and/or PDI of the RNA particles before the composition has been frozen.
- composition of item 131 which is in liquid form.
- composition of item 136 wherein the RNA integrity after storage of the composition for at least 1 week is at least 50% compared to the RNA integrity before storage.
- a method for preparing a ready-to-use pharmaceutical composition comprising the steps of providing a frozen composition prepared by the method of any one of items 102 to 119, 121 to 123b, and 125 to 128, and thawing the frozen composition thereby obtaining the ready-to-use pharmaceutical composition.
- 140. A method for preparing a ready-to-use pharmaceutical composition, the method comprising the step of providing a liquid composition prepared by the method of any one of items 102 to 105, 107 to 121, 124, 125, 129, and 130, thereby obtaining the ready-to-use pharmaceutical composition.
- a ready-to-use pharmaceutical composition preparable by the method of item 139 or 140.
- a method of transfecting cells comprising adding a composition of any one of items 1 to 101, 131 to 138, and 141 to cells; and incubating the mixture of the composition and cells for a sufficient amount of time.
- kits comprising a composition of any one of items 1 to 101, 131 to 138, and 141 to 143 or a pharmaceutical composition as described herein.
- the kit of item 143c which is for use in therapy, such as for inducing an immune response.
- the kit of item 143c or 143d which is for use in inducing an immune response against a pathogen, such as for treating or preventing an infectious disease.
- Figure 1 Degradation of RNA in relation of the type of buffer substance. RNA LNPs were incubated for 12 weeks at room temperature in various buffer systems (100 mM, pH 7.4).
- RNA LNPs were incubated for 12 weeks at room temperature in various buffer systems (100 mM, pH 7.4).
- Figure 3 RNA integrity versus buffer chemistry.
- Figure 4 Impact of the presence of different cryoprotectants in LNP RNA compositions subjected to at least one freeze/thaw cycle on the size of the LNPs.
- the terms used herein are defined as described in "A multilingual glossary of biotechnological terms: (IUPAC Recommendations) " , H.G.W. Leuenberger, B. Nagel, and H. Kolbl, Eds., Helvetica Chimica Acta, CH-4010 Basel, Switzerland, (1995).
- the term "about” denotes an interval of accuracy that the person of ordinary skill will understand to still ensure the technical effect of the feature in question.
- the term typically indicates deviation from the indicated numerical value by ⁇ 10%, such as ⁇ 5%, ⁇ 4%, ⁇ 3%, ⁇ 2%, ⁇ 1%, ⁇ 0.9%, ⁇ 0.8%, ⁇ 0.7%, ⁇ 0.6%, ⁇ 0.5%, ⁇ 0.4%, ⁇ 0.3%, ⁇ 0.2%, ⁇ 0.1%, ⁇ 0.05%, and for example ⁇ 0.01%.
- "about” indicates deviation from the indicated numerical value by ⁇ 10%.
- "about” indicates deviation from the indicated numerical value by ⁇ 5%.
- “about” indicates deviation from the indicated numerical value by ⁇ 4%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 3%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 2%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 1%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.9%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.8%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.7%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.6%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.5%.
- “about” indicates deviation from the indicated numerical value by ⁇ 0.4%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.3%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.2%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.1%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.05%. In some embodiments, “about” indicates deviation from the indicated numerical value by ⁇ 0.01%. As will be appreciated by the person of ordinary skill, the specific such deviation for a numerical value for a given technical effect will depend on the nature of the technical effect. For example, a natural or biological technical effect may generally have a larger such deviation than one for a man-made or engineering technical effect.
- Physiological pH refers to a pH of about 7.5 or about 7.4. In some embodiments, physiological pH is from 7.3 to 7.5. In some embodiments, physiological pH is from 7.35 to 7.45. In some embodiments, physiological pH is 7.3, 7.35, 7.4, 7.45, or 7.5.
- physiological conditions refer to the conditions (in particular pH and temperature) in a living subject, in particular a human.
- physiological conditions mean a physiological pH and/or a temperature of about 37°C.
- % (w/v) refers to weight by volume percent, which is a unit of concentration measuring the amount of solute in grams (g) expressed as a percent of the total volume of solution in milliliters (ml).
- % by weight or “% (w/w)” (or “% w/w”) refers to weight percent, which is a unit of concentration measuring the amount of a substance in grams (g) expressed as a percent of the total weight of the total composition in grams (g).
- mol % is defined as the ratio of the number of moles of one component to the total number of moles of all components, multiplied by 100.
- mol % of the total lipid is defined as the ratio of the number of moles of one lipid component to the total number of moles of all lipids, multiplied by 100.
- total lipid includes lipids and lipid-like material.
- ionic strength refers to the mathematical relationship between the number of different kinds of ionic species in a particular solution and their respective charges.
- ionic strength I is represented mathematically by the formula: in which c is the molar concentration of a particular ionic species and z the absolute value of its charge. The sum ⁇ is taken over all the different kinds of ions (i) in solution.
- the term "ionic strength" in some embodiments relates to the presence of monovalent ions.
- divalent inorganic ions in particular divalent inorganic cations, their concentration or effective concentration (presence of free ions) due to the presence of chelating agents is in one embodiment sufficiently low so as to prevent degradation of the RNA.
- the concentration or effective concentration of divalent inorganic ions is below’ the catalytic level for hydrolysis of the phosphodiester bonds between RNA nucleotides.
- the concentration of free divalent inorganic ions is 20 mM or less. In one embodiment, there are no or essentially no free divalent inorganic ions.
- Oleality refers to the concentration of a particular solute expressed as the number of osmoles of solute per kilogram of solvent.
- lyophilizing refers to the freeze-drying of a substance by freezing it and then reducing the surrounding pressure (e.g., below 15 Pa, such as below 10 Pa, below 5 Pa, or 1 Pa or less) to allow the frozen medium in the substance to sublimate directly from the solid phase to the gas phase.
- surrounding pressure e.g., below 15 Pa, such as below 10 Pa, below 5 Pa, or 1 Pa or less
- spray-drying refers to spray-drying a substance by mixing (heated) gas wdth a fluid that is atomized (sprayed) within a vessel (spray dryer), where the solvent from the formed droplets evaporates, leading to a dry powder.
- the term "reconstitute” relates to adding a solvent such as water to a dried product to return it to a liquid state such as its original liquid state.
- freeze relates to the solidification of a liquid, usually with the removal of heat.
- aqueous phase as used herein in relation to a composition/ formulation comprising particles, in particular LNPs, liposomes, and/or lipoplexes, means the mobile or liquid phase, i.e ., the continuous water phase including all components dissolved therein but (formally) excluding the particles.
- particles such as LNPs
- the aqueous phase is free of X is such manner as it is practically and realistically feasible, e.g., the concentration of compound X in the aqueous composition is less than 1% by weight.
- the particles dispersed in the aqueous phase may comprise compound X in an amount of more than 1% by weight.
- protonated form as used herein in relation with a base (e.g., the buffer substance having the formula N(R’)(R 2 )(R 3 ) or its N-oxide) means the conjugate acid of the base, wherein the conjugate acid contains a proton which is removable by deprotonation resulting in the base.
- the protonated form of TEA has the formula [HN(CH 2 CH 2 0H) 3 ] + .
- a “buffer substance” as used herein refers to a mixture of the base and its protonated form (e.g., a mixture of TEA and [HN(CH 2 CH 2 0H) 3 ] + ). Consequently, the amount of a buffer substance contained in a composition is the sum of the amounts of both the base and the conjugate acid in the composition.
- recombinant in the context of the present disclosure means "made through genetic engineering". In some embodiments, a “recombinant object" in the context of the present disclosure is not occurring naturally.
- naturally occurring refers to the fact that an object can be found in nature.
- a peptide or nucleic acid that is present in an organism (including viruses) and can be isolated from a source in nature and which has not been intentionally modified by man in the laboratory is naturally occurring.
- found in nature means "present in nature” and includes known objects as well as objects that have not yet been discovered and/or isolated from nature, but that may be discovered and/or isolated in the future from a natural source.
- room temperature and “ambient temperature” are used interchangeably herein and refer to temperatures from at least about 15°C, preferably from about 15°C to about 35°C, from about 15°C to about 30°C, from about 15°C to about 25 °C, or from about 17°C to about 22°C. Such temperatures will include 15°C, 16°C, 17°C, 18°C, 19°C, 20°C, 21°C and 22°C.
- alkyl refers to a monoradical of a saturated straight or branched hydrocarbon.
- the alkyl group comprises from 1 to 12 (such as 1 to 10) carbon atoms, i.e., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 carbon atoms, abbreviated as C 1- 12 alkyl, (such as 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 carbon atoms, abbreviated as Ci_io alkyl), more preferably 1 to 8 carbon atoms, such as 1 to 6 or 1 to 4 carbon atoms.
- Exemplary alkyl groups include methyl, ethyl, propyl, iso-propyl (also called 2-propyl or 1- methylethyl), butyl, iso-butyl, tert-butyl, n-pentyl, iso-pentyl, sec-pentyl, neo-pentyl, 1,2-dimethyl- propyl, iso-amyl, n-hexyl, iso-hexyl, sec-hexyl, n-heptyl, iso-heptyl, n-octyl, 2-ethyl-hexyl, n-nonyl, n- decyl, n-undecyl, n-dodecyl, and the like.
- a “substituted alkyl” means that one or more (such as 1 to the maximum number of hydrogen atoms bound to an alkyl group, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or up to 10, such as between 1 to 5, 1 to 4, or 1 to 3, or 1 or 2) hydrogen atoms of the alkylene group are replaced with a substituent other than hydrogen (when more than one hydrogen atom is replaced the substituents may be the same or different).
- the substituent other than hydrogen is a 1 st level substituent, as specified herein.
- Examples of a substituted alkyl include chloromethyl, dichloromethyl, fluoromethyl, and difluoromethyl.
- alkylene refers to a diradical of a saturated straight or branched hydrocarbon.
- the alkylene comprises from 1 to 12 (such as 1 to 10) carbon atoms, i.e., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 carbon atoms (such as 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 carbon atoms), more preferably 1 to 8 carbon atoms, such as 1 to 6 or 1 to 4 carbon atoms.
- Exemplary alkylene groups include methylene, ethylene ( i.e ., 1,1 -ethylene, 1,2-ethylene), propylene (i.e., 1 , 1 -propylene, 1 ,2-propylene (- €H(03 ⁇ 4)03 ⁇ 4-), 2,2- propylene (-(2(03 ⁇ 4)2-), and 1,3-propylene), the butylene isomers (e.g., 1 , 1 -butylene, 1 ,2 -butylene, 2,2- butylene, 1,3-butylene, 2,3-butylene (cis or trans or a mixture thereof), 1 ,4-butylene, 1,1 -iso-butylene, 1 ,2-iso-butylene, and 1,3 -iso-butylene), the pentylene isomers (e.g., 1 , 1 -pentylene, 1 ,2-pentylene, 1,3- pentylene, 1 ,4-pentylene, 1 ,
- the straight alkylene moieties having at least 3 carbon atoms and a free valence at each end can also be designated as a multiple of methylene (e.g., 1 ,4-butylene can also be called tetramethylene).
- methylene e.g. 1 ,4-butylene can also be called tetramethylene
- tetramethylene a polymer of ethylene
- the ending "ylene” for alkylene moieties as specified above, one can also use the ending "diyl” (e.g., 1 ,2-butylene can also be called butan-l,2-diyl).
- a “substituted alkylene” means that one or more (such as 1 to the maximum number of hydrogen atoms bound to an alkylene group, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or up to 10, such as between 1 to 5, 1 to 4, or 1 to 3, or 1 or 2) hydrogen atoms of the alkylene group are replaced with a substituent other than hydrogen (when more than one hydrogen atom is replaced the substituents may be the same or different).
- the substituent other than hydrogen is a 1 st level substituent, as specified herein.
- alkenyl refers to a monoradical of an unsaturated straight or branched hydrocarbon having at least one carbon-carbon double bond.
- the maximal number of carbon-carbon double bonds in the alkenyl group can be equal to the integer which is calculated by dividing the number of carbon atoms in the alkenyl group by 2 and, if the number of carbon atoms in the alkenyl group is uneven, rounding the result of the division down to the next integer.
- the maximum number of carbon-carbon double bonds is 4.
- the alkenyl group has 1 to 6 (such as 1 to 4), i.e., 1, 2, 3, 4, 5, or 6, carbon-carbon double bonds.
- the alkenyl group comprises from 2 to 12 (such as 2 to 10) carbon atoms, i.e., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 carbon atoms (such as 2, 3, 4, 5, 6, 7, 8, 9, or 10 carbon atoms), more preferably 2 to 8 carbon atoms, such as 2 to 6 carbon atoms or 2 to 4 carbon atoms.
- the alkenyl group comprises from 2 to 12, abbreviated as C2-12 alkenyl, (e.g., 2 to 10) carbon atoms and 1, 2, 3, 4, 5, or 6 (e.g., 1, 2, 3, 4, or 5) carbon-carbon double bonds, more preferably it comprises 2 to 8 carbon atoms and 1, 2, 3, or 4 carbon-carbon double bonds, such as 2 to 6 carbon atoms and 1, 2, or 3 carbon-carbon double bonds or 2 to 4 carbon atoms and 1 or 2 carbon-carbon double bonds.
- the carbon-carbon double bond(s) may be in cis (Z) or trans (E) configuration.
- alkenyl groups include vinyl, 1- propenyl, 2-propenyl (i.e., allyl), 1-butenyl, 2-butenyl, 3-butenyl, 1 -pentenyl, 2-pentenyl, 3-pentenyl, 4- pentenyl, 1-hexenyl, 2-hexenyl, 3-hexenyl, 4-hexenyl, 5-hexenyl, 1-heptenyl, 2-heptenyl, 3-heptenyl, 4- heptenyl, 5-heptenyl, 6-heptenyl, 1-octenyl, 2-octenyl, 3-octenyl, 4-octenyl, 5-octenyl, 6-octenyl, 7- octenyl, 1 -nonenyl, 2-nonenyl, 3-nonenyl, 4-nonenyl, 5-nonenyl, 6-nonenyl, 7-nonenyl,
- a "substituted alkenyl” means that one or more (such as 1 to the maximum number of hydrogen atoms bound to an alkenyl group, e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, or up to 10, such as between 1 to 5, 1 to 4, or 1 to 3, or 1 or 2) hydrogen atoms of the alkenyl group are replaced with a substituent other than hydrogen (when more than one hydrogen atom is replaced the substituents may be the same or different).
- the substituent other than hydrogen is a l sl level substituent as specified herein.
- alkynyl refers to a linear or branched monovalent hydrocarbon moiety having at least one carbon-carbon triple bond in which the total carbon atoms may be six to thirty, typically six to twenty, often six to eighteen.
- Alkynyl groups can optionally have one or more carbon carbon double bonds.
- the maximal number of carbon-carbon triple bonds in the alkynyl group can be equal to the integer which is calculated by dividing the number of carbon atoms in the alkynyl group by 2 and, if the number of carbon atoms in the alkynyl group is uneven, rounding the result of the division down to the next integer.
- the maximum number of carbon- carbon triple bonds is 4.
- the alkynyl group has 1 to 6 (such as 1 to 4), i.e., 1, 2, 3, 4, 5, or 6, more preferably 1 or 2 carbon-carbon triple bonds.
- alkenylene refers to a diradical of an unsaturated straight or branched hydrocarbon having at least one carbon-carbon double bond.
- the maximal number of carbon-carbon double bonds in the alkenylene group can be equal to the integer which is calculated by dividing the number of carbon atoms in the alkenylene group by 2 and, if the number of carbon atoms in the alkenylene group is uneven, rounding the result of the division down to the next integer.
- the maximum number of carbon-carbon double bonds is 4.
- the alkenylene group has 1 to 6 (such as 1 to 4), i.e., 1, 2, 3, 4, 5, or 6, carbon-carbon double bonds.
- the alkenylene group comprises from 2 to 12 (such as 2 to 10) carbon atoms, i.e., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , or 12 carbon atoms (such as 2, 3, 4, 5, 6, 7, 8, 9, or 10 carbon atoms), more preferably 2 to 8 carbon atoms, such as 2 to 6 carbon atoms or 2 to 4 carbon atoms.
- the alkenylene group comprises from 2 to 12 (such as 2 to 10 carbon) atoms and 1, 2, 3, 4, 5, or 6 (such as 1 , 2, 3, 4, or 5) carbon-carbon double bonds, more preferably it comprises 2 to 8 carbon atoms and 1 , 2, 3, or 4 carbon-carbon double bonds, such as 2 to 6 carbon atoms and 1, 2, or 3 carbon-carbon double bonds or 2 to 4 carbon atoms and 1 or 2 carbon-carbon double bonds.
- the carbon-carbon double bond(s) may be in cis (Z) or trans (E) configuration.
- alkenylene groups include ethen-l,2-diyl, vinylidene (also called ethenylidene), 1 -propen- 1,2-diyl, 1 -propen-1, 3-diyl, 1 -propen-2, 3-diyl, allylidene, 1-buten- 1,2-diyl, 1-buten-l, 3-diyl, 1-buten-l ,4-diyl, 1 -buten-2, 3-diyl, l-buten-2,4-diyl, 1- buten-3,4-diyl, 2-buten- 1,2-diyl, 2-buten-l, 3-diyl, 2-buten-l,4-diyl, 2-buten-2, 3-diyl, 2-buten-l,4-diyl, 2-buten-2, 3-diyl, 2-buten-2,4-diyl, 2-buten-2, 3-diyl, 2-buten-2
- a "substituted alkenylene” means that one or more (such as 1 to the maximum number of hydrogen atoms bound to an alkenylene group, e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, or up to 10, such as between 1 to 5, 1 to 4, or 1 to 3, or 1 or 2) hydrogen atoms of the alkenylene group are replaced with a substituent other than hydrogen (when more than one hydrogen atom is replaced the substituents may be the same or different).
- the substituent other than hydrogen is a 1 st level substituent as specified herein.
- cycloalkyl represents cyclic non-aromatic versions of “alkyl” and "alkenyl” with preferably 3 to 14 carbon atoms, such as 3 to 12 or 3 to 10 carbon atoms, i.e., 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, or 14 carbon atoms (such as 3, 4, 5, 6, 7, 8, 9, or 10 carbon atoms), more preferably 3 to 7 carbon atoms.
- Exemplary cycloalkyl groups include cyclopropyl, cyclopropenyl, cyclobutyl, cyclobutenyl, cyclopentyl, cyclopentenyl, cyclohexyl, cyclohexenyl, cycloheptyl, cycloheptenyl, cyclooctyl, cyclooctenyl, cyclononyl, cyclononenyl, cylcodecyl, cylcodecenyl, and adamantyl.
- the cycloalkyl group may consist of one ring (monocyclic), two rings (bicyclic), or mre than two rings (polycyclic).
- cycloalkylene represents cyclic non-aromatic versions of "alkylene” and is a geminal, vicinal or isolated diradical.
- the cycloalkylene (i) is monocyclic or polycyclic (such as bi- or tricyclic) and/or (ii) is 3- to 14-membered (i.e., 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 11-, 12-, 13-, or 14- membered, such as 3- to 12-membered or 3- to 10-membered).
- the cycloalkylene is a mono-, bi- or tricyclic 3- to 14-membered (i.e., 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 11-, 12-, 13-, or 14- membered, such as 3- to 12-membered or 3- to 10-membered) cycloalkylene.
- cycloalkylene groups include cyclohexylene, cycloheptylene, cyclopropylene, cyclobutylene, cyclopentylene, cyclooctylene, bicyclo[3.2.1] octylene, bicyclo[3.2.2]nonylene, and adamantanylene (e.g., tricyclo[3.3.1.1 37 ]decan-2,2- diyl).
- a “substituted cycloalkylene” means that one or more (such as 1 to the maximum number of hydrogen atoms bound to an cycloalkylene group, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or up to 10, such as between 1 to 5, 1 to 4, or 1 to 3, or 1 or 2) hydrogen atoms of the alkylene group are replaced with a substituent other than hydrogen (when more than one hydrogen atom is replaced the substituents may be the same or different).
- the substituent other than hydrogen is a 1 st level substituent as specified herein.
- cycloalkenylene represents cyclic non-aromatic versions of "alkenylene” and is a geminal, vicinal or isolated diradical.
- the maximal number of carbon-carbon double bonds in the cycloalkenylene group can be equal to the integer which is calculated by dividing the number of carbon atoms in the cycloalkenylene group by 2 and, if the number of carbon atoms in the cycloalkenylene group is uneven, rounding the result of the division down to the next integer.
- the maximum number of carbon-carbon double bonds is 4.
- the cycloalkenylene group has 1 to 6 (such as 1 to 4), i.e., 1, 2, 3, 4, 5, or 6, carbon-carbon double bonds.
- the cycloalkenylene (i) is monocyclic or polycyclic (such as bi- or tricyclic) and/or (ii) is 3- to 14-membered (i.e., 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 11-, 12-, 13-, or 14- membered, such as 3- to 12-membered or 3- to 10-membered).
- the cycloalkenylene is a mono-, bi- or tricyclic 3- to 14-membered (i.e., 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 11-, 12-, 13-, or 14- membered, such as 3- to 12-membered or 3- to 10-membered) cycloalkenylene.
- exemplary cycloalkenylene groups include cyclohexenylene, cycloheptenylene, cyclopropenylene, cyclobutenylene, cyclopentenylene, and cyclooctenylene.
- a “substituted cycloalkenylene” means that one or more (such as 1 to the maximum number of hydrogen atoms bound to an cycloalkenylene group, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or up to 10, such as between 1 to 5, 1 to 4, or 1 to 3, or 1 or 2) hydrogen atoms of the cycloalkenylene group are replaced with a substituent other than hydrogen (when more than one hydrogen atom is replaced the substituents may be the same or different).
- the substituent other than hydrogen is a 1 st level substituent as specified herein.
- aryl refers to a monoradical of an aromatic cyclic hydrocarbon.
- the aryl group contains 3 to 14 (e.g., 5, 6, 7, 8, 9, or 10, such as 5, 6, or 10) carbon atoms which can be arranged in one ring (e.g., phenyl) or two or more condensed rings (e.g., naphthyl).
- exemplary aryl groups include cyclopropenylium, cyclopentadienyl, phenyl, indenyl, naphthyl, azulenyl, fluorenyl, anthryl, and phenanthryl.
- aryl refers to a monocyclic ring containing 6 carbon atoms or an aromatic bicyclic ring system containing 10 carbon atoms. Preferred examples are phenyl and naphthyl. Aryl does not encompass fullerenes.
- heterocyclyl or “heterocyclic ring” means a non-aromatic cycloalkyl group as defined above in which from 1, 2, 3, or 4 ring carbon atoms in the cycloalkyl group are replaced by heteroatoms, preferably selected from the group consisting of oxygen, nitrogen, silicon, selenium, phosphorous, and sulfur, more preferably from the group consisting of O, S, and N.
- a heterocyclyl group has preferably 1 or 2 rings containing from 3 to 10, such as 3, 4, 5, 6, or 7, ring atoms.
- the maximum number of O atoms is 1
- the maximum number of S atoms is 1
- the maximum total number of O and S atoms is 2.
- heterocyclyl groups include morpholinyl, pyrrolidinyl, imidazolidinyl, pyrazolidinyl, oxazolidinyl, thiazolidinyl, piperidinyl (also called piperidyl), piperazinyl, 1,2-diazinanyl, 1,3-diazinanyl, 1,3,5-triazinanyl, morpholinyl, thiomorpholinyl, di- and tetrahydrofuranyl, di- and tetrahydrothienyl , di- and tetrahydropyranyl, urotropinyl, lactones, lactams, cyclic iinides, and cyclic anhydrides.
- a “substituted heterocyclyl” means that one or more (such as 1 to the maximum number of hydrogen atoms bound to a heterocyclyl group, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or up to 10, such as between 1 to 5, 1 to 4, or 1 to 3, or 1 or 2) hydrogen atoms of the heterocyclyl group are replaced with a substituent other than hydrogen (when more than one hydrogen atom is replaced the substituents may be the same or different).
- the substituent other than hydrogen is a 1 st level substituent as specified herein.
- N-heterocyclic ring means a heterocyclic ring as defined above, wherein the heterocyclic ring contains at least one N ring atom and may contain one or more further ring heteroatoms (preferably selected from the group consisting of oxygen, nitrogen, silicon, selenium, phosphorous, and sulfur, more preferably from the group consisting of O, S, and N).
- N-heterocyclic rings include pyrrolidinyl, imidazolidinyl, pyrazolidinyl, oxazolidinyl, thiazolidinyl, piperidinyl, piperazinyl, 1,2- diazinanyl, 1,3-diazinanyl, 1,3,5-triazinanyl, morpholinyl, and thiomorpholinyl, preferably selected from piperidinyl, piperazinyl, 1 ,2-diazinanyl, 1 ,3-diazinanyl, morpholinyl, and thiomorpholinyl.
- a “substituted N-heterocyclic ring” means that one or more (such as 1 to the maximum number of hydrogen atoms bound to an N-heterocyclic ring, e.g., 1 , 2, 3, 4, 5, 6, 7, 8, 9, or up to 10, such as between 1 to 5, 1 to 4, or 1 to 3, or 1 or 2) hydrogen atoms of the N-heterocyclic ring are replaced with a substituent other than hydrogen (when more than one hydrogen atom is replaced the substituents may be the same or different).
- the substituent other than hydrogen is a 1 st level substituent as specified herein.
- aromatic as used in the context of hydrocarbons means that the whole molecule has to be aromatic.
- a monocyclic aryl is hydrogenated (either partially or completely) the resulting hydrogenated cyclic structure is classified as cycloalkyl for the purposes of the present disclosure.
- a bi- or polycyclic aryl such as naphthyl
- the resulting hydrogenated bi- or polycyclic structure is classified as cycloalky] for the purposes of the present disclosure (even if one ring, such as in 1 ,2-dihydronaphthyl, is still aromatic).
- heteroaryl i.e., an aryl group as defined above in which one or more carbon atoms in the aryl group are replaced by heteroatoms
- heterocyclyl i.e., an aryl group as defined above in which one or more carbon atoms in the aryl group are replaced by heteroatoms
- indolinyl i.e., a dihydro variant of indolyl
- heterocyclyl is classified as heterocyclyl for the purposes of the present disclosure, since only one ring of the bicyclic structure is aromatic and one of the ring atoms is a heteroatom.
- Particularly preferred 1 st level substituents are selected from the group consisting of methyl, ethyl, propyl, isopropyl, halogen (such as F, Cl, or Br), and -CF3, such as halogen (e.g.. F, Cl, or Br), and -CF3.
- R', R 2 , and R 3 is H, CH(C 1-5 alkylene-R 4 )2, or C(C M alkylene-R 4 )3
- N(R 1 )(R 2 )(R 3 ) means that each of the H, CH(CI-5 alkylene-R 4 )2, and C(C]-5 alkylene-R 4 )3 can be bound to the N atom of N(R ] )(R 2 )(R 3 ) only once at the same time.
- R 1 , R 2 , and R 3 is H, the other two cannot be H (i.e., the other two must be other than H).
- R 1 , R 2 , and R 3 are CH(C 1-5 alkylene-R 4 )2, the other two cannot be CH(C I-5 alkylene-R 4 )2 (i.e., the other two must be other than CH(C 1-5 alkylene-R 4 )2). Also, if one of R 1 , R 2 , and R 3 is C(C 1-5 alkylene- R 4 )3, the other two cannot be C(C 1-5 alkylene-R 4 ) 3 (i.e., the other two must be other than C(C 1-5 alkylene- R 4 )3).
- the expression means that only one of R 1 , R 2 , and R 3 can be either H, CH(C 1-5 alkylene- R 4 )2, or C(C 1-5 alkylene-R 4 )3, the other two can neither be H, nor CH(C 1-5 alkylene-R 4 )2, nor C(C 1-5 alkylene-R 4 )3 (e.g., the other two are independently Ci-e alkyl, or join together with the nitrogen atom to form a 5- or 6-membered N -heterocyclic ring which is optionally substituted with one or two R 5 ).
- after thawing the frozen composition means that the frozen composition has to be thawed before the characteristics (such as RNA integrity and/or size (Z aV erage) and/or size distribution and/or the PDI of the particles (such as LNPs) contained in the composition) can be measured.
- characteristics such as RNA integrity and/or size (Z aV erage) and/or size distribution and/or the PDI of the particles (such as LNPs) contained in the composition
- a "monovalent” compound relates to a compound having only one functional group of interest.
- a monovalent anion relates to a compound having only one negatively charged group, preferably under physiological conditions.
- a “divalent” or “dibasic” compound relates to a compound having two functional groups of interest.
- a dibasic organic acid has two acid groups.
- a "polyvalent” or “polybasic” compound relates to a compound having three or more functional groups of interest.
- a polybasic organic acid has three or more acid groups.
- substantially free of X means that a mixture (such as an aqueous phase of a composition or formulation described herein) is free of X is such manner as it is practically and realistically feasible.
- the amount of X in the mixture may be less than 1% by weight (e.g., less than 0.5% by weight, less than 0.4% by weight, less than 0.3% by weight, less than 0.2% by weight, less than 0.1% by weight, less than 0.09% by weight, less than 0.08% by weight, less than 0.07% by weight, less than 0.06% by weight, less than 0.05% by weight, less than 0.04% by weight, less than 0.03% by weight, less than 0.02% by weight, less than 0.01% by weight, less than 0.005% by weight, less than 0.001% by weight), based on the total weight of the mixture.
- citrate anion means any compound which contains a citrate anion and which when solved in an aqueous medium releases the citrate anion.
- examples of compounds which contain a citrate anion and which release the citrate anion when solved in an aqueous medium, include citric acid and salts of citric acid.
- anion of EDTA means any compound which contains an anion of EDTA and which when solved in an aqueous medium releases the anion of EDTA.
- examples of compounds which contain an anion of EDTA and which release an anion when solved in an aqueous medium include ethylenediaminetetraacetic acid (EDTA) and salts of EDTA.
- dibasic organic acid anions means any organic compound containing two acid groups which are in free form (i.e., protonated), anhydride form or salt form.
- the term “acid group” refers to a carboxylic acid or sulfate group.
- the expression “dibasic organic acids” does not include esters of a carboxylic or sulfate group with one or more organic alcohols. Examples of dibasic organic acids include oxalic acid, malic acid, and tartaric acid.
- polybasic organic acid anions means any organic compound containing three or more acid groups which are in free form (i.e., protonated), anhydride form or salt form.
- the term "acid group” refers to a carboxylic acid or sulfate group.
- the expression “polybasic organic acids” does not include esters of a carboxylic or sulfate group with one or more organic alcohols.
- a polybasic organic acid includes citric acid.
- RNA integrity means the percentage of the full-length (i.e., non-fragmented) RNA to the total amount of RNA (i.e., non-fragmented plus fragmented RNA) contained in a sample.
- the RNA integrity may be determined by chromatographically separating the RNA (e.g., using capillary electrophoresis), determining the peak area of the main RNA peak (i.e., the peak area of the full-length (i.e., non-fragmented) RNA), determining the peak area of the total RNA, and dividing the peak area of the main RNA peak by the peak area of the total RNA.
- cryoprotectant relates to a substance that is added to a preparation (e.g., formulation or composition) in order to protect the active ingredients of the preparation during the freezing stages.
- lyoprotectant relates to a substance that is added to a formulation in order to protect the active ingredients during the drying stages.
- peptide comprises oligo- and polypeptides and refers to substances which comprise about two or more, about 3 or more, about 4 or more, about 6 or more, about 8 or more, about 10 or more, about 13 or more, about 16 or more, about 20 or more, and up to about 50, about 100 or about 150, consecutive amino acids linked to one another via peptide bonds.
- polypeptide refers to large peptides, in particular peptides having at least about 151 amino acids.
- eptides and “polypeptides” are both protein molecules, although the terms “protein” and “polypeptide” are used herein usually as synonyms.
- a “therapeutic protein” has a positive or advantageous effect on a condition or disease state of a subject when provided to the subject in a therapeutically effective amount.
- a therapeutic protein has curative or palliative properties and may be administered to ameliorate, relieve, alleviate, reverse, delay onset of or lessen the severity of one or more symptoms of a disease or disorder.
- a therapeutic protein may have prophylactic properties and may be used to delay the onset of a disease or to lessen the severity of such disease or pathological condition.
- the term "therapeutic protein” includes entire proteins or peptides, and can also refer to therapeutically active fragments thereof. It can also include therapeutically active variants of a protein. Examples of therapeutically active proteins include, but are not limited to, antigens for vaccination and immunostimulants such as cytokines.
- a nucleic acid such as RNA (e.g., mRNA) encoding a peptide, polypeptide or protein is taken up by or introduced, i.e. transfected or transduced, into a cell which cell may be present in vitro or in a subject, resulting in expression of said peptide, polypeptide or protein.
- the cell may express the encoded peptide, polypeptide or protein intracellularly (e.g. in the cytoplasm and/or in the nucleus), may secrete the encoded peptide, polypeptide or protein, and/or may express it on the surface.
- nucleic acid expressing and “nucleic acid encoding” or similar terms are used interchangeably herein and with respect to a particular peptide, polypeptide or protein mean that the nucleic acid, if present in the appropriate environment, preferably within a cell, can be expressed to produce said peptide, polypeptide or protein.
- portion refers to a fraction. With respect to a particular structure such as an amino acid sequence or protein the term “portion” thereof may designate a continuous or a discontinuous fraction of said structure.
- the terms “part” and “fragment” are used interchangeably herein and refer to a continuous element.
- a part of a structure such as an amino acid sequence or protein refers to a continuous element of said structure.
- the term “part” means a portion of the composition.
- a part of a composition may any portion from 0.1 % to 99.9% (such as 0.1%, 0.5%, 1%, 5%, 10%, 50%, 90%, or 99%) of said composition.
- “Fragment” with reference to an amino acid sequence (peptide, polypeptide or protein), relates to a part of an amino acid sequence, i.e. a sequence which represents the amino acid sequence shortened at the N-terminus and/or C-terminus.
- a fragment shortened at the C-terminus is obtainable, e.g., by translation of a truncated open reading frame that lacks the 3 '-end of the open reading frame.
- a fragment shortened at the N-terminus is obtainable, e.g., by translation of a truncated open reading frame that lacks the 5 '-end of the open reading frame, as long as the truncated open reading frame comprises a start codon that serves to initiate translation.
- a fragment of an amino acid sequence comprises, e.g., at least 50%, at least 60%, at least 70%, at least 80%, at least 90% of the amino acid residues from an amino acid sequence.
- a fragment of an amino acid sequence preferably comprises at least 6, in particular at least 8, at least 12, at least 15, at least 20, at least 30, at least 50, or at least 100 consecutive amino acids from an amino acid sequence.
- a fragment of an amino acid sequence comprises, e.g., a sequence of up to 8, in particular up to 10, up to 12, up to 15, up to 20, up to 30 or up to 55, consecutive amino acids of the amino acid sequence.
- a part or fragment of a peptide, polypeptide or protein preferably has at least one functional property of the peptide, polypeptide or protein from which it has been derived.
- Such functional properties comprise a pharmacological activity, the interaction with other peptides, polypeptides or proteins, an enzymatic activity, the interaction with antibodies, and the selective binding of nucleic acids.
- a pharmacological active fragment of a peptide, polypeptide or protein has at least one of the pharmacological activities of the peptide, polypeptide or protein from which the fragment has been derived.
- a part or fragment of a peptide, polypeptide or protein preferably comprises a sequence of at least 6, in particular at least 8, at least 10, at least 12, at least 15, at least 20, at least 30 or at least 50, consecutive amino acids of the peptide or protein.
- a part or fragment of a peptide or protein preferably comprises a sequence of up to 8, in particular up to 10, up to 12, up to 15, up to 20, up to 30 or up to 55, consecutive amino acids of the peptide or protein.
- Variant as used herein and with reference to an amino acid sequence (peptide, polypeptide, or protein), is meant an amino acid sequence that differs from a parent amino acid sequence by virtue of at least one amino acid (e.g., a different amino acid, or a modification of the same amino acid).
- the parent amino acid sequence may be a naturally occurring or wild type (WT) amino acid sequence, or may be a modified version of a wild type amino acid sequence.
- the variant amino acid sequence has at least one amino acid difference as compared to the parent amino acid sequence, e.g., from 1 to about 20 amino acid differences, and preferably from 1 to about 10 or from 1 to about 5 amino acid differences compared to the parent.
- wild type or “WT” or “native” herein is meant an amino acid sequence that is found in nature, including allelic variations.
- a wild type amino acid sequence, peptide, polypeptide or protein has an amino acid sequence that has not been intentionally modified.
- variants of an amino acid sequence comprise amino acid insertion variants, amino acid addition variants, amino acid deletion variants and/or amino acid substitution variants.
- variant includes all mutants, splice variants, post-translationally modified variants, conformations, isoforms, allelic variants, species variants, and species homologs, in particular those which are naturally occurring.
- variant includes, in particular, fragments of an amino acid sequence.
- Amino acid insertion variants comprise insertions of single or two or more amino acids in a particular amino acid sequence. In the case of amino acid sequence variants having an insertion, one or more amino acid residues are inserted into a particular site in an amino acid sequence, although random insertion with appropriate screening of the resulting product is also possible.
- Amino acid addition variants comprise amino- and/or carboxy-terminal fusions of one or more amino acids, such as 1, 2, 3, 5, 10, 20, 30, 50, or more amino acids.
- Amino acid deletion variants are characterized by the removal of one or more amino acids from the sequence, such as by removal of 1, 2, 3, 5, 10, 20, 30, 50, or more amino acids. The deletions may be in any position of the protein.
- Amino acid deletion variants that comprise the deletion at the N-terminal and/or C-terminal end of the protein are also called N-terminal and/or C- terminal truncation variants.
- Amino acid substitution variants are characterized by at least one residue in the sequence being removed and another residue being inserted in its place. Preference is given to the modifications being in positions in the amino acid sequence which are not conserved between homologous proteins or peptides and/or to replacing amino acids with other ones having similar properties.
- amino acid changes in peptide and protein variants are conservative amino acid changes, i.e., substitutions of similarly charged or uncharged amino acids.
- a conservative amino acid change involves substitution of one of a family of amino acids which are related in their side chains.
- Naturally occurring amino acids are generally divided into four families: acidic (aspartate, glutamate), basic (lysine, arginine, histidine), non-polar (alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), and uncharged polar (glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine) amino acids. Phenylalanine, tryptophan, and tyrosine are sometimes classified jointly as aromatic amino acids.
- conservative amino acid substitutions include substitutions within the following groups: - glycine, alanine;
- the degree of similarity, preferably identity between a given amino acid sequence and an amino acid sequence which is a variant of said given amino acid sequence will be at least about 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%.
- the degree of similarity or identity is given preferably for an amino acid region which is at least about 10%, at least about 20%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90% or about 100% of the entire length of the reference amino acid sequence.
- the degree of similarity or identity is given preferably for at least about 20, at least about 40, at least about 60, at least about 80, at least about 100, at least about 120, at least about 140, at least about 160, at least about 180, or about 200 amino acids, in some embodiments continuous amino acids.
- the degree of similarity or identity is given for the entire length of the reference amino acid sequence.
- the alignment for determining sequence similarity, preferably sequence identity can be done with art known tools, preferably using the best sequence alignment, for example, using Align, using standard settings, preferably EMBOSS::needle, Matrix: Blosum62, Gap Open 10.0, Gap Extend 0.5.
- Sequence similarity indicates the percentage of amino acids that either are identical or that represent conservative amino acid substitutions.
- Sequence identity between two amino acid sequences indicates the percentage of amino acids that are identical between the sequences.
- Sequnce identity between two nucleic acid sequences indicates the percentage of nucleotides that are identical between the sequences.
- % identical and % identity are intended to refer, in particular, to the percentage of nucleotides or amino acids which are identical in an optimal alignment between the sequences to be compared. Said percentage is purely statistical, and the differences between the two sequences may be but are not necessarily randomly distributed over the entire length of the sequences to be compared. Comparisons of two sequences are usually carried out by comparing the sequences, after optimal alignment, with respect to a segment or "window of comparison", in order to identify local regions of corresponding sequences. The optimal alignment for a comparison may be carried out manually or with the aid of the local homology algorithm by Smith and Waterman, 1981, Ads App. Math. 2, 482, with the aid of the local homology algorithm by Neddleman and Wunsch, 1970, J.
- NCBI National Center for Biotechnology Information
- the algorithm parameters used for BLASTN algorithm on the NCBI website include: (i) Expect Threshold set to 10; (ii) Word Size set to 28; (iii) Max matches in a query range set to 0; (iv) Match/Mismatch Scores set to 1, -2; (v) Gap Costs set to Linear; and (vi) the filter for low complexity regions being used.
- the algorithm parameters used for BLASTP algorithm on the NCBI website include: (i) Expect Threshold set to 10; (ii) Word Size set to 3; (iii) Max matches in a query range set to 0; (iv) Matrix set to BLOSUM62; (v) Gap Costs set to Existence: 11 Extension: 1 ; and (vi) conditional compositional score matrix adjustment.
- Percentage identity is obtained by determining the number of identical positions at which the sequences to be compared correspond, dividing this number by the number of positions compared (e.g., the number of positions in the reference sequence) and multiplying this result by 100.
- the degree of similarity or identity is given for a region which is at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90% or about 100% of the entire length of the reference sequence.
- the degree of identity is given for at least about 100, at least about 120, at least about 140, at least about 160, at least about 180, or about 200 nucleotides, in some embodiments continuous nucleotides.
- the degree of similarity or identity is given for the entire length of the reference sequence.
- Homologous amino acid sequences exhibit according to the disclosure at least 40%, in particular at least 50%, at least 60%, at least 70%, at least 80%, at least 90% and preferably at least 95%, at least 98 or at least 99% identity of the amino acid residues.
- amino acid sequence variants described herein may readily be prepared by the skilled person, for example, by recombinant DNA manipulation.
- the manipulation of DNA sequences for preparing peptides or proteins having substitutions, additions, insertions or deletions, is described in detail in Sambrook et al. (1989), for example.
- the peptides and amino acid variants described herein may be readily prepared with the aid of known peptide synthesis techniques such as, for example, by solid phase synthesis and similar methods.
- a fragment or variant of an amino acid sequence is preferably a "functional fragment” or “functional variant”.
- the term "functional fragment” or “functional variant” of an amino acid sequence relates to any fragment or variant exhibiting one or more functional properties identical or similar to those of the amino acid sequence from which it is derived, i.e., it is functionally equivalent.
- one particular function is one or more immunogenic activities displayed by the amino acid sequence from which the fragment or variant is derived.
- the modifications in the amino acid sequence of the parent molecule or sequence do not significantly affect or alter the characteristics of the molecule or sequence.
- the function of the functional fragment or functional variant may be reduced but still significantly present, e.g., immunogenicity of the functional variant may be at least 50%, at least 60%, at least 70%, at least 80%, or at least 90% of the parent molecule or sequence.
- immunogenicity of the functional fragment or functional variant may be enhanced compared to the parent molecule or sequence.
- amino acid sequence "derived from” a designated amino acid sequence (peptide, protein or polypeptide) refers to the origin of the first amino acid sequence.
- amino acid sequence which is derived from a particular amino acid sequence has an amino acid sequence that is identical, essentially identical or homologous to that particular sequence or a fragment thereof.
- Amino acid sequences derived from a particular amino acid sequence may be variants of that particular sequence or a fragment thereof.
- the antigens suitable for use herein may be altered such that they vary in sequence from the naturally occurring or native sequences from which they were derived, while retahiing the desirable activity of the native sequences.
- isolated means altered or removed (e.g., purified) from the natural state or from an artificial composition, such as a composition from a production process.
- a nucleic acid or a peptide naturally present in a living animal is not “isolated”, but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated”.
- An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
- the RNA (such as raRNA) used in the present disclosure is in substantially purified form.
- a solution (preferably an aqueous solution) of RNA (such as mRNA) in substantially purified form contains a first buffer system.
- the term “genetic modification” or simply “modification” includes the transfection of cells with nucleic acid.
- the term “transfection” relates to the introduction of nucleic acids, in particular RNA, into a cell.
- the term “transfection” also includes the introduction of a nucleic acid into a cell or the uptake of a nucleic acid by such cell, wherein the cell may be present in a subject, e,g., a patient.
- a cell for transfection of a nucleic acid described herein can be present in vitro or in vivo, e.g. the cell can form part of an organ, a tissue and/or an organism of a patient.
- transfection can be transient or stable. For some applications of transfection, it is sufficient if the transfected genetic material is only transiently expressed. RNA can be transfected into cells to transiently express its coded protein. Since the nucleic acid introduced in the transfection process is usually not integrated into the nuclear genome, the foreign nucleic acid will be diluted through mitosis or degraded. Cells allowing episomal amplification of nucleic acids greatly reduce the rate of dilution. If it is desired that the transfected nucleic acid actually remains in the genome of the cell and its daughter cells, a stable transfection must occur. Such stable transfection can be achieved by using virus-based systems or transposon-based systems for transfection. Generally, nucleic acid encoding antigen is transiently transfected into cells. RNA can be transfected into cells to transiently express its coded protein.
- an analog of a peptide, polypeptide or protein is a modified form of said peptide, polypeptide or protein from which it has been derived and has at least one functional property of said peptide, polypeptide or protein.
- a pharmacological active analog of a peptide, polypeptide or protein has at least one of the pharmacological activities of the peptide, polypeptide or protein from which the analog has been derived.
- modifications include any chemical modification and comprise single or multiple substitutions, deletions and/or additions of any molecules associated with the protein, polypeptide or peptide, such as carbohydrates, lipids and/or proteins or peptides.
- analogs of proteins, polypeptides or peptides include those modified forms resulting from glycosylation, acetylation, phosphorylation, amidation, palmitoylation, myristoylation, isoprenylation, lipidation, alkylation, derivatization, introduction of protective/blocking groups, proteolytic cleavage or binding to an antibody or to another cellular ligand.
- the term “analog” also extends to all functional chemical equivalents of said proteins, polypeptides and peptides.
- Activation refers to the state of a cell (e.g., an immune effector cell such as T cell) that has been sufficiently stimulated to induce detectable cellular proliferation. Activation can also be associated with initiation of signaling pathways, induced cytokine production, and detectable effector functions.
- activated immune effector cells refers to, among other things, immune effector cells that are undergoing cell division.
- the term "priming" refers to a process wherein an immune effector cell such as a T cell has its first contact with its specific antigen and causes differentiation into effector cells such as effector T cells.
- clonal expansion refers to a process wherein a specific entity is multiplied.
- the term is preferably used in the context of an immunological response in which immune effector cells are stimulated by an antigen, proliferate, and the specific immune effector cell recognizing said antigen is amplified.
- expansion leads to differentiation of the immune effector cells.
- an “antigen” covers any substance that will elicit an immune response and/or any substance against which an immune response or an immune mechanism such as a cellular response is directed. This also includes situations wherein the antigen is processed into antigen peptides and an immune response or an immune mechanism is directed against one or more antigen peptides, in particular if presented in the context of MHC molecules.
- an “antigen” relates to any substance, preferably a peptide or protein, that reacts specifically with antibodies or T- lymphocytes (T-cells).
- the term "antigen” comprises any molecule which comprises at least one epitope, such as a T cell epitope.
- an antigen in the context of the present disclosure is a molecule which, optionally after processing, induces an immune reaction, which is preferably specific for the antigen (including cells expressing the antigen).
- an antigen is a disease-associated antigen, such as a tumor antigen, a viral antigen, or a bacterial antigen, or an epitope derived from such antigen.
- any suitable antigen may be used, which is a candidate for an immune response, wherein the immune response may be a humoral or cellular immune response or both.
- the antigen is presented by a cell, preferably by an antigen presenting cell, in the context of MHC molecules, which results in an immune response against the antigen.
- An antigen may be a product which corresponds to or is derived from a naturally occurring antigen. Such naturally occurring antigens may include or may be derived from allergens, viruses, bacteria, fungi, parasites and other infectious agents and pathogens or an antigen may also be a tumor antigen.
- an antigen may correspond to a naturally occurring product, for example, a viral protein, or a part thereof.
- disease-associated antigen is used in its broadest sense to refer to any antigen associated with a disease.
- a disease-associated antigen is a molecule which contains epitopes that will stimulate a host's immune system to make a cellular antigen-specific immune response and/or a humoral antibody response against the disease.
- Disease-associated antigens include pathogen-associated antigens, i.e., antigens which are associated with infection by microbes, typically microbial antigens (such as bacterial or viral antigens), or antigens associated with cancer, typically tumors, such as tumor antigens.
- the antigen is a tumor antigen, i.e., a part of a tumor cell, in particular those which primarily occur intracellularly or as surface antigens of tumor cells.
- the antigen is a pathogen-associated antigen, i.e., an antigen derived from a pathogen, e.g., from a virus, bacterium, unicellular organism, or parasite, for example a viral antigen such as viral ribonucleoprotein or coat protein.
- the antigen should be presented by MHC molecules which results in modulation, in particular activation of cells of the immune system, preferably CD4+ and CD8+ lymphocytes, in particular via the modulation of the activity of a T-cell receptor.
- tumor antigen refers to a constituent of cancer cells which may be derived from the cytoplasm, the cell surface or the cell nucleus. In particular, it refers to those antigens which are produced intracellularly or as surface antigens on tumor cells.
- tumor antigens include the carcinoembryonal antigen, a 1 -fetoprotein, isoferritin, and fetal sulphoglycoprotein, a2-H-ferroprotein and g-fetoprotein, as well as various virus tumor antigens.
- a tumor antigen comprises any antigen which is characteristic for tumors or cancers as well as for tumor or cancer cells with respect to type and/or expression level.
- viral antigen refers to any viral component having antigenic properties, i.e., being able to provoke an immune response in an individual.
- the viral antigen may be a viral ribonucleoprotein or an envelope protein.
- bacterial antigen refers to any bacterial component having antigenic properties, i.e. being able to provoke an immune response in an individual.
- the bacterial antigen may be derived from the cell wall or cytoplasm membrane of the bacterium.
- epitope refers to an antigenic determinant in a molecule such as an antigen, i.e., to a part in or fragment of the molecule that is recognized by the immune system, for example, that is recognized by antibodies T cells or B cells, in particular when presented in the context of MHC molecules.
- An epitope of a protein may comprise a continuous or discontinuous portion of said protein and, e.g., may be between about 5 and about 100, between about 5 and about 50, between about 8 and about 0, between about 10 and about 25 amino acids in length, for example, the epitope may be preferably 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids in length.
- the epitope in the context of the present disclosure is a T cell epitope.
- Terms such as “epitope”, “fragment of an antigen”, “immunogenic peptide” and “antigen peptide” are used interchangeably herein and, e.g., may relate to an incomplete representation of an antigen which is, e.g., capable of eliciting an immune response against the antigen or a cell expressing or comprising and presenting the antigen.
- the terms relate to an immunogenic portion of an antigen. Preferably, it is a portion of an antigen that is recognized (i.e., specifically bound) by a T cell receptor, in particular if presented in the context of MHC molecules.
- epitope refers to a part or fragment of a molecule such as an antigen that is recognized by the immune system.
- the epitope may be recognized by T cells, B cells or antibodies.
- An epitope of an antigen may include a continuous or discontinuous portion of the antigen and may be between about 5 and about 100, such as between about 5 and about 50, more preferably between about 8 and about 30, most preferably between about 8 and about 25 amino acids in length, for example, the epitope may be preferably 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids in length. In some embodiments, an epitope is between about 10 and about 25 amino acids in length.
- epitope includes T cell epitopes.
- T cell epitope refers to a part or fragment of a protein that is recognized by a T cell when presented in the context of MHC molecules.
- major histocompatibility complex and the abbreviation "MHC” includes MHC class I and MHC class II molecules and relates to a complex of genes which is present in all vertebrates. MHC proteins or molecules are important for signaling between lymphocytes and antigen presenting cells or diseased cells in immune reactions, wherein the MHC proteins or molecules bind peptide epitopes and present them for recognition by T cell receptors on T cells.
- the proteins encoded by the MHC are expressed on the surface of cells, and display both selfantigens (peptide fragments from the cell itself) and non-self-antigens (e.g., fragments of invading microorganisms) to a T cell.
- the binding peptides are typically about 8 to about 10 amino acids long although longer or shorter peptides may be effective.
- the binding peptides are typically about 10 to about 25 amino acids long and are in particular about 13 to about 18 amino acids long, whereas longer and shorter peptides may be effective.
- the peptide and protein antigen can be 2 to 100 amino acids, including for example, 5 amino acids, 10 amino acids, 15 amino acids, 20 amino acids, 25 amino acids, 30 amino acids, 35 amino acids, 40 amino acids, 45 amino acids, or 50 amino acids in length. In some embodiments, a peptide can be greater than 50 amino acids. In some embodiments, the peptide can be greater than 100 amino acids.
- the peptide or protein antigen can be any peptide or protein that can induce or increase the ability of the immune system to develop antibodies and T cell responses to the peptide or protein.
- vaccine antigen i.e., an antigen whose inoculation into a subject induces an immune response
- the vaccine antigen is recognized by an immune effector cell.
- the vaccine antigen if recognized by an immune effector cell is able to induce in the presence of appropriate co-stimulatory signals, stimulation, priming and/or expansion of the immune effector cell carrying an antigen receptor recognizing the vaccine antigen.
- the vaccine antigen is preferably presented or present on the surface of a cell, preferably an antigen presenting cell.
- an antigen is presented by a diseased cell (such as tumor cell or an infected cell).
- an antigen receptor is a TCR which binds to an epitope of an antigen presented in the context of MHC.
- binding of a TCR when expressed by T cells and/or present on T cells to an antigen presented by cells such as antigen presenting cells results in stimulation, priming and/or expansion of said T cells.
- binding of a TCR when expressed by T cells and/or present on T cells to an antigen presented on diseased cells results in cytolysis and/or apoptosis of the diseased cells, wherein said T cells preferably release cytotoxic factors, e.g., perforins and granzymes.
- an antigen receptor is an antibody or B cell receptor which binds to an epitope in an antigen. In some embodiments, an antibody or B cell receptor binds to native epitopes of an antigen.
- the term "expressed on the cell surface” or "associated with the cell surface” means that a molecule such as an antigen is associated with and located at the plasma membrane of a cell, wherein at least a part of the molecule faces the extracellular space of said cell and is accessible from the outside of said cell, e.g., by antibodies located outside the cell.
- a part may be, e.g., at least 4, at least 8, at least 12, or at least 20 amino acids.
- the association may be direct or indirect.
- the association may be by one or more transmembrane domains, one or more lipid anchors, or by the interaction with any other protein, lipid, saccharide, or other structure that can be found on the outer leaflet of the plasma membrane of a cell.
- a molecule associated with the surface of a cell may be a transmembrane protein having an extracellular portion or may be a protein associated with the surface of a cell by interacting with another protein that is a transmembrane protein.
- Cell surface or “surface of a cell” is used in accordance with its normal meaning in the art, and thus includes the outside of the cell which is accessible to binding by proteins and other molecules.
- An antigen is expressed on the surface of cells if it is located at the surface of said cells and is accessible to binding by, e.g., antigen-specific antibodies added to the cells.
- an antigen expressed on the surface of cells is an integral membrane protein having an extracellular portion which may be recognized by a CAR.
- extracellular portion or “exodomain” in the context of the present disclosure refers to a part of a molecule such as a protein that is facing the extracellular space of a cell and preferably is accessible from the outside of said cell, e.g., by binding molecules such as antibodies located outside the cell.
- the term refers to one or more extracellular loops or domains or a fragment thereof.
- T cell and "T lymphocyte” are used interchangeably herein and include T helper cells (CD4+ T cells) and cytotoxic T cells (CTLs, CD8+ T cells) which comprise cytolytic T cells.
- T helper cells CD4+ T cells
- CTLs cytotoxic T cells
- antigen-specific T cell or similar terms relate to a T cell which recognizes the antigen to which the T cell is targeted, in particular when presented on the surface of antigen presenting cells or diseased cells such as cancer cells in the context ofMHC molecules and preferably exerts effector functions ofT cells.
- T cells are considered to be specific for antigen if the cells kill target cells expressing an antigen.
- T cell specificity may be evaluated using any of a variety of standard techniques, for example, within a chromium release assay or proliferation assay. Alternatively, synthesis of lymphokines (such as interferon-y) can be measured.
- the RNA in particular mRNA
- target shall mean an agent such as a cell or tissue which is a target for an immune response such as a cellular immune response.
- Targets include cells that present an antigen or an antigen epitope, i.e., a peptide fragment derived from an antigen.
- the target cell is a cell expressing an antigen and preferably presenting said antigen with class I MHC.
- Antigen processing refers to the degradation of an antigen into processing products which are fragments of said antigen (e.g., the degradation of a protein into peptides) and the association of one or more of these fragments (e.g., via binding) with MHC molecules for presentation by cells, preferably antigen-presenting cells to specific T-cells.
- Antigen-presenting cells can be distinguished in professional antigen presenting cells and non-professional antigen presenting cells.
- antigen-responsive CTL is meant a CD8 + T-cell that is responsive to an antigen or a peptide derived from said antigen, which is presented with class I MHC on the surface of antigen presenting cells.
- CTL responsiveness may include sustained calcium flux, cell division, production of cytokines such as IFN-y and TNF-a, up-regulation of activation markers such as CD44 and CD69, and specific cytolytic killing of tumor antigen expressing target cells.
- CTL responsiveness may also be determined using an artificial reporter that accurately indicates CTL responsiveness.
- immune response and “immune reaction” are used herein interchangeably in their conventional meaning and refer to an integrated bodily response to an antigen and may refer to a cellular immune response, a humoral immune response, or both.
- the term “immune response to” or “immune response against” with respect to an agent such as an antigen, cell or tissue, relates to an immune response such as a cellular response directed against the agent.
- An immune response may comprise one or more reactions selected from the group consisting of developing antibodies against one or more antigens and expansion of antigen-specific T-lymphocytes, such as CD4 + and CD8 T-lymphocytes, e.g., CD8 + T-lymphocytes, which may be detected in various proliferation or cytokine production tests in vitro.
- antigen-specific T-lymphocytes such as CD4 + and CD8 T-lymphocytes, e.g., CD8 + T-lymphocytes, which may be detected in various proliferation or cytokine production tests in vitro.
- the terms "inducing an immune response” and “eliciting an immune response” and similar terms in the context of the present disclosure refer to the induction of an immune response, such as the induction of a cellular immune response, a humoral immune response, or both.
- the immune response may be protective/preventive/prophylactic and/or therapeutic.
- the immune response may be directed against any immunogen or antigen or antigen peptide, preferably against a tumor-associated antigen or a pathogen-associated antigen ⁇ e.g., an antigen of a virus (such as influenza virus (A, B, or C), CMV or RSV)).
- inducing in this context may mean that there was no immune response against a particular antigen or pathogen before induction, but it may also mean that there was a certain level of immune response against a particular antigen or pathogen before induction and after induction said immune response is enhanced.
- inducing the immune response in this context also includes “enhancing the immune response”.
- after inducing an immune response in an individual said individual is protected from developing a disease such as an infectious disease or a cancerous disease or the disease condition is ameliorated by inducing an immune response.
- cellular immune response means to include a cellular response directed to cells characterized by expression of an antigen and/or presentation of an antigen with class I or class II MHC.
- the cellular response relates to cells called T cells or T lymphocytes which act as either "helpers” or “killers".
- the helper T cells also termed CD4 + T cells
- the killer cells also termed cytotoxic T cells, cytolytic T cells, CD8 + T cells or CTLs kill cells such as diseased cells.
- the term "humoral immune response” refers to a process in living organisms wherein antibodies are produced in response to agents and organisms, which they ultimately neutralize and/or eliminate.
- the specificity of the antibody response is mediated by T and/or B cells through membrane-associated receptors that bind antigen of a single specificity.
- B lymphocytes divide, which produces memory B cells as well as antibody secreting plasma cell clones, each producing antibodies that recognize the identical antigenic epitope as was recognized by its antigen receptor.
- Memory B lymphocytes remain dormant until they are subsequently activated by their specific antigen. These lymphocytes provide the cellular basis of memory and the resulting escalation in antibody response when re-exposed to a specific antigen.
- antibody refers to an immunoglobulin molecule, which is able to specifically bind to an epitope on an antigen.
- antibody refers to a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
- antibody includes monoclonal antibodies, recombinant antibodies, human antibodies, humanized antibodies, chimeric antibodies and combinations of any of the foregoing.
- Each heavy chain is comprised of a heavy chain variable region (VH) and a heavy chain constant region (CH).
- VL light chain variable region
- CL light chain constant region
- variable regions and constant regions are also referred to herein as variable domains and constant domains, respectively.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
- CDRs complementarity determining regions
- FRs framework regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1 , CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the CDRs of a VH are termed HCDR1, HCDR2 and HCDR3, the CDRs of a VL are termed LCDR1 , LCDR2 and LCDR3.
- variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of an antibody comprise the heavy chain constant region (CH) and the light chain constant region (CL), wherein CH can be further subdivided into constant domain CHI, a hinge region, and constant domains CH2 and CH3 (arranged from amino-terminus to carboxy-terminus in the following order: CHI, CH2, CH3).
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g ., effector cells) and the first component (Clq) of the classical complement system.
- Antibodies can be intact immunoglobulins derived from natural sources or from recombinant sources and can be immunoactive portions of intact immunoglobulins. Antibodies are typically tetramers of immunoglobulin molecules. Antibodies may exist in a variety of forms including, for example, polyclonal antibodies, monoclonal antibodies, Fv, Fab and F(ab)2, as well as single chain antibodies and humanized antibodies.
- immunoglobulin relates to proteins of the immunoglobulin superfamily, such as to antigen receptors such as antibodies or the B cell receptor (BCR).
- the immunoglobulins are characterized by a structural domain, the immunoglobulin domain, having a characteristic immunoglobulin (Ig) fold.
- the term encompasses membrane bound immunoglobulins as well as soluble immunoglobulins.
- Membrane bound immunoglobulins are also termed surface immunoglobulins or membrane immunoglobulins, which are generally part of the BCR.
- Soluble immunoglobulins are generally termed antibodies.
- Immunoglobulins generally comprise several chains, typically two identical heavy chains and two identical light chains which are linked via disulfide bonds.
- immunoglobulin domains such as the VL (variable light chain) domain, CL (constant light chain) domain, V H (variable heavy chain) domain, and the C H (constant heavy chain) domains CHI , CH2, CH3, and CH4.
- immunoglobulin heavy chains There are five types of mammalian immunoglobulin heavy chains, i.e., a, d, e, g, and m which account for the different classes of antibodies, i.e., IgA, IgD, IgE, IgG, and IgM.
- the heavy chains of membrane or surface immunoglobulins comprise a transmembrane domain and a short cytoplasmic domain at their carboxy-terminus.
- the immunoglobulin chains comprise a variable region and a constant region. The constant region is essentially conserved within the different isotypes of the immunoglobulins, wherein the variable part is highly divers and accounts for antigen recognition.
- vaccination and “immunization” describe the process of treating an individual for therapeutic or prophylactic reasons and relate to the procedure of administering one or more immunogen(s) or antigen(s) or derivatives thereof, in particular in the form of RNA (especially mRNA) coding therefor, as described herein to an individual and stimulating an immune response against said one or more immunogen(s) or antigen(s) or cells characterized by presentation of said one or more immunogen(s) or antigen(s).
- RNA especially mRNA
- cell characterized by presentation of an antigen or “cell presenting an antigen” or “MHC molecules which present an antigen on the surface of an antigen presenting cell” or similar expressions is meant a cell such as a diseased cell, in particular a tumor cell or an infected cell, or an antigen presenting cell presenting the antigen or an antigen peptide, either directly or following processing, in the context of MHC molecules, preferably MHC class I and/or MHC class P molecules, most preferably MHC class I molecules.
- transcription relates to a process, wherein the genetic code in a DNA sequence is transcribed into RNA (especially mRNA). Subsequently, the RNA (especially mRNA) may be translated into peptide, polypeptide or protein.
- RNA With respect to RNA, the term "expression” or “translation” relates to the process in the ribosomes of a cell by which a strand of mRNA directs the assembly of a sequence of amino acids to make a peptide or protein.
- a medical preparation, in particular kit, described herein may comprise instructional material or instructions.
- "instructional material” or “instructions” includes a publication, a recording, a diagram, or any other medium of expression which can be used to communicate the usefulness of the compositions and methods of the present disclosure.
- the instructional material of the kit of the present disclosure may, for example, be affixed to a container which contains the compositions of the present disclosure or be shipped together with a container which contains the compositions. Alternatively, the instructional material may be shipped separately from the container with the intention that the instructional material and the compositions be used cooperatively by the recipient.
- Prodrugs of a particular compound described herein are those compounds that upon administration to an individual undergo chemical conversion under physiological conditions to provide the particular compound. Additionally, prodrugs can be converted to the particular compound by chemical or biochemical methods in an ex vivo environment. For example, prodrugs can be slowly converted to the particular compound when, for example, placed in a transdermal patch reservoir with a suitable enzyme or chemical reagent. Exemplary prodrugs are esters (using an alcohol or a carboxy group contained in the particular compound) or amides (using an amino or a carboxy group contained in the particular compound) which are hydrolyzable in vivo. Specifically, any amino group which is contained in the particular compound and which bears at least one hydrogen atom can be converted into a prodrug form. Typical N-prodrug forms include carbamates, Mannich bases, enamines, and enaminones.
- a structural formula of a compound may represent a certain isomer of said compound. It is to be understood, however, that the present disclosure includes all isomers such as geometrical isomers, optical isomers based on an asymmetrical carbon, stereoisomers, tautomers and the like which occur structurally and isomer mixtures and is not limited to the description of the formula. Furthermore, in the present specification, a structural formula of a compound may represent a specific salt and/or solvate of said compound. It is to be understood, however, that the present disclosure includes all salts ( e.g ., pharmaceutically acceptable salts) and solvates ( e.g ., hydrates) and is not limited to the description of the specific salt and/or solvate.
- “Isomers” are compounds having the same molecular formula but differ in structure (“structural isomers”) or in the geometrical (spatial) positioning of the functional groups and/or atoms (“stereoisomers”).
- “Enantiomers” are a pair of stereoisomers which are non-superimposable mirror- images of each other.
- a “racemic mixture” or “racemate” contains a pair of enantiomers in equal amounts and is denoted by the prefix ( ⁇ ).
- “Diastereomers” are stereoisomers which are non- superimposable and which are not mirror-images of each other.
- Tautomers are structural isomers of the same chemical substance that spontaneously and reversibly interconvert into each other, even when pure, due to the migration of individual atoms or groups of atoms; i.e., the tautomers are in a dynamic chemical equilibrium with each other.
- An example of tautomers are the isomers of the keto-enol- tautomerism.
- Conformers are stereoisomers that can be interconverted just by rotations about formally single bonds, and include - in particular - those leading to different 3-dimentional forms of (hetero)cyclic rings, such as chair, half-chair, boat, and twist-boat forms of cyclohexane.
- solvate refers to an addition complex of a dissolved material in a solvent (such as an organic solvent (e.g., an aliphatic alcohol (such as methanol, ethanol, n-propanol, isopropanol), acetone, acetonitrile, ether, and the like), water or a mixture of two or more of these liquids), wherein the addition complex exists in the form of a crystal or mixed crystal.
- a solvent such as an organic solvent (e.g., an aliphatic alcohol (such as methanol, ethanol, n-propanol, isopropanol), acetone, acetonitrile, ether, and the like), water or a mixture of two or more of these liquids)
- a solvent such as an organic solvent (e.g., an aliphatic alcohol (such as methanol, ethanol, n-propanol, isopropanol), acetone, acetonitrile, ether, and the like
- isotopically labeled compounds one or more atoms are replaced by a corresponding atom having the same number of protons but differing in the number of neutrons.
- a hydrogen atom may be replaced by a deuterium or tritium atom.
- Exemplary isotopes which can be used in the present disclosure include deuterium, tritium, H C, 13 C, 14 C, 15 N, !8 F, 32 P, 32 S, 35 S, 36 C1, and 125 I.
- average diameter refers to the mean hydrodynamic diameter of particles as measured by dynamic light scattering (DLS) with data analysis using the so-called cumulant algorithm, which provides as results the so-called Z average with the dimension of a length, and the polydispersity index (PDI), which is dimensionless (Koppel, D., J. Chem. Phys. 57, 1972, pp 4814-4820, ISO 13321).
- PDI polydispersity index
- the "polydispersity index” is calculated based on dynamic light scattering measurements by the so-called cumulant analysis as mentioned in the definition of the "average diameter". Under certain prerequisites, it can be taken as a measure of the size distribution of an ensemble of nanoparticles.
- the "radius of gyration" (abbreviated herein as R g ) of a particle about an axis of rotation is the radial distance of a point from the axis of rotation at which, if the whole mass of the particle is assumed to be concentrated, its moment of inertia about the given axis would be the same as with its actual distribution of mass.
- R g is the root mean square distance of the particle's components from either its center of mass or a given axis.
- R g is the square-root of the mass average of Si 2 over all mass elements and can be calculated as follows:
- the radius of gyration can be determined or calculated experimentally, e.g., by using light scattering.
- the structure function S is defined as follows: wherein N is the number of components (Guinier's law).
- the "DIO value”, in particular regarding a quantitative size distribution of particles, is the diameter at which 10% of the particles have a diameter less than this value.
- the D10 value is a means to describe the proportion of the smallest particles within a population of particles (such as within a particle peak obtained from a field-flow fractionation).
- D50 value in particular regarding a quantitative size distribution of particles, is the diameter at which 50% of the particles have a diameter less than this value.
- the D50 value is a means to describe the mean particle size of a population of particles (such as within a particle peak obtained from a field-flow fractionation).
- the “D90 value”, in particular regarding a quantitative size distribution of particles, is the diameter at which 90% of the particles have a diameter less than this value.
- the "D95”, “D99”, and “D100” values have corresponding meanings.
- the D90, D95, D99, and D100 values are means to describe the proportion of the larger particles within a population of particles (such as within a particle peak obtained from a field-flow fractionation).
- the "hydrodynamic radius” (which is sometimes called “Stokes radius” or “Stokes-Einstein radius”) of a particle is the radius of a hypothetical hard sphere that diffuses at the same rate as said particle.
- the hydrodynamic radius is related to the mobility of the particle, taking into account not only size but also solvent effects. For example, a smaller charged particle with stronger hydration may have a greater hydrodynamic radius than a larger charged particle with weaker hydration. This is because the smaller particle drags a greater number of water molecules with it as it moves through the solution.
- the hydrodynamic radius may be defined by the Stokes-Einstein equation: wherein fe is the Boltzmann constant; T is the temperature; h is the viscosity of the solvent; and D is the diffusion coefficient.
- the diffusion coefficient can be determined experimentally, e.g., by using dynamic light scattering (DLS).
- one procedure to determine the hydrodynamic radius of a particle or a population of particles is to measure the DLS signal of said particle or population of particles (such as DLS signal of particles such as LNPs contained in a fonnulation or composition as disclosed herein or the DLS signal of a particle peak obtained from subjecting such a formulation or composition to field-flow fractionation).
- aggregate as used herein relates to a cluster of particles, wherein the particles are identical or very similar and adhere to each other in a non-covalently manner (e.g., via ionic interactions, H bridge interactions, dipole interactions, and/or van der Waals interactions).
- light scattering refers to the physical process where light is forced to deviate from a straight trajectory by one or more paths due to localized non-uniformities in the medium through which the light passes.
- UV means ultraviolet and designates a band of the electromagnetic spectrum with a wavelength from 10 nm to 400 nm, i.e., shorter than that of visible light but longer than X-rays.
- multi-angle light scattering or “MALS” as used herein relates to a technique for measuring the light scattered by a sample into a plurality of angles.
- Multi-angle means in this respect that scattered light can be detected at different discrete angles as measured, for example, by a single detector moved over a range including the specific angles selected or an array of detectors fixed at specific angular locations.
- the light source used in MALS is a laser source (MALLS: multi-angle laser light scattering).
- the Zimm plot is a graphical presentation using the following equation: wherein c is the mass concentration of the particles in the solvent (g/mL); A2 is the second virial coefficient (mol-mL/g 2 ); R(q) is a form factor relating to the dependence of scattered light intensity on angle; Re is the excess Rayleigh ratio (cm 4 ); and K* is an optical constant that is equal to 4p 2 h 0 (d «/dc) 2 Zo '4 /V A 4 , where h 0 is the refractive index of the solvent at the incident radiation (vacuum) wavelength, lo is the incident radiation (vacuum) wavelength (nm), N A is Avogadro’s number (mol 4 ), and dn/dc is the differential refractive index increment (mL/g) (cfi, e.g., Buchholz et al.
- the Berry plot is calculated the following term or the reciprocal thereof: wherein c, Re and K* are as defined above.
- the Debye plot is calculated the following term or the reciprocal thereof: wherein c, Re and K* are as defined above.
- DLS dynamic light scattering
- a monochromatic light source usually a laser
- the scattered light then goes through a second polarizer where it is detected and the resulting image is projected onto a screen.
- the particles in the solution are being hit with the light and diffract the light in all directions.
- the diffracted light from the particles can either interfere constructively (light regions) or destructively (dark regions). This process is repeated at short time intervals and the resulting set of speckle patterns are analyzed by an autocorrelator that compares the intensity of light at each spot over time.
- SLS static light scattering
- MALS multi-angle light scattering
- MALLS multi - angle laser light scattering
- nucleic acid comprises deoxyribonucleic acid (DNA), ribonucleic acid (RNA), combinations thereof, and modified forms thereof.
- the term comprises genomic DNA, cDNA, mRNA, recombinantly produced and chemically synthesized molecules.
- a nucleic acid may be present as a single-stranded or double-stranded and linear or covalently circularly closed molecule.
- a nucleic acid can be isolated.
- isolated nucleic acid means, according to the present disclosure, that the nucleic acid (i) was amplified in vitro, for example via polymerase chain reaction (PCR) for DNA or in vitro transcription (using, e.g., an RNA polymerase) for RNA, (ii) was produced recombinantly by cloning, (iii) was purified, for example, by cleavage and separation by gel electrophoresis, or (iv) was synthesized, for example, by chemical synthesis.
- PCR polymerase chain reaction
- RNA polymerase RNA polymerase
- purified for example, by cleavage and separation by gel electrophoresis
- iv was synthesized, for example, by chemical synthesis.
- N nucleoside
- nucleoside is a nucleobase linked to a sugar (e.g ., ribose or deoxyribose)
- a nucleotide is composed of a nucleoside and one or more phosphate groups.
- nucleosides include cytidine, uridine, pseudouridine, adenosine, and guanosine.
- the five standard nucleosides which usually make up naturally occurring nucleic acids are uridine, adenosine, thymidine, cytidine and guanosine.
- the five nucleosides are commonly abbreviated to their one letter codes U, A, T, C and G, respectively.
- thymidine is more commonly written as “dT” ("d” represents “deoxy") as it contains a 2'-deoxyribofuranose moiety rather than the ribofuranose ring found in uridine. This is because thymidine is found in deoxyribonucleic acid (DNA) and not ribonucleic acid (RNA).
- uridine is found in RNA and not DNA.
- the remaining three nucleosides may be found in both RNA and DNA. In RNA, they would be represented as A, C and G, whereas in DNA they would be represented as cLA, dC and dG.
- a modified purine (A or G) or pyrimidine (C, T, or U) base moiety is preferably modified by one or more alkyl groups, more preferably one or more C M alkyl groups, even more preferably one or more methyl groups.
- modified purine or pyrimidine base moieties include ⁇ -alkyl- guanine, N b -alkyl-adenine, 5-alkyl-cytosine, 5-alkyl-uracil, and N(l)-alkyl-uracil, such as N 7 -C 1-4 alkyl- guanine, N 6 -C M alkyl-adenine, 5-C M alkyl-cytosine, 5-C 1-4 alkyl-uracil, and N(1)-C M alkyl-uracil, preferably N 7 -methyl-guanine, N 6 -methyl-adenine, 5-methyl-cytosine, 5-methyl-uracil, and N(l)- methyl-uracil.
- DNA relates to a nucleic acid molecule which includes deoxyribonucleotide residues.
- the DNA contains all or a majority of deoxyribonucleotide residues.
- deoxyribonucleotide refers to a nucleotide which lacks a hydroxyl group at the 2'-position of a b-D-ribofuranosyl group.
- DNA encompasses without limitation, double stranded DNA, single stranded DNA, isolated DNA such as partially purified DNA, essentially pure DNA, synthetic DNA, recombinantly produced DNA, as well as modified DNA that differs from naturally occurring DNA by the addition, deletion, substitution and/or alteration of one or more nucleotides. Such alterations may refer to addition of non-nucleotide material to internal DNA nucleotides or to the end(s) of DNA. It is also contemplated herein that nucleotides in DNA may be non-standard nucleotides, such as chemically synthesized nucleotides or ribonucleotides. For the present disclosure, these altered DNAs are considered analogs of naturally-occurring DNA.
- a molecule contains "a majority of deoxyribonucleotide residues" if the content of deoxyribonucleotide residues in the molecule is more than 50% (such as at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%), based on the total number of nucleotide residues in the molecule.
- the total number of nucleotide residues in a molecule is the sum of all nucleotide residues (irrespective of whether the nucleotide residues are standard (i.e., naturally occurring) nucleotide residues or analogs thereof).
- DNA may be recombinant DNA and may be obtained by cloning of a nucleic acid, in particular cDNA.
- the cDNA may be obtained by reverse transcription of RNA.
- RNA means a nucleic acid molecule which includes ribonucleotide residues. In preferred embodiments, the RNA contains all or a majority of ribonucleotide residues.
- ribonucleotide refers to a nucleotide with a hydroxyl group at the 2'-position of a b-D-ribofuranosyl group.
- RNA encompasses without limitation, double stranded RNA, single stranded RNA, isolated RNA such as partially purified RNA, essentially pure RNA, synthetic RNA, recombinantly produced RNA, as well as modified RNA that differs from naturally occurring RNA by the addition, deletion, substitution and/or alteration of one or more nucleotides. Such alterations may refer to addition of non-nucleotide material to internal RNA nucleotides or to the end(s) of RNA. It is also contemplated herein that nucleotides in RNA may be non-standard nucleotides, such as chemically synthesized nucleotides or deoxynucleotides .
- altered/modified nucleotides can be referred to as analogs of naturally occurring nucleotides, and the corresponding RNAs containing such altered/ modified nucleotides (i.e., altered/ modified RNAs) can be referred to as analogs of naturally occurring RNAs.
- a molecule contains "a majority of ribonucleotide residues" if the content of ribonucleotide residues in the molecule is more than 50% (such as at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%), based on the total number of nucleotide residues in the molecule.
- the total number of nucleotide residues in a molecule is the sum of all nucleotide residues (irrespective of whether the nucleotide residues are standard (i.e., naturally occurring) nucleotide residues or analogs thereof).
- RNA includes mRNA, tRNA, ribosomal RNA (rRNA), small nuclear RNA (snRNA), self-amplifying RNA (saRNA), single-stranded RNA (ssRNA), dsRNA, inhibitory RNA (such as antisense ssRNA, small interfering RNA (siRNA), or microRNA (miRNA)), activating RNA (such as small activating RNA) and immunostimulatory RNA (isRNA).
- RNA refers to mRNA.
- the RNA comprises an open reading frame (ORF) encoding a peptide, polypeptide or protein.
- IVT in vitro transcription
- RNA polymerase preferably T7, T3 or SP6 polymerase
- the RNA is mRNA.
- mRNA means "messenger-RNA” and includes a “transcript” which may be generated by using a DNA template.
- mRNA encodes a peptide, polypeptide or protein.
- an mRNA comprises a 5'-UTR, a peptide/protein coding region, and a 3'-UTR.
- mRNA is preferably generated by in vitro transcription (IVT) from a DNA template.
- IVTT in vitro transcription
- the in vitro transcription methodology is known to the skilled person, and a variety of in vitro transcription kits is commercially available.
- mRNA is single-stranded but may contain self-complementary sequences that allow parts of the mRNA to fold and pair with itself to form double helices.
- dsRNA means double-stranded RNA and is RNA with two partially or completely complementary strands.
- the mRNA relates to an RNA transcript which encodes a peptide, polypeptide or protein.
- the RNA which preferably encodes a peptide, polypeptide or protein has a length of at least 45 nucleotides (such as at least 60, at least 90, at least 100, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1 ,000, at least 1 ,500, at least 2,000, at least 2,500, at least 3,000, at least 3,500, at least 4,000, at least 4,500, at least 5,000, at least 6,000, at least 7,000, at least 8,000, at least 9,000 nucleotides), preferably up to 15,000, such as up to 14,000, up to 13,000, up to 12,000 nucleotides, up to 11,000 nucleotides or up to 10,000 nucleotides.
- nucleotides such as at least 60, at least 90, at least 100, at least 200, at least 300, at least 400, at least 500, at least 600, at least 700, at least 800, at least
- the RNA (such as mRNA) generally contains a 5' untranslated region (5'-UTR), a peptide/polypeptide/protein coding region and a 3' untranslated region (3'-UTR).
- the RNA (such as mRNA) is produced by in vitro transcription or chemical synthesis.
- the RNA (such as mRNA) is produced by in vitro transcription using a DNA template.
- the in vitro transcription methodology is known to the skilled person; cf., e.g., Molecular Cloning: A Laboratory Manual, 2 nd Edition, J. Sambrook et al. eds., Cold Spring Harbor Laboratory Press, Cold Spring Harbor 1989.
- in vitro transcription kits are commercially available, e.g,, from Thermo Fisher Scientific (such as TranscriptAidTM T7 kit, MEGAscript® T7 kit, MAXIscript®), New England BioLabs Inc. (such as HiScribeTM T7 kit, HiScribeTM ⁇ '7 ARCA mRNA kit), Promega (such as RiboMAXTM, HeLaScribe®, Riboprobe® systems), Jena Bioscience (such as SP6 or T7 transcription kits), and Epicentre (such as AmpliScribeTM).
- Thermo Fisher Scientific such as TranscriptAidTM T7 kit, MEGAscript® T7 kit, MAXIscript®), New England BioLabs Inc.
- HiScribeTM T7 kit HiScribeTM ⁇ '7 ARCA mRNA kit
- Promega such as RiboMAXTM, HeLaScribe®, Riboprobe® systems
- Jena Bioscience such as SP6 or T7 transcription kits
- Epicentre
- modified RNA such as mRNA
- correspondingly modified nucleotides such as modified naturally occurring nucleotides, non- naturally occurring nucleotides and/or modified non-naturally occurring nucleotides, can be incorporated during synthesis (preferably in vitro transcription), or modifications can be effected in and/or added to the mRNA after transcription.
- RNA such as mRNA
- IVT-RNA in vitro transcribed RNA
- the promoter for controlling transcription can be any promoter for any RNA polymerase.
- RNA polymerases are the T7, T3, and SP6 RNA polymerases.
- the in vitro transcription is controlled by a T7 or SP6 promoter.
- a DNA template for in vitro transcription may be obtained by cloning of a nucleic acid, in particular cDNA, and introducing it into an appropriate vector for in vitro transcription.
- the cDNA may be obtained by reverse transcription of RNA.
- the RNA (such as mRNA) is “replicon RNA” (such as “replicon mRNA") or simply a “replicon”, in particular "self-replicating RNA” (such as “self-replicating mRNA”) or “self-amplifying RNA” (or “self-amplifying mRNA”).
- the replicon or self-replicating RNA (such as self-replicating mRNA) is derived from or comprises elements derived from an ssRNA virus, in particular a positive-stranded ssRNA virus such as an alphavirus. Alphaviruses are typical representatives of positive-stranded RNA viruses.
- Alphaviruses replicate in the cytoplasm of infected cells (for review of the alpha viral life cycle see Jose et al., Future Microbiol., 2009, vol. 4, pp. 837-856).
- the total genome length of many alphaviruses typically ranges between 11,000 and 12,000 nucleotides, and the genomic RNA typically has a 5 ’-cap, and a 3’ poly(A) tail.
- the genome of alphaviruses encodes non-structural proteins (involved in transcription, modification and replication of viral RNA and in protein modification) and structural proteins (forming the virus particle). There are typically two open reading frames (ORFs) in the genome.
- the four non-structural proteins are typically encoded together by a first ORF beginning near the 5' terminus of the genome, while alphavirus structural proteins are encoded together by a second ORF which is found downstream of the first ORF and extends near the 3’ terminus of the genome.
- first ORF is larger than the second ORF, the ratio being roughly 2:1.
- RNA RNA molecule that resembles eukaryotic messenger RNA
- mRNA messenger RNA
- (+) stranded genomic RNA directly acts like a messenger RNA for the translation of the open reading frame encoding the non-structural poly-protein (nsP1234).
- Alphavirus-derived vectors have been proposed for delivery of foreign genetic information into target cells or target organisms.
- Alphavirus-based trans-replication systems rely on alphavirus nucleotide sequence elements on two separate nucleic acid molecules: one nucleic acid molecule encodes a viral replicase, and the other nucleic acid molecule is capable of being replicated by said replicase in trans (hence the designation trans-replication system).
- Trans-replication requires the presence of both these nucleic acid molecules in a given host cell.
- the nucleic acid molecule capable of being replicated by the replicase in trans must comprise certain alphaviral sequence elements to allow recognition and RNA synthesis by the alphaviral replicase.
- the RNA (such as mRNA) described herein (e.g., contained in the compositions of the present disclosure and/or used in the methods of the present disclosure) contains one or more modifications, e.g., in order to increase its stability and/or increase translation efficiency and/or decrease immunogenicity and/or decrease cytotoxicity.
- the RNA in order to increase expression of the RNA (such as mRNA), it may be modified within the coding region, i.e., the sequence encoding the expressed peptide or protein, preferably without altering the sequence of the expressed peptide or protein.
- modifications are described, for example, in WO 2007/036366 and PCT/EP2019/056502, and include the following: a 5'-cap structure; an extension or truncation of the naturally occurring poly(A) tail; an alteration of the 5'- and/or 3'-untranslated regions (UTR) such as introduction of a UTR which is not related to the coding region of said RNA; the replacement of one or more naturally occurring nucleotides with synthetic nucleotides; and codon optimization (e.g., to alter, preferably increase, the GC content of the RNA).
- the term "modification" in the context of modified mRNA according to the present disclosure preferably relates to any modification of an mRNA which is not naturally present in said RNA (such as mRNA).
- the RNA (such as mRNA) described herein comprises a 5'-cap structure. In one embodiment, the mRNA does not have uncapped 5 '-triphosphates. In one embodiment, the RNA (such as mRNA) described herein may comprise a conventional 5'-cap and/or a 5'-cap analog.
- inventional 5'-cap refers to a cap structure found on the 5 '-end of an mRNA molecule and generally consists of a guanosine 5 '-triphosphate (Gppp) which is connected via its triphosphate moiety to the 5'- end of the next nucleotide of the mRNA (i.e., the guanosine is connected via a 5' to 5' triphosphate linkage to the rest of the mRNA).
- Gppp guanosine 5 '-triphosphate
- the guanosine may be methylated at position N 7 (resulting in the cap structure m 7 Gppp).
- 5'-cap analog refers to a 5'-cap which is based on a conventional 5'-cap but which has been modified at either the 2'- or 3'-position of the m 7 guanosine structure in order to avoid an integration of the 5'-cap analog in the reverse orientation (such 5 '-cap analogs are also called antireverse cap analogs (ARCAs)).
- ARCAs antireverse cap analogs
- Particularly preferred 5'-cap analogs are those having one or more substitutions at the bridging and non-bridging oxygen in the phosphate bridge, such as phosphorothioate modified 5'-cap analogs at the b-phosphate (such as ni 2 7,20 G(5')ppSp(5')G (referred to as beta-S-ARCA or b-S-ARCA)), as described in PCT/EP2019/056502.
- phosphorothioate modified 5'-cap analogs at the b-phosphate such as ni 2 7,20 G(5')ppSp(5')G (referred to as beta-S-ARCA or b-S-ARCA)
- Providing an RNfA (such as mRNA) with a 5'- cap structure as described herein may be achieved by in vitro transcription of a DNA template in presence of a corresponding 5 '-cap compound, wherein said 5'-cap structure is co-transcriptionally incorporated into the generated RNA (such as mRNA) strand, or the RNA (such as mRNA) may be generated, for example, by in vitro transcription, and the 5'-cap structure may be attached to the post-transcriptionally using capping enzymes, for example, capping enzymes of vaccinia virus.
- capping enzymes for example, capping enzymes of vaccinia virus.
- the RNA (such as mRNA) comprises a 5'-cap structure selected from the group consisting of m 2 7 ’ 2' °G(5’)ppSp(5')G (in particular its D1 diastereomer), m2 7 ’ 3 °G(5 ')ppp(5 ')G, and m 2 7 . 3 °Gppp(mi 2'" °)ApG.
- RNA encoding a peptide, polypeptide or protein comprising an antigen or epitope comprises m 2 7 - 20 G(5’)ppSp(5')G (in particular its D1 diastereomer) as 5'-cap structure.
- the RNA (such as mRNA) comprises a capO, capl, or cap2, preferably capl or cap2.
- capO means the structure "m 7 GpppN", wherein N is any nucleoside bearing an OH moiety at position 2'.
- capl means the structure "m 7 GpppNm”, wherein Nm is any nucleoside bearing an OCH3 moiety at position 2'.
- cap2 means the structure "m 7 GpppNmNm", wherein each Nm is independently any nucleoside bearing an OCH3 moiety at position 2'.
- the 5 '-cap analog beta-S-ARCA (b-S-ARCA) has the following structure:
- the "D1 diastereomer of beta-S-ARCA" or “beta-S-ARCA(D 1 )” is the diastereomer of beta-S-ARCA which elutes first on an HPLC column compared to the D2 diastereomer of beta-S-ARCA (beta-S- ARCA(D2)) and thus exhibits a shorter retention time.
- the HPLC preferably is an analytical HPLC.
- a Supelcosil LC-18-T RP column preferably of the format: 5 pm, 4.6 x 250 mm is used for separation, whereby a flow rate of 1.3 ml/min can be applied.
- VWD UV-detection
- FLD fluorescence detection
- the 5'-cap analog m2 7,3 ' °Gppp(mi 2 ⁇ 0 )ApG also referred to as m2 730 G(5')ppp(5')nr 0 ApG
- m2 730 G(5')ppp(5')nr 0 ApG which is a building block of a cap! has the following structure:
- An exemplary capO mRNA comprising b-S-ARCA and mRNA has the following structure:
- An exemplary capO mRNA comprising ni 2 7,vo G(5')ppp(5')G and mRNA has the following structure:
- An exemplary capl mRNA comprising m2 7,3' °Gppp(mi 2' °)ApG and mRNA has the following structure:
- poly-A tail or "poly-A sequence” refers to an uninterrupted or interrupted sequence of adenylate residues which is typically located at the 3 '-end of an RNA (such as mRNA) molecule.
- Poly-A tails or poly-A sequences are known to those of skill in the art and may follow the 3’- UTR in the RNAs (such as mRNAs) described herein.
- An uninterrupted poly-A tail is characterized by consecutive adenylate residues. In nature, an uninterrupted poly-A tail is typical.
- RNAs such as mRNAs
- RNAs can have a poly-A tail attached to the free 3 '-end of the RNA by a template- independent RNA polymerase after transcription or a poly-A tail encoded by DNA and transcribed by a template-dependent RNA polymerase.
- poly-A tail of about 120 A nucleotides has a beneficial influence on the levels of mRNA in transfected eukaryotic cells, as well as on the levels of protein that is translated from an open reading frame that is present upstream (5’) of the poly-A tail (Holtkamp et al., 2006, Blood, vol. 108, pp. 4009-4017).
- the poly-A tail may be of any length.
- a poly-A tail comprises, essentially consists of, or consists of at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 A nucleotides, and, in particular, about 120 A nucleotides.
- nucleotides in the poly-A tail typically at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% by number of nucleotides in the poly-A tail are A nucleotides, but permits that remaining nucleotides are nucleotides other than A nucleotides, such as U nucleotides (uridylate), G nucleotides (guanylate), or C nucleotides (cytidylate).
- a poly-A tail is attached during RNA transcription, e.g., during preparation of in vitro transcribed RNA, based on a DNA template comprising repeated dT nucleotides (deoxythymidylate) in the strand complementary to the coding strand.
- the DNA sequence encoding a poly-A tail (coding strand) is referred to as poly(A) cassette.
- the poly(A) cassette present in the coding strand of DNA essentially consists of dA nucleotides, but is interrupted by a random sequence of the four nucleotides (dA, dC, dG, and dT). Such random sequence may be 5 to 50, 10 to 30, or 10 to 20 nucleotides in length.
- a cassette is disclosed in WO 2016/005324 Al, hereby incorporated by reference. Any poly(A) cassette disclosed in WO 2016/005324 Al may be used in the present disclosure.
- a poly(A) cassette that essentially consists of dA nucleotides, but is interrupted by a random sequence having an equal distribution of the four nucleotides (dA, dC, dG, dT) and having a length of e.g., 5 to 50 nucleotides shows, on DNA level, constant propagation of plasmid DNA in E. coli and is still associated, on RNA level, with the beneficial properties with respect to supporting RNA stability and translational efficiency is encompassed.
- the poly-A tail contained in an RNA (in particular, mRNA) molecule described herein essentially consists of A nucleotides, but is interrupted by a random sequence of the four nucleotides (A, C, G, U). Such random sequence may be 5 to 50, 10 to 30, or 10 to 20 nucleotides in length.
- no nucleotides other than A nucleotides flank a poly-A tail at its 3'-end, i.e., the poly-A tail is not masked or followed at its 3'-end by a nucleotide other than A.
- a poly-A tail may comprise at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 nucleotides. In some embodiments, the poly-A tail may essentially consist of at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 nucleotides. In some embodiments, the poly- A tail may consist of at least 20, at least 30, at least 40, at least 80, or at least 100 and up to 500, up to 400, up to 300, up to 200, or up to 150 nucleotides.
- the poly-A tail comprises at least 100 nucleotides. In some embodiments, the poly-A tail comprises about 150 nucleotides. In some embodiments, the poly-A tail comprises about 120 nucleotides. In some embodiments, the poly-A tail comprises or consists of the nucleotide sequence of SEQ ID NO: 14. In some embodiments, the poly-A sequence has a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 14.
- the term "untranslated region" or “UTR” relates to a region in a DNA molecule which is transcribed but is not translated into an amino acid sequence, or to the corresponding region in an RNA molecule, such as an mRNA molecule.
- An untranslated region (UTR) can be present 5' (upstream) of an open reading frame (5'-UTR) and/or 3' (downstream) of an open reading frame (3 '-UTR).
- a 5 '-UTR if present, is located at the 5 '-end, upstream of the start codon of a protein-encoding region.
- a 5 '-UTR is downstream of the 5 '-cap (if present), e.g., directly adjacent to the 5'-cap.
- a 3 '-UTR if present, is located at the 3'-end, downstream of the termination codon of a protein-encoding region, but the term "3'-UTR" does preferably not include the poly-A sequence.
- the 3 '-UTR is upstream of the poly-A sequence (if present), e.g., directly adjacent to the poly-A sequence.
- Incorporation of a 3'-UTR into the 3 '-non translated region of an RNA (preferably mRNA) molecule can result in an enhancement in translation efficiency.
- a synergistic effect may be achieved by incorporating two or more of such 3'- UTRs (which are preferably arranged in a head-to-tail orientation; cf., e.g., Holtkamp et al., Blood 108, 4009-4017 (2006)).
- the 3'-UTRs may be autologous or heterologous to the RNA (preferably mRNA) into which they are introduced.
- the 3 '-UTR is derived from a globin gene or mRNA, such as a gene or mRNA of alpha2 -globin, alpha 1 -globin, or beta-globin, preferably beta- globin, more preferably human beta-globin.
- the RNA (preferably mRNA) may be modified by the replacement of the existing 3'-UTR with or the insertion of one or more, preferably two copies of a 3 '-UTR derived from a globin gene, such as alpha2-globin, alpha 1 -globin, beta-globin, preferably beta-globin, more preferably human beta-globin.
- a globin gene such as alpha2-globin, alpha 1 -globin, beta-globin, preferably beta-globin, more preferably human beta-globin.
- the RNA (such as mRNA) used in present disclosure comprises a 5’-UTR comprising the nucleotide sequence of SEQ ID NO: 12, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 12.
- the RNA (such as mRNA) used in present disclosure comprises a 3 ’-UTR comprising the nucleotide sequence of SEQ ID NO: 13, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 13.
- RNA such as mRNA
- the RNA (such as mRNA) described herein may have modified ribonucleotides in order to increase its stability and/or decrease immunogenicity and/or decrease cytotoxicity.
- uridine in the RNA (such as mRNA) described herein is replaced (partially or completely, preferably completely) by a modified nucleoside.
- the modified nucleoside is a modified uridine.
- the modified uridine replacing uridine is selected from the group consisting of pseudouridine (y), N 1 -methyl-pseudouridine (m 1 y), 5 -methyl-uridine (m5U), and combinations thereof.
- the modified nucleoside replacing (partially or completely, preferably completely) uridine in the RNA may be any one or more of 3-methyl-uridine (m3U), 5-methoxy-uridine (mo5U), 5-aza-uridine, 6-aza-uridine, 2-thio-5-aza-uridine, 2-thio-uridine (s2U), 4- thio-uridine (s4U), 4-thio-pseudouridine, 2-thio-pseudouridine, 5-hydroxy-uridine (ho5U), 5- aminoallyl-uridine, 5 -halo-uridine (e.g., 5-iodo-uridineor 5-bromo-uridine), uridine 5-oxyace
- 5-carbamoylmethyl-2'-0-methyl-uridine ncm5Um
- 5-carboxymethylaminomethyl-2'-0-methyl- uridine cmnm5Um
- 3,2'-0-dimethyl-uridine m3Um
- 5-(isopentenylaminomethyl)-2'-0-methyl- uridine inm5Um
- 1 -thio-uridine deoxythymidine, 2'-F-ara-uridine, 2'-F-uridine, 2'-OH-ara-uridine
- 5- (2-carbomethoxyvinyl) uridine 5-[3-(l -E-propenylamino)uridine, or any other modified uridine known in the art.
- RNA which is modified by pseudouridine (replacing partially or completely, preferably completely, uridine)
- Y-modified An RNA (preferably mRNA) which is modified by pseudouridine (replacing partially or completely, preferably completely, uridine)
- m 1 Y-modified means that the RNA (preferably mRNA) contains N(l)-methylpseudouridine (replacing partially or completely, preferably completely, uridine).
- m5U-modified means that the RNA (preferably mRNA) contains 5-methyluridine (replacing partially or completely, preferably completely, uridine).
- RNAs usually exhibit decreased immunogenicity compared to their unmodified forms and, thus, are preferred in applications where the induction of an immune response is to be avoided or minimized.
- the RNA preferably mRNA
- the codons of the RNA (preferably mRNA) described in the present disclosure may further be optimized, e.g., to increase the GC content of the RNA and/or to replace codons which are rare in the cell (or subject) in which the peptide or protein of interest is to be expressed by codons which are synonymous frequent codons in said cell (or subject).
- the amino acid sequence encoded by the RNA described in the present disclosure is encoded by a coding sequence which is codon-optimized and/or the G/C content of which is increased compared to wild type coding sequence.
- This also includes embodiments, wherein one or more sequence regions of the coding sequence are codon-optimized and/or increased in the G/C content compared to the corresponding sequence regions of the wild type coding sequence.
- the codon-optimization and/or the increase in the G/C content preferably does not change the sequence of the encoded amino acid sequence.
- coding regions are preferably codon-optimized for optimal expression in a subject to be treated using the RNA (preferably mRNA) described herein. Codon-optimization is based on the finding that the translation efficiency is also determined by a different frequency in the occurrence of tRNAs in cells. Thus, the sequence ofRNA (preferably mRNA) may be modified such that codons for which frequently occurring tRNAs are available are inserted in place of "rare codons".
- the guanosine/cytosine (G/C) content of the coding region of the RNA (preferably mRNA) described herein is increased compared to the G/C content of the corresponding coding sequence of the wild type RNA, wherein the amino acid sequence encoded by the RNA (preferably mRNA) is preferably not modified compared to the amino acid sequence encoded by the wild type RNA.
- This modification of the RNA sequence is based on the fact that the sequence of any RNA region to be translated is important for efficient translation of that RNA (preferably mRNA) Sequences having an increased G (guanosine)/C (cytosine) content are more stable than sequences having an increased A (adenosine)/U (uracil) content.
- RNA preferably mRNA
- codons which contain A and/or U nucleotides can be modified by substituting these codons by other codons, which code for the same amino acids but contain no A and/or U or contain a lower content of A and/or U nucleotides.
- the G/C content of the coding region of the RNA (in particular, mRNA) described herein is increased by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 55%, or even more compared to the G/C content of the coding region of the wild type RNA.
- a combination of the above described modifications i.e., incorporation of a 5 '-cap structure, incorporation of a poly-A sequence, unmasking of a poly-A sequence, alteration of the 5'- and/or 3'- UTR (such as incorporation of one or more 3'-UTRs), replacing one or more naturally occurring nucleotides with synthetic nucleotides (e.g ., 5-methylcytidine for cytidine and/or pseudouridine (Y) or N(l)-methylpseudouridine (m 1 Y) or 5-methyluridine (m5U) for uridine), and codon optimization, has a synergistic influence on the stability of RNA (preferably mRNA) and increase in translation efficiency.
- RNA preferably mRNA
- the RNA (preferably mRNA) described in the present disclosure contains a combination of at least two, at least three, at least four or all five of the above-mentioned modifications, i.e., (i) incorporation of a 5'-cap structure; (ii) incorporation of a poly- A sequence, unmasking of a poly-A sequence; (iii) alteration of the 5’- and/or 3'-UTR (such as incorporation of one or more 3'-UTRs); (iv) replacing one or more naturally occurring nucleotides with synthetic nucleotides (e.g., 5-methylcytidine for cytidine and/or pseudouridine (Y) or N(l)- methylpseudouridine (m l'T) or 5-methyluridine (m5U) for uridine); and (v) cod
- the RNA (preferably mRNA) described in the present disclosure comprises a capl or cap2, preferably a capl structure.
- the poly-A sequence comprises at least 100 nucleotides.
- the poly-A sequence comprises or consists of the nucleotide sequence of SEQ ID NO: 14.
- the a 5’-UTR comprises the nucleotide sequence of SEQ ID NO: 12, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 12.
- the 3’-UTR comprising the nucleotide sequence of SEQ ID NO: 13, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 13.
- the disclosure involves the targeted delivery of the RNA (preferably mRNA) disclosed herein to certain cells or tissues.
- the disclosure involves targeting the lymphatic system, in particular secondary lymphoid organs, more specifically spleen.
- Targeting the lymphatic system, in particular secondary lymphoid organs, more specifically spleen is in particular preferred if the RNA (preferably mRNA) administered is RNA (preferably mRNA) encoding an antigen or epitope for inducing an immune response.
- the target cell is a spleen cell.
- the target cell is an antigen presenting cell such as a professional antigen presenting cell in the spleen.
- the target cell is a dendritic cell in the spleen.
- the "lymphatic system” is part of the circulatory system and an important part of the immune system, comprising a network of lymphatic vessels that carry lymph.
- the lymphatic system consists of lymphatic organs, a conducting network of lymphatic vessels, and the circulating lymph.
- the primary or central lymphoid organs generate lymphocytes from immature progenitor cells.
- the thymus and the bone marrow constitute the primary lymphoid organs.
- Secondary or peripheral lymphoid organs which include lymph nodes and the spleen, maintain mature naive lymphocytes and initiate an adaptive immune response.
- Lipid-based RNA (such as mRNA) delivery systems have an inherent preference to the liver. Liver accumulation is caused by the discontinuous nature of the hepatic vasculature or the lipid metabolism (liposomes and lipid or cholesterol conjugates).
- the target organ is liver and the target tissue is liver tissue.
- the delivery to such target tissue is preferred, in particular, if presence of mRNA or of the encoded peptide or protein in this organ or tissue is desired and/or if it is desired to express large amounts of the encoded peptide or protein and/or if systemic presence of the encoded peptide or protein, in particular in significant amounts, is desired or required.
- the RNA is delivered to a target cell or target organ. In some embodiments, at least a portion of the RNA is delivered to the cytosol of the target cell.
- the RNA is RNA (preferably mRNA) encoding a peptide or protein and the RNA is translated by the target cell to produce the peptide or protein.
- the target cell is a cell in the liver. In some embodiments, the target cell is a muscle cell. In some embodiments, the target cell is an endothelial cell. In some embodiments, the target cell is a tumor cell or a cell in the tumor microenvironment.
- the target cell is a blood cell. In some embodiments, the target cell is a cell in the lymph nodes. In some embodiments, the target cell is a cell in the lung In some embodiments, the target cell is a cell in the skin. In some embodiments, the target cell is a spleen cell. In some embodiments, the target cell is an antigen presenting cell such as a professional antigen presenting cell in the spleen. In some embodiments, the target cell is a dendritic cell in the spleen. In some embodiments, the target cell is a T cell. In some embodiments, the target cell is a B cell. In some embodiments, the target cell is a NK cell. In some embodiments, the target cell is a monocyte.
- RNA LNP compositions described herein may be used for delivering RNA (preferably mRNA) to such target cell.
- the present disclosure also relates to a method for delivering RNA (preferably mRNA) to a target cell in a subject comprising the administration of the RNA compositions described herein to the subject.
- the RNA is delivered to the cytosol of the target cell.
- the RNA is RNA (preferably mRNA) encoding a peptide or protein and the RNA is translated by the target cell to produce the peptide or protein.
- the RNA is an inhibitory RNA.
- the term "inhibitory RNA" as used herein means KNA which selectively hybridizes to and/or is specific for a target mRNA, thereby inhibiting (e.g., reducing) transcription and/or translation thereof.
- Inhibitory RNA includes RNA molecules having sequences in the antisense orientation relative to the target mRNA. Suitable inhibitory oligonucleotides typically vary in length from five to several hundred nucleotides, more typically about 20 to 70 nucleotides in length or shorter, even more typically about 10 to 30 nucleotides in length. Examples of inhibitory RNA include antisense RNA, ribozyme, iRNA, siRNA and miRNA. In some embodiments of all aspects of the disclosure, the inhibitory RNA is siRNA.
- antisense RNA refers to an RNA which hybridizes under physiological conditions to DNA comprising a particular gene or to mRNA of said gene, thereby inhibiting transcription of said gene and/or translation of said mRNA.
- An antisense RNA or of a part thereof may form a duplex with naturally occurring mRNA and thus prevent accumulation of or translation of the mRNA.
- Another possibility is the use of ribozymes for inactivating a nucleic acid.
- the antisense RNA may hybridize with an N-terminal or 5' upstream site such as a translation initiation site, transcription initiation site or promoter site. In some embodiments, the antisense RNA may hybridize with a 3'- untranslated region or mRNA splicing site.
- the size of the antisense RNA may vary from 15 nucleotides to 15,000, preferably 20 to 12,000, in particular 100 to 10,000, 150 to 8,000, 200 to 7,000, 250 to 6,000, 300 to 5,000 nucleotides, such as 15 to 2,000, 20 to 1,000, 25 to 800, 30 to 600, 35 to 500, 40 to 400, 45 to 300, 50 to 250, 55 to 200, 60 to 150, or 65 to 100 nucleotides.
- the antisense RNA has a length of at least 2,700 nucleotides (such as at least 2,800, at least 2,900, at least 3,000, at least 3,100, at least 3,200, at least 3,300, at least 3,400, at least 3,500, at least 3,600, at least 3,700, at least 3,800, at least 3,900, at least 4,000, at least 4,100, at least 4,200, at least 4,300, at least 4,400, at least 4,500, at least 4,600, at least 4,700, at least 4,800, at least 4,900, at least 5,000 nucleotides).
- 2,700 nucleotides such as at least 2,800, at least 2,900, at least 3,000, at least 3,100, at least 3,200, at least 3,300, at least 3,400, at least 3,500, at least 3,600, at least 3,700, at least 3,800, at least 3,900, at least 4,000, at least 4,100, at least 4,200, at least 4,300, at least 4,400, at least 4,500, at least 4,600, at least 4,700,
- antisense RNA may be stabilized by one or more modifications having a stabilizing effect.
- modifications include modified phosphodiester linkages (such as methylphosphonate, phosphorothioate, phosphorodithioate or phosphoramidate linkages instead of naturally occurring phosphodiester linkages) and 2'-substitutions (e.g., 2'-fluoro, 2'-0-alkyl (such as 2'-0-methyl, 2'-0-propyl, or 2'-0-pentyl) and 2'-0-allyl).
- phosphorothioate linkages are substituted partially for phosphodiester linkages.
- the ribose moiety is substituted partially at the 2'-position with O-alkyl (such as 2'-0- methyl).
- O-alkyl such as 2'-0- methyl
- An antisense RNA can be targeted to any stretch of approximately 19 to 25 contiguous nucleotides in any of the target mRNA sequences (the "target sequence").
- a target sequence on the target mRNA can be selected from a given cDNA sequence corresponding to the target mRNA, preferably beginning 50 to 100 nt downstream (i.e., in the 3'-direction) from the start codon.
- the target sequence can, however, be located in the 5'- or 3 '-untranslated regions, or in the region nearby the start codon.
- Antisense RNA can be obtained using a number of techniques known to those of skill in the art. For example, antisense RNA can be chemically synthesized or recombinantly produced using methods known in the art. Preferably, antisense RNA is transcribed from recombinant circular or linear DNA plasmids using any suitable promoter.
- small interfering RNA or "siRNA” as used herein is meant an RNA molecule, preferably greater than 10 nucleotides in length, more preferably greater than 15 nucleotides in length, and most preferably 18, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length that is capable of binding specifically to a portion of a target mRNA. This binding induces a process, in which said portion of the target mRN A is cut or degraded and thereby the gene expression of said target mRNA inhibited.
- a range of 19 to 25 nucleotides is the most preferred size for siRNAs.
- the sense and antisense strands of siRNAs can comprise two complementary, single-stranded RNA molecules
- the siRNAs according to the present disclosure, comprise a single molecule in which two complementary portions are base-paired and are covalently linked by a single-stranded "hairpin" area. That is, the sense region and antisense region can be covalently connected via a linker molecule.
- the linker molecule can be a polynucleotide or non-nucleotide linker, but is preferably a polynucleotide linker.
- the hairpin area of the siRNA molecule is cleaved intracellularly by the "Dicer" protein (or its equivalent) to form an siRNA of two individual base-paired RNA molecules.
- the siRNA can also comprise a 3'-overhang.
- a "3'-overhang” refers to at least one unpaired nucleotide extending from the 3'-end of an RNA strand.
- the siRNA comprises at least one 3 '-overhang of from 1 to about 6 nucleotides (which includes ribonucleotides or deoxynucleotides) in length, preferably from 1 to about 5 nucleotides in length, more preferably from 1 to about 4 nucleotides in length, and particularly preferably from about 2 to about 4 nucleotides in length.
- both strands of the siRNA molecule i.e., after the siRNA molecule is cleaved intracellularly by the "Dicer” protein
- the length of the overhangs can be the same or different for each strand.
- the 3'- overhang is present on both strands of the siRNA, and is 2 nucleotides in length.
- each strand of the siRNA can comprise 3'-overhangs of dideoxythymidylic acid ("TT") or diuridylic acid ("uu").
- the 3 '-overhangs can be also stabilized against degradation.
- the overhangs are stabilized by including purine nucleotides, such as adenosine or guanosine nucleotides.
- substitution of pyrimidine nucleotides by modified analogues e.g., substitution of uridine nucleotides in the 3'-overhangs with 2'-deoxythymidine, is tolerated and does not affect the efficiency of RNAi degradation.
- the absence of a 2'- hydroxyl in the 2'-deoxythymidine significantly enhances the nuclease resistance of the 3 '-overhang in tissue culture medium.
- target mRNA refers to an RNA molecule that is a target for downregulation.
- the target mRNA comprises an ORF encoding a pharmaceutically active peptide or polypeptide as specified herein.
- the pharmaceutically active peptide or polypeptide is one whose expression (in particular increased expression, e.g., compared to the expression in a healthy subject) is associated with a disease.
- the target mRNA comprises an ORF encoding a pharmaceutically active peptide or polypeptide whose expression (in particular increased expression, e.g., compared to the expression in a healthy subject) is associated with cancer.
- siRNA can be targeted to any stretch of approximately 19 to 25 contiguous nucleotides in any of the target mRNA sequences (the "target sequence”).
- Techniques for selecting target sequences for siRNA are given, for example, in Tuschl T. et al., "The siRNA User Guide”, revised Oct. 11, 2002, the entire disclosure of which is herein incorporated by reference. "The siRNA User Guide” is available on the world wide web at a website maintained by Dr. Thomas Tuschl, Laboratory of RNA Molecular Biology, Rockefeller University, New York, USA, and can be found by accessing the website of the Rockefeller University and searching with the keyword "siRNA”.
- the sense strand of the siRNA used in the present disclosure comprises a nucleotide sequence substantially identical to any contiguous stretch of about 19 to about 25 nucleotides in the target mRNA.
- a target sequence on the target mRNA can be selected from a given cDNA sequence corresponding to the target mRNA, preferably beginning 50 to 100 nt downstream (i.e., in the 3'- direction) from the start codon.
- the target sequence can, however, be located in the 5'- or 3 '-untranslated regions, or in the region nearby the start codon.
- siRNA can be obtained using a number of techniques known to those of skill in the art. For example, siRNA can be chemically synthesized or recombinantly produced using methods known in the art, such as the Drosophila in vitro system described in U.S. application no. 2002/0086356 of Tuschl et al., the entire disclosure of which is herein incorporated by reference.
- siRNA can be expressed from pol III expression vectors without a change in targeting site, as expression of RNAs from pol III promoters is only believed to be efficient when the first transcribed nucleotide is a purine.
- siRNA is transcribed from recombinant circular or linear DNA plasmids using any suitable promoter.
- suitable promoters for transcribing siRNA used in the present disclosure from a plasmid include, for example, the U6 or HI RNA pol III promoter sequences and the cytomegalovirus promoter. Selection of other suitable promoters is within the skill in the art.
- plasmids suitable for transcribing siRNA are within the skill in the art.
- miRNA refers to non-coding RNAs which have a length of 21 to 25 (such as 21 to 23, preferably 22) nucleotides and which induce degradation and/or prevent translation of target mRNAs.
- miRNAs are typically found in plants, animals and some viruses, wherein they are encoded by eukaryotic nuclear DNA in plants and animals and by viral DNA (in viruses whose genome is based on DNA), respectively.
- miRNAs are post-transcriptional regulators that bind to complementary sequences on target messenger RNA transcripts (mRNAs), usually resulting in translational repression or target degradation and gene silencing. miRNA can be obtained using a number of techniques known to those of skill in the art.
- miRNA can be chemically synthesized or recombinantly produced using methods known in the art (e.g., by using commercially available kits such as the miRNA cDNA Synthesis Kit sold by Applied Biological Materials Inc.).
- miRNA is transcribed from recombinant circular or linear DNA plasmids using any suitable promoter.
- Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an RNA (preferably mRNA), to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
- a gene encodes a protein if transcription and translation of RNA (preferably mRNA) corresponding to that gene produces the protein in a cell or other biological system.
- Both the coding strand, the nucleotide sequence of which is identical to the RNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
- a nucleic acid sequence e.g., an ORF
- polypeptides e.g., a peptide or protein, preferably a pharmaceutically active peptide or protein.
- RNA (preferably mRNA) described in the present disclosure comprises a nucleic acid sequence (e.g., an ORF) encoding a peptide or protein, preferably a pharmaceutically active peptide or protein, and is capable of expressing said peptide or protein, in particular if transferred into a cell or subject.
- the RNA (preferably mRNA) described in the present disclosure contains a coding region (ORF) encoding a peptide or protein, preferably encoding a pharmaceutically active peptide or protein.
- ORF coding region
- an "open reading frame” or "ORF” is a continuous stretch of codons beginning with a start codon and ending with a stop codon.
- RNA preferably mRNA
- RNA encoding a pharmaceutically active peptide or protein
- pharmaceutically active RNA or “pharmaceutically active mRNA”
- RNA (preferably mRNA) described in the present disclosure comprises a nucleic acid sequence encoding more than one peptide or polypeptide, e.g., two, three, four or more peptides or polypeptides.
- the term "pharmaceutically active peptide or protein” means a peptide or protein that can be used in the treatment of an individual where the expression of the peptide or protein would be of benefit, e.g., in ameliorating the symptoms of a disease or disorder.
- a pharmaceutically active peptide or protein has curative or palliative properties and may be administered to ameliorate, relieve, alleviate, reverse, delay onset of or lessen the severity of one or more symptoms of a disease or disorder.
- a pharmaceutically active peptide or protein has a positive or advantageous effect on the condition or disease state of an individual when administered to the individual in a therapeutically effective amount.
- a pharmaceutically active peptide or protein may have prophylactic properties and may be used to delay the onset of a disease or disorder or to lessen the severity of such disease or disorder.
- pharmaceutically active peptide or protein includes entire proteins or polypeptides, and can also refer to pharmaceutically active fragments thereof. It can also include pharmaceutically active analogs of a peptide or protein.
- pharmaceutically active peptides and proteins include, but are not limited to, immunostimulants, e.g., cytokines, hormones, adhesion molecules, immunoglobulins, immunologically active compounds, growth factors, protease inhibitors, enzymes, receptors, apoptosis regulators, transcription factors, tumor suppressor proteins, structural proteins, reprogramming factors, genomic engineering proteins, and blood proteins.
- immunostimulants e.g., cytokines, hormones, adhesion molecules, immunoglobulins, immunologically active compounds, growth factors, protease inhibitors, enzymes, receptors, apoptosis regulators, transcription factors, tumor suppressor proteins, structural proteins, reprogramming factors, genomic engineering proteins, and blood proteins.
- the pharmaceutically active peptide and polypeptide includes a replacement protein.
- an “immunostimulant” is any substance that stimulates the immune system by inducing activation or increasing activity of any of the immune system's components, in particular immune effector cells.
- the immunostimulant may be pro-inflammatory (e.g., when treating infections or cancer), or antiinflammatory (e.g., when treating autoimmune diseases).
- the immunostimulant is a cytokine or a variant thereof.
- cytokines include interferons, such as interferon-alpha (IFN-a) or interferon-gamma (IFN-g), interleukins, such as IL2, IL7, IL12, IL15 and IL23, colony stimulating factors, such as M-CSF and GM-CSF, and tumor necrosis factor.
- the immunostimulant includes an adjuvant-type immunostimulatory agent such as APC Toll-like Receptor agonists or costimulatory/cell adhesion membrane proteins.
- Toll-like Receptor agonists include costimul atory/ adhesion proteins such as CD80, CD86, and ICAM-1.
- cytokines relates to proteins which have a molecular weight of about 5 to 60 kDa (such as about 5 to 20 kDa) and which participate in cell signaling (e.g., paracrine, endocrine, and/or autocrine signaling). In particular, when released, cytokines exert an effect on the behavior of cells around the place of their release. Examples of cytokines include lymphokines, interleukins, chemokines, interferons, and tumor necrosis factors (TNFs). According to the present disclosure, cytokines do not include hormones or growth factors.
- Cytokines differ from hormones in that (i) they usually act at much more variable concentrations than hormones and (ii) generally are made by a broad range of cells (nearly all nucleated cells can produce cytokines).
- Interferons are usually characterized by antiviral, antiproliferative and immunomodulatory activities. Interferons are proteins that alter and regulate the transcription of genes within a cell by binding to interferon receptors on the regulated cell's surface, thereby preventing viral replication within the cells. The interferons can be grouped into two types. IFN- gamma is the sole type II interferon; all others are type I interferons.
- cytokines include erythropoietin (EPO), colony stimulating factor (CSF), granulocyte colony stimulating factor (G-CSF), granulocyte-macrophage colony stimulating factor (GM-CSF), tumor necrosis factor (TNF), bone morphogenetic protein (BMP), interferon alfa (IFNa), interferon beta (IFNp), interferon gamma (INFy), interleukin 2 (IL-2), interleukin 4 (IL-4), interleukin 10 (IL-10), interleukin 11 (IL-11), interleukin 12 (IL-12), and interleukin 21 (IL-21).
- EPO erythropoietin
- CSF colony stimulating factor
- G-CSF granulocyte colony stimulating factor
- GM-CSF granulocyte-macrophage colony stimulating factor
- TNF tumor necrosis factor
- BMP bone morphogenetic protein
- IFNa interferon alfa
- a cytokine may be a naturally occurring cytokine or a functional fragment or variant thereof.
- a cytokine may be human cytokine and may be derived from any vertebrate, especially any mammal.
- One particularly preferred cytokine is interferon-a.
- Immunostimulants may be provided to a subject by administering to the subject RNA encoding an immunostimulant in a formulation for preferential delivery of RNA to liver or liver tissue.
- RNA encoding an immunostimulant in a formulation for preferential delivery of RNA to liver or liver tissue.
- the delivery of RNA to such target organ or tissue is preferred, in particular, if it is desired to express large amounts of the immunostimulant and/or if systemic presence of the immunostimulant, in particular in significant amounts, is desired or required.
- RNA delivery systems have an inherent preference to the liver. This pertains to lipid-based particles, cationic and neutral nanoparticles, in particular lipid nanoparticles.
- cytokines involved in T cell proliferation and/or maintenance.
- suitable cytokines include IL2 or IL7, fragments and variants thereof, and fusion proteins of these cytokines, fragments and variants, such as extended-PK cytokines.
- RNA encoding an immunostimulant may be administered in a formulation for preferential delivery of RNA to the lymphatic system, in particular secondary lymphoid organs, more specifically spleen.
- the delivery of an immunostimulant to such target tissue is preferred, in particular, if presence of the immunostimulant in this organ or tissue is desired (e.g., for inducing an immune response, in particular in case immunostimulants such as cytokines are required during T-cell priming or for activation of resident immune cells), while it is not desired that the immunostimulant is present systemically, in particular in significant amounts (e.g., because the immunostimulant has systemic toxicity).
- suitable immunostimulants are cytokines involved in T cell priming.
- suitable cytokines include IL12, IL15, IFN-a, or IFN-b, fragments and variants thereof, and fusion proteins of these cytokines, fragments and variants, such as extended-PK cytokines.
- Interferons are a group of signaling proteins made and released by host cells in response to the presence of several pathogens, such as viruses, bacteria, parasites, and also tumor cells. In a typical scenario, a virus-infected cell will release interferons causing nearby cells to heighten their anti-viral defenses.
- interferons Based on the type of receptor through which they signal, interferons are typically divided among three classes: type I interferon, type II interferon, and type III interferon. All type I interferons bind to a specific cell surface receptor complex known as the DFN-a/b receptor (IFNAR) that consists of IFNAR1 and IFNAR2 chains.
- IFNAR DFN-a/b receptor
- type I interferons present in humans are IFNa, IFNp, IFNa, IFNK and IFNco.
- type I interferons are produced when the body recognizes a virus that has invaded it. They are produced by fibroblasts and monocytes. Once released, type 1 interferons bind to specific receptors on target cells, which leads to expression of proteins that will prevent the virus from producing and replicating its RNA and DNA.
- the IFNa proteins are produced mainly by plasmacytoid dendritic cells (pDCs). They are mainly involved in innate immunity against viral infection.
- the genes responsible for their synthesis come in 13 subtypes that are called IFNA1, 1FNA2, IFNA4, IFNA5, IFNA6, IFNA7, IFNA8, IFNA10, IFNA13, 1FNA14, JFNA16, 1FNA17, IFNA21 . These genes are found together in a cluster on chromosome 9.
- the IFNP proteins are produced in large quantities by fibroblasts. They have antiviral activity that is involved mainly in innate immune response. Two types ofIFNp have been described, IFNpi and IFNP3. The natural and recombinant forms of IFNpi have antiviral, antibacterial, and anticancer properties.
- Type II interferon IFNy in humans
- IL12 Type II interferon
- type II interferons are released by cytotoxic T cells and T helper cells.
- Type III interferons signal through a receptor complex consisting of IL10R2 (also called CRF2-4) and IFNLR1 (also called CRF2-12). Although discovered more recently than type 1 and type II IFNs, recent information demonstrates the importance of type III IFNs in some types of virus or fungal infections.
- type I and II interferons are responsible for regulating and activating the immune response.
- a type I interferon is preferably IFNa or IFNp, more preferably IFNa.
- an interferon may be a naturally occurring interferon or a functional fragment or variant thereof.
- An interferon may be human interferon and may be derived from any vertebrate, especially any mammal.
- Interleukins are a group of cytokines (secreted proteins and signal molecules) that can be divided into four major groups based on distinguishing structural features. However, their amino acid sequence similarity is rather weak (typically 15-25% identity).
- the human genome encodes more than 50 interleukins and related proteins.
- an interleukin may be a naturally occurring interleukin or a functional fragment or variant thereof.
- An interleukin may be human interleukin and may be derived from any vertebrate, especially any mammal.
- Immunostimulant polypeptides described herein can be prepared as fusion or chimeric polypeptides that include an immunostimulant portion and a heterologous polypeptide (i.e., a polypeptide that is not an immunostimulant).
- the immunostimulant may be fused to an extended-PK group, which increases circulation half-life.
- extended-PK groups are described infra. It should be understood that other PK groups that increase the circulation half-life of immunostimulants such as cytokines, or variants thereof, are also applicable to the present disclosure.
- the extended-PK group is a serum albumin domain (e.g., mouse serum albumin, human serum albumin).
- PK is an acronym for "pharmacokinetic” and encompasses properties of a compound including, by way of example, absorption, distribution, metabolism, and elimination by a subject.
- an "extended-PK group” refers to a protein, peptide, or moiety that increases the circulation half-life of a biologically active molecule when fused to or administered together with the biologically active molecule.
- examples of an extended-PK group include serum albumin (e.g., HSA), Immunoglobulin Fc or Fc fragments and variants thereof, transferrin and variants thereof, and human serum albumin (HSA) binders (as disclosed in U.S. Publication Nos. 2005/0287153 and 2007/0003549).
- extended-PK groups are disclosed in Kontermann, Expert Opin Biol Ther, 2016 Jul;16(7):903-15 which is herein incorporated by reference in its entirety.
- an "extended-PK" immunostimulant refers to an immunostimulant moiety in combination with an extended-PK group.
- the extended-PK immunostimulant is a fusion protein in which an immunostimulant moiety is linked or fused to an extended-PK group.
- the serum half-life of an extended-PK immunostimulant is increased relative to the immunostimulant alone (i.e., the immunostimulant not fused to an extended-PK group). In certain embodiments, the serum half-life of the extended-PK immunostimulant is at least 20%, at least 40%, at least 60%, at least 80%, at least 100%, at least 120%, at least 150%, at least 180%, at least 200%, at least 400%, at least 600%, at least 800%, or at least 1000% longer relative to the serum half-life of the immunostimulant alone.
- the serum half-life of the extended-PK immunostimulant is at least 1 ,5-fold, 2-fold, 2.5-fold, 3-fold, 3.5-fold, 4-fold, 4.5-fold, 5-fold, 6-fold, 7- fold, 8-fold, 10-fold, 12-fold, 13-fold, 15-fold, 17-fold, 20-fold, 22-fold, 25-fold, 27-fold, 30-fold, 35- fold, 40-fold, or 50-fold greater than the serum half-life of the Immunostimulant alone.
- the serum half-life of the extended-PK immunostimulant is at least 10 hours, 15 hours, 20 hours, 25 hours, 30 hours, 35 hours, 40 hours, 50 hours, 60 hours, 70 hours, 80 hours, 90 hours, 100 hours, 110 hours, 120 hours, 130 hours, 135 hours, 140 hours, 150 hours, 160 hours, or 200 hours.
- half-life refers to the time taken for the serum or plasma concentration of a compound such as a peptide or polypeptide to reduce by 50%, in vivo, for example due to degradation and/or clearance or sequestration by natural mechanisms.
- An extended-PK immunostimulant suitable for use herein is stabilized in vivo and its half-life increased by, e.g., fusion to serum albumin (e.g ., HSA or MSA), which resist degradation and/or clearance or sequestration.
- the half-life can be determined in any manner known per se, such as by pharmacokinetic analysis.
- Suitable techniques will be clear to the person skilled in the art, and may for example generally involve the steps of suitably administering a suitable dose of the amino acid sequence or compound to a subject; collecting blood samples or other samples from said subject at regular intervals; determining the level or concentration of the amino acid sequence or compound in said blood sample; and calculating, from (a plot of) the data thus obtained, the time until the level or concentration of the amino acid sequence or compound has been reduced by 50% compared to the initial level upon dosing. Further details are provided in, e.g., standard handbooks, such as Kenneth, A. et al., Chemical Stability of Pharmaceuticals: A Handbook for Pharmacists and in Peters et al., Pharmacokinetic Analysis: A Practical Approach (1996). Reference is also made to Gibaldi, M. et al, Pharmacokinetics, 2nd Rev. Edition, Marcel Dekker (1982).
- the extended-PK group includes serum albumin, or fragments thereof or variants of the serum albumin or fragments thereof (all of which for the purpose of the present disclosure are comprised by the term "albumin”).
- Polypeptides described herein may be fused to albumin (or a fragment or variant thereof) to form albumin fusion proteins.
- albumin fusion proteins are described in U.S. Publication No. 20070048282.
- albumin fusion protein refers to a protein formed by the fusion of at least one molecule of albumin (or a fragment or variant thereof) to at least one molecule of a protein such as a therapeutic protein, in particular an immunostimulant .
- the albumin fusion protein may be generated by translation of a nucleic acid in which a polynucleotide encoding a therapeutic protein is joined in-frame with a polynucleotide encoding an albumin.
- an albumin fusion protein comprises at least one molecule of a therapeutic protein (including, but not limited to a mature form of the therapeutic protein) and at least one molecule of albumin (including but not limited to a mature form of albumin).
- an albumin fusion protein is processed by a host cell such as a cell of the target organ for administered RNA, e.g. a liver cell, and secreted into the circulation.
- Processing of the nascent albumin fusion protein that occurs in the secretory pathways of the host cell used for expression of the RNA may include, but is not lim ited to signal peptide cleavage; formation of disulfide bonds; proper folding; addition and processing of carbohydrates (such as for example, N- and O-linked glycosylation); specific proteolytic cleavages; and/or assembly into multimeric proteins.
- An albumin fusion protein is preferably encoded by RNA in a non-processed form which in particular has a signal peptide at its N-terminus and following secretion by a cell is preferably present in the processed form wherein in particular the signal peptide has been cleaved off.
- the "processed form of an albumin fusion protein” refers to an albumin fusion protein product which has undergone N-terminal signal peptide cleavage, herein also referred to as a "mature albumin fusion protein”.
- albumin fusion proteins comprising a therapeutic protein have a higher plasma stability compared to the plasma stability of the same therapeutic protein when not fused to albumin.
- Plasma stability typically refers to the time period between when the therapeutic protein is administered in vivo and carried into the bloodstream and when the therapeutic protein is degraded and cleared from the bloodstream, into an organ, such as the kidney or liver, that ultimately clears the therapeutic protein from the body.
- Plasma stability is calculated in terms of the half-life of the therapeutic protein in the bloodstream. The half-life of the therapeutic protein in the bloodstream can be readily determined by common assays known in the art.
- albumin refers collectively to albumin protein or amino acid sequence, or an albumin fragment or variant, having one or more functional activities (e.g ., biological activities) of albumin.
- albumin refers to human albumin or fragments or variants thereof especially the mature form of human albumin, or albumin from other vertebrates or fragments thereof, or variants of these molecules.
- the albumin may be derived from any vertebrate, especially any mammal, for example human, cow, sheep, or pig. Non-mammalian albumins include, but are not limited to, hen and salmon.
- the albumin portion of the albumin fusion protein may be from a different animal than the therapeutic protein portion.
- the albumin is human serum albumin (HSA), or fragments or variants thereof, such as those disclosed in US 5,876,969, WO 2011/124718, WO 2013/075066, and WO 2011/0514789.
- HSA human serum albumin
- HA human albumin
- albumin and serum albumin are broader, and encompass human serum albumin (and fragments and variants thereof) as well as albumin from other species (and fragments and variants thereof).
- a fragment of albumin sufficient to prolong the therapeutic activity or plasma stability of the therapeutic protein refers to a fragment of albumin sufficient in length or structure to stabilize or prolong the therapeutic activity or plasma stability of the protein so that the plasma stability of the therapeutic protein portion of the albumin fusion protein is prolonged or extended compared to the plasma stability in the non-fusion state.
- the albumin portion of the albumin fusion proteins may comprise the full length of the albumin sequence, or may include one or more fragments thereof that are capable of stabilizing or prolonging the therapeutic activity or plasma stability.
- Such fragments may be of 10 or more amino acids in length or may include about 15, 20, 25, 30, 50, or more contiguous amino acids from the albumin sequence or may include part or all of specific domains of albumin.
- one or more fragments of HSA spanning the first two immunoglobulin-like domains may be used.
- the HSA fragment is the mature form of HSA.
- an albumin fragment or variant will be at least 100 amino acids long, preferably at least 150 amino acids long.
- albumin may be naturally occurring albumin or a fragment or variant thereof.
- Albumin may be human albumin and may be derived from any vertebrate, especially any mammal.
- the albumin fusion protein comprises albumin as the N-terminal portion, and a therapeutic protein as the C -terminal portion.
- an albumin fusion protein comprising albumin as the C -terminal portion, and a therapeutic protein as the N-terminal portion may also be used.
- the albumin fusion protein has a therapeutic protein fused to both the N-terminus and the C-terminus of albumin.
- the therapeutic proteins fused at the N- and C -termini are the same therapeutic proteins.
- the therapeutic proteins fused at the N- and C -termini are different therapeutic proteins.
- the different therapeutic proteins are both cytokines.
- the therapeutic protein(s) is (are) joined to the albumin through (a) peptide linker(s).
- a peptide linker between the fused portions may provide greater physical separation between the moieties and thus maximize the accessibility of the therapeutic protein portion, for instance, for binding to its cognate receptor.
- the peptide linker may consist of amino acids such that it is flexible or more rigid.
- the linker sequence may be cleavable by a protease or chemically.
- Fc region refers to the portion of a native immunoglobulin formed by the respective Fc domains (or Fc moieties) of its two heavy chains.
- Fc domain refers to a portion or fragment of a single immunoglobulin (Ig) heavy chain wherein the Fc domain does not comprise an Fv domain.
- an Fc domain begins in the hinge region just upstream of the papain cleavage site and ends at the C-terminus of the antibody. Accordingly, a complete Fc domain comprises at least a hinge domain, a CH2 domain, and a CH3 domain.
- an Fc domain comprises at least one of; a hinge ( e.g ,, upper, middle, and/or lower hinge region) domain, a CH2 domain, a CH3 domain, a CH4 domain, or a variant, portion, or fragment thereof.
- a hinge e.g ,, upper, middle, and/or lower hinge region
- a CH2 domain e.g , a CH2 domain
- a CH3 domain e.g., upper, middle, and/or lower hinge region
- a CH2 domain e.g , upper, middle, and/or lower hinge region domain
- a CH2 domain e.g , a CH3 domain
- a CH4 domain e.g., a variant, portion, or fragment thereof.
- an Fc domain comprises a complete Fc domain (/. ⁇ ?., a hinge domain, a CH2 domain, and a CH3 domain).
- an Fc domain comprises a hinge domain (or portion thereof) fused to a CH3 domain (
- an Fc domain consists of a CH3 domain or portion thereof. In certain embodiments, an Fc domain consists of a hinge domain (or portion thereof) and a CH3 domain (or portion thereof). In certain embodiments, an Fc domain consists of a CH2 domain (or portion thereof) and a CH3 domain. In certain embodiments, an Fc domain consists of a hinge domain (or portion thereof) and a CH2 domain (or portion thereof). In certain embodiments, an Fc domain lacks at least a portion of a CH2 domain (e.g., all or part of a CH2 domain).
- An Fc domain herein generally refers to a polypeptide comprising all or part of the Fc domain of an immunoglobulin heavy-chain.
- the Fc domain may be derived from an immunoglobulin of any species and/or any subtype, including, but not limited to, a human IgGl, IgG2, IgG3, IgG4, IgD, IgA, IgE, or IgM antibody.
- the Fc domain encompasses native Fc and Fc variant molecules.
- any Fc domain may be modified such that it varies in amino acid sequence from the native Fc domain of a naturally occurring immunoglobulin molecule.
- the Fc domain has reduced effector function (e.g., FcyR binding).
- an Fc domain of a polypeptide described herein may be derived from different immunoglobulin molecules.
- an Fc domain of a polypeptide may comprise a CH2 and/or CH3 domain derived from an IgGl molecule and a hinge region derived from an IgG3 molecule.
- an Fc domain can comprise a chimeric hinge region derived, in part, from an IgGl molecule and, in part, from an IgG3 molecule.
- an Fc domain can comprise a chimeric hinge derived, in part, from an IgGl molecule and, in part, from an IgG4 molecule.
- an extended-PK group includes an Fc domain or fragments thereof or variants of the Fc domain or fragments thereof (all of which for the purpose of the present disclosure are comprised by the term "Fc domain").
- the Fc domain does not contain a variable region that binds to antigen.
- Fc domains suitable for use in the present disclosure may be obtained from a number of different sources.
- an Fc domain is derived from a human immunoglobulin.
- the Fc domain is from a human IgGl constant region. It is understood, however, that the Fc domain may be derived from an immunoglobulin of another mammalian species, including for example, a rodent (e.g. a mouse, rat, rabbit, guinea pig) or non-human primate (e.g. chimpanzee, macaque) species.
- rodent e.g. a mouse, rat, rabbit, guinea pig
- non-human primate e.g. chimpanzee, mac
- the Fc domain (or a fragment or variant thereof) may be derived from any immunoglobulin class, including IgM, IgG, IgD, IgA, and IgE, and any immunoglobulin isotype, including IgGl, IgG2, IgG3, and IgG4.
- Fc domain gene sequences e.g., mouse and human constant region gene sequences
- Constant region domains comprising an Fc domain sequence can be selected lacking a particular effector function and/or with a particular modification to reduce immunogenicity.
- Many sequences of antibodies and antibody-encoding genes have been published and suitable Fc domain sequences (e.g. hinge, CH2, and/or CH3 sequences, or fragments or variants thereof) can be derived from these sequences using art recognized techniques.
- the extended-PK group is a serum albumin binding protein such as those described in US2005/0287153, US2007/0003549, US2007/0178082, US2007/0269422,
- the extended-PK group is transferrin, as disclosed in US 7,176,278 and US 8,158,579, which are herein incorporated by reference in their entirety.
- the extended-PK group is a serum immunoglobulin binding protein such as those disclosed in US2007/0178082, US2014/0220017, and US2017/0145062, which are herein incorporated by reference in their entirety.
- the extended-PK group is a fibronectin (Fn)-based scaffold domain protein that binds to semm albumin, such as those disclosed in US2012/0094909, which is herein incorporated by reference in its entirety. Methods of making fibronectin-based scaffold domain proteins are also disclosed in US2012/0094909.
- Fn3-based extended-PK group is Fn3(HSA), i.e., a Fn3 protein that binds to human serum albumin.
- the extended-PK immunostimulant can employ one or more peptide linkers.
- peptide linker refers to a peptide or polypeptide sequence which connects two or more domains (e.g., the extended-PK moiety and an immunostimulant moiety) in a linear amino acid sequence of a polypeptide chain.
- peptide linkers may be used to connect an immunostimulant moiety to a HSA domain.
- Linkers suitable for fusing the extended-PK group to, e.g., an immunostimulant are well known in the art.
- Exemplary linkers include glycine-serine-polypeptide linkers, glycine-proline-polypeptide linkers, and proline-alanine polypeptide linkers.
- the linker is a glycine-serine- polypeptide linker, /. ⁇ ? ., a peptide that consists of glycine and serine residues.
- a pharmaceutically active peptide or protein comprises a replacement protein.
- the present disclosure provides a method for treatment of a subject having a disorder requiring protein replacement (e.g ., protein deficiency disorders) comprising administering to the subject RNA as described herein encoding a replacement protein.
- protein replacement refers to the introduction of a protein (including functional variants thereof) into a subject having a deficiency in such protein.
- the term also refers to the introduction of a protein into a subject otherwise requiring or benefiting from providing a protein, e.g., suffering from protein insufficiency.
- disorder characterized by a protein deficiency refers to any disorder that presents with a pathology caused by absent or insufficient amounts of a protein. This term encompasses protein folding disorders, i.e., conformational disorders, that result in a biologically inactive protein product. Protein insufficiency can be involved in infectious diseases, immunosuppression, organ failure, glandular problems, radiation illness, nutritional deficiency, poisoning, or other environmental or external insults.
- hormones relates to a class of signaling molecules produced by glands, wherein signaling usually includes the following steps: (i) synthesis of a hormone in a particular tissue; (ii) storage and secretion; (iii) transport of the hormone to its target; (iv) binding of the hormone by a receptor; (v) relay and amplification of the signal; and (vi) breakdown of the hormone.
- Hormones differ from cytokines in that (1) hormones usually act in less variable concentrations and (2) generally are made by specific kinds of cells.
- a "hormone” is a peptide or protein hormone, such as insulin, vasopressin, prolactin, adrenocorticotropic hormone (ACTH), thyroid hormone, growth hormones (such as human grown hormone or bovine somatotropin), oxytocin, atrial-natriuretic peptide (ANP), glucagon, somatostatin, cholecystokinin, gastrin, and leptins.
- Adhesion molecules relates to proteins which are located on the surface of a cell and which are involved in binding of the cell with other cells or with the extracellular matrix (ECM).
- Adhesion molecules are typically transmembrane receptors and can be classified as calcium-independent (e.g., integrins, immunoglobulin superfamily, lymphocyte homing receptors) and calcium-dependent (cadherins and selectins).
- Particular examples of adhesion molecules are integrins, lymphocyte homing receptors, selectins (e.g., P-selectin), and addressins.
- Integrins are also involved in signal transduction.
- integrins upon ligand binding, integrins modulate cell signaling pathways, e.g., pathways of transmembrane protein kinases such as receptor tyrosine kinases (RTK).
- RTK receptor tyrosine kinases
- integrins include: aibi, q ⁇ bi, o3 ⁇ 4bi, o ⁇ fi, a ⁇ bi, a 3 ⁇ 4 bi, a ? bi, ai$i, a M b2, ai3 ⁇ 4b3, a n bi, anb ⁇ , anb ⁇ , a n b&, anbb, and a 6 b4 ⁇
- immunoglobulins or “immunoglobulin superfamily” refers to molecules which are involved in the recognition, binding, and/or adhesion processes of cells. Molecules belonging to this superfamily share the feature that they contain a region known as immunoglobulin domain or fold.
- immunoglobulin superfamily include antibodies (e.g., IgG), T cell receptors (TCRs), major histocompatibility complex (MHC) molecules, co-receptors (e.g., CD4, CDS, CD19), antigen receptor accessory molecules (e.g., CD-3y, CD3-5, CD-3e, CD79a, CD79b), co-stimulatory or inhibitory molecules (e.g., CD28, CD80, CD86), and other.
- antibodies e.g., IgG
- T cell receptors T cell receptors
- MHC major histocompatibility complex
- co-receptors e.g., CD4, CDS, CD19
- antigen receptor accessory molecules e.g., CD-3y, CD3-5, CD-3e, CD79a, CD79b
- co-stimulatory or inhibitory molecules e.g., CD28, CD80, CD86
- immunologically active compound relates to any compound altering an immune response, preferably by inducing and/or suppressing maturation of immune cells, inducing and/or suppressing cytokine biosynthesis, and/or altering humoral immunity by stimulating antibody production by B cells.
- Immunologically active compounds possess potent immunostimulating activity including, but not limited to, antiviral and antitumor activity, and can also down-regulate other aspects of the immune response, for example shifting the immune response away from a TH2 immune response, which is useful for treating a wide range of TH2 mediated diseases.
- Immunologically active compounds can be useful as vaccine adjuvants.
- immunologically active compounds include interleukins, colony stimulating factor (CSF), granulocyte colony stimulating factor (G-CSF), granulocyte- macrophage colony stimulating factor (GM-CSF), erythropoietin, tumor necrosis factor (TNF), interferons, integrins, addressins, selectins, homing receptors, and antigens, in particular tumor- associated antigens, pathogen-associated antigens (such as bacterial, parasitic, or viral antigens), allergens, and autoantigens.
- a preferred immunologically active compound is a vaccine antigen, i.e., an antigen whose inoculation into a subject induces an immune response.
- the "peptide or polypeptide comprising an epitope for inducing an immune response against an antigen in a subject” is also designated herein as "vaccine antigen", “peptide and protein antigen” or simply "antigen”.
- the RNA (in particular, mRNA) encoding vaccine antigen is a single-stranded, 5' capped mRNA that is translated into the respective protein upon entering cells of a subject being administered the RNA, e.g., antigen-presenting cells (APCs).
- APCs antigen-presenting cells
- the RNA (i) contains structural elements optimized for maximal efficacy of the RNA with respect to stability and translational efficiency (5' cap, 5' UTR, 3' UTR, poly(A) sequence); (ii) is modified for optimized efficacy of the RNA (e.g., increased translation efficacy, decreased immunogenicity, and/or decreased cytotoxicity) (e.g., by replacing (partially or completely, preferably completely) naturally occurring nucleosides (in particular cytidine) with synthetic nucleosides (e.g., modified nucleosides selected from the group consisting of pseudouridine (y), N 1 -methyl-pseudouridine (hi ⁇ y), and 5-methyl-uridine); and/or codon- optimization), or (iii) both (i) and (ii).
- (ii) is modified for optimized
- beta-S-ARCA(Dl) is utilized as specific capping structure at the 5'-end of the RNA.
- the 5’-UTR comprises the nucleotide sequence of SEQ ID NO: 12, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 12.
- the 3’-UTR comprises the nucleotide sequence of SEQ ID NO: 13, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 13.
- the poly(A) sequence is 110 nucleotides in length and consists of a stretch of 30 adenosine residues, followed by a 10 nucleotide linker sequence and another 70 adenosine residues. This poly(A) sequence was designed to enhance RNA stability and translational efficiency in dendritic cells.
- the poly(A) sequence comprises the nucleotide sequence of SEQ ID NO: 14, or a nucleotide sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the nucleotide sequence of SEQ ID NO: 14.
- the RNA comprises a modified nucleoside in place of uridine.
- the modified nucleoside replacing (partially or completely, preferably completely) uridine is selected from the group consisting of pseudouridine (y), N1 -methyl- pseudouridine (m 1 y), and 5 -methyl -uridine.
- the RNA encoding the vaccine antigen has a coding sequence (a) which is codon-optimized, (b) the G/C content of which is increased compared to the wild type coding sequence, or (c) both (a) and (b).
- the RNA encoding the vaccine antigen is expressed in cells of the subject to provide the vaccine antigen. In some embodiments, expression of the vaccine antigen is at the cell surface. In some embodiments, the vaccine antigen is presented in the context of MHC. In some embodiments, the RNA encoding the vaccine antigen is transiently expressed in cells of the subject. In some embodiments, the RNA encoding the vaccine antigen is administered systemically. In some embodiments, after systemic administration of the RNA encoding the vaccine antigen, expression of the RNA encoding the vaccine antigen in spleen occurs.
- RNA encoding the vaccine antigen after systemic administration of the RNA encoding the vaccine antigen, expression of the RNA encoding the vaccine antigen in antigen presenting cells, preferably professional antigen presenting cells occurs.
- the antigen presenting cells are selected from the group consisting of dendritic cells, macrophages and B cells.
- no or essentially no expression of the RNA encoding the vaccine antigen in lung and/or liver occurs.
- expression of the RNA encoding the vaccine antigen in spleen is at least 5 -fold the amount of expression in lung.
- the vaccine antigen comprises an epitope for inducing an immune response against an antigen in a subject.
- the vaccine antigen comprises an antigenic sequence for inducing an immune response against an antigen in a subject.
- Such antigenic sequence may correspond to a target antigen or disease-associated antigen, e.g., a protein of an infectious agent (e.g., viral or bacterial antigen) or tumor antigen, or may correspond to an immunogenic variant thereof, or an immunogenic fragment of the target antigen or disease-a ssociated antigen or the immunogenic variant thereof.
- the antigenic sequence may comprise at least an epitope of a target antigen or di sease-associated antigen or an immunogenic variant thereof.
- the antigenic sequences e.g., epitopes, suitable for use according to the disclosure typically may be derived from a target antigen, i.e. the antigen against which an immune response is to be elicited.
- a target antigen i.e. the antigen against which an immune response is to be elicited.
- the antigenic sequences contained within the vaccine antigen may be a target antigen or a fragment or variant of a target antigen.
- the antigenic sequence or a procession product thereof may bind to the antigen receptor such as TCR or CAR carried by immune effector cells.
- the antigenic sequence is selected from the group consisting of the antigen expressed by a target cell to which the immune effector cells are targeted or a fragment thereof, or a variant of the antigenic sequence or the fragment.
- a vaccine antigen which may be provided to a subject according to the present disclosure by administering RNA encoding the vaccine antigen preferably results in the induction of an immune response, e.g., in the stimulation, priming and/or expansion of immune effector cells, in the subject being provided the vaccine antigen.
- Said immune response e.g., stimulated, primed and/or expanded immune effector cells, is preferably directed against a target antigen, in particular a target antigen expressed by diseased cells, tissues and/or organs, i.e., a disease-associated antigen.
- a vaccine antigen may comprise the disease-associated antigen, or a fragment or variant thereof. In some embodiments, such fragment or variant is immunologically equivalent to the disease-associated antigen.
- fragment of an antigen or “variant of an antigen” means an agent which results in the induction of an immune response, e.g., in the stimulation, priming and/or expansion of immune effector cells, which immune response, e.g., stimulated, primed and/or expanded immune effector cells, targets the antigen, i.e. a disease-associated antigen, in particular when presented by diseased cells, tissues and/or organs.
- the vaccine antigen may correspond to or may comprise the disease-associated antigen, may correspond to or may comprise a fragment of the disease- associated antigen or may correspond to or may comprise an antigen which is homologous to the disease- associated antigen or a fragment thereof.
- the vaccine antigen comprises a fragment of the disease- associated antigen or an amino acid sequence which is homologous to a fragment of the disease- associated antigen
- said fragment or amino acid sequence may comprise an epitope of the disease- associated antigen to which the antigen receptor of the immune effector cells is targeted or a sequence which is homologous to an epitope of the disease-associated antigen.
- a vaccine antigen may comprise an immunogenic fragment of a disease-associated antigen or an amino acid sequence being homologous to an immunogenic fragment of a disease-associated antigen.
- an "immunogenic fragment of an antigen” preferably relates to a fragment of an antigen which is capable of inducing an immune response against, e.g., stimulating, priming and/or expanding immune effector cells carrying an antigen receptor binding to, the antigen or cells expressing the antigen.
- the vaccine antigen (similar to the disease-associated antigen) provides the relevant epitope for binding by the antigen receptor present on the immune effector cells.
- the vaccine antigen or a fragment thereof is expressed on the surface of a cell such as an antigen-presenting cell (optionally in the context of MHC) so as to provide the relevant epitope for binding by immune effector cells.
- the vaccine antigen may be a recombinant antigen.
- the RNA encoding the vaccine antigen is expressed in cells of a subject to provide the antigen or a procession product thereof for binding by the antigen receptor expressed by immune effector cells, said binding resulting in stimulation, priming and/or expansion of the immune effector cells.
- An "antigen" according to the present disclosure covers any substance that will elicit an immune response and/or any substance against which an immune response or an immune mechanism such as a cellular response and/or humoral response is directed. This also includes situations wherein the antigen is processed into antigen peptides and an immune response or an immune mechanism is directed against one or more antigen peptides, in particular if presented in the context of MHC molecules.
- an "antigen” relates to any substance, such as a peptide or polypeptide, that reacts specifically with antibodies or T-lymphocytes (T-cells).
- the term "antigen” may comprise a molecule that comprises at least one epitope, such as a T cell epitope.
- an antigen is a molecule which, optionally after processing, induces an immune reaction, which may be specific for the antigen (including cells expressing the antigen).
- an antigen is a disease-associated antigen, such as a tumor antigen, a viral antigen, or a bacterial antigen, or an epitope derived from such antigen.
- an antigen is presented or present on the surface of cells of the immune system such as antigen presenting cells like dendritic cells or macrophages.
- An antigen or a procession product thereof such as a T cell epitope is in some embodiments bound by an antigen receptor. Accordingly, an antigen or a procession product thereof may react specifically with immune effector cells such as T- lymphocytes (T cells).
- autoantigen or "self-antigen” refers to an antigen which originates from within the body of a subject (i.e., the autoantigen can also be called “autologous antigen") and which produces an abnormally vigorous immune response against this normal part of the body. Such vigorous immune reactions against autoantigens may be the cause of "autoimmune diseases”.
- an antigen is expressed on the surface of a diseased cell (such as tumor cell or an infected cell).
- an antigen receptor is a CAR which binds to an extracellular domain or to an epitope in an extracellular domain of an antigen.
- a CAR binds to native epitopes of an antigen present on the surface of living cells.
- binding of a CAR when expressed by T cells and/or present on T cells to an antigen present on cells results in stimulation, priming and/or expansion of said T cells.
- binding of a CAR when expressed by T cells and/or present on T cells to an antigen present on diseased cells results in cytolysis and/or apoptosis of the diseased cells, wherein said T cells preferably release cytotoxic factors, e.g., perforins and granzymes.
- an amino acid sequence enhancing antigen processing and/or presentation is fused, either directly or through a linker, to an antigenic peptide or polypeptide (antigenic sequence).
- the RNA described herein comprises at least one coding region encoding an antigenic peptide or polypeptide and an amino acid sequence enhancing antigen processing and/or presentation.
- antigen for vaccination which may be administered in the form of RNA coding therefor comprises a naturally occurring antigen or a fragment such as an epitope thereof.
- amino acid sequences enhancing antigen processing and/or presentation are preferably located at the C-terminus of the antigenic peptide or polypeptide (and optionally at the C -terminus of an amino acid sequence which breaks immunological tolerance), without being limited thereto.
- Amino acid sequences enhancing antigen processing and/or presentation as defined herein preferably improve antigen processing and presentation.
- the amino acid sequence enhancing antigen processing and/or presentation as defined herein includes, without being limited thereto, sequences derived from the human MHC class I complex (HLA-B51 , haplotype A2, B27/B51, Cw2/Cw3), in particular a sequence comprising the amino acid sequence of SEQ ID NO: 36 or a functional variant thereof.
- a secretory sequence e.g., a sequence comprising the amino acid sequence of SEQ ID NO: 35, may be fused to the N-terminus of the antigenic peptide or polypeptide.
- an amino acid sequence enhancing antigen processing and/or presentation comprises the amino acid sequence of SEQ ID NO: 36, an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 36, or a functional fragment of the amino acid sequence of SEQ ID NO: 36, or the amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 36.
- an amino acid sequence enhancing antigen processing and/or presentation comprises the amino acid sequence of SEQ ID NO: 36.
- the RNA described herein comprises at least one coding region encoding an antigenic peptide or polypeptide and an amino acid sequence enhancing antigen processing and/or presentation, said amino acid sequence enhancing antigen processing and/or presentation preferably being fused to the antigenic peptide or polypeptide, more preferably to the C-terminus of the antigenic peptide or polypeptide as described herein.
- a secretory sequence e.g., a sequence comprising the amino acid sequence of SEQ ID NO: 35, may be fused to the N-terminus of the antigenic peptide or polypeptide.
- Amino acid sequences derived from tetanus toxoid of Clostridium tetani may be employed to overcome self-tolerance mechanisms in order to efficiently mount an immune response to self-antigens by providing T-cell help during priming.
- tetanus toxoid heavy chain includes epitopes that can bind promiscuously to MHC class II alleles and induce CD4 + memory T cells in almost all tetanus vaccinated individuals.
- TT tetanus toxoid
- p2 Q YI K ANSKFIG ITEL; TT 3 ⁇ 4 3o-844; SEQ ID NO: 40
- pi 6 MTNSVDDALINSTKIYSYFPSVISKVNQGAQG; TT578-609; SEQ ID NO: 41
- the p2 epitope was already used for peptide vaccination in clinical trials to boost anti-melanoma activity.
- Non-clinical data showed that RNA vaccines encoding both a tumor antigen plus promiscuously binding tetanus toxoid sequences lead to enhanced CD8' T-cell responses directed against the tumor antigen and improved break of tolerance.
- Immunomonitoring data from patients vaccinated with vaccines including those sequences fused in frame with the tumor antigen-specific sequences reveal that the tetanus sequences chosen are able to induce tetanus-specific T-cell responses in almost all patients.
- an amino acid sequence which breaks immunological tolerance is fused, either directly or through a linker, e.g., a linker having the amino acid sequence according to SEQ ID NO: 38, to the antigenic peptide or polypeptide.
- amino acid sequences which break immunological tolerance are preferably located at the C- terminus of the antigenic peptide or polypeptide (and optionally at the N -terminus of the amino acid sequence enhancing antigen processing and/or presentation, wherein the amino acid sequence which breaks immunological tolerance and the amino acid sequence enhancing antigen processing and/or presentation may be fused either directly or through a linker, e.g., a linker having the amino acid sequence according to SEQ ID NO: 39), without being limited thereto.
- Amino acid sequences which break immunological tolerance as defined herein preferably improve T cell responses.
- the amino acid sequence which breaks immunological tolerance as defined herein includes, without being limited thereto, sequences derived from tetanus toxoid-derived helper sequences p2 and pl6 (P2P 16), in particular a sequence comprising the amino acid sequence of SEQ ID NO: 37 or a functional variant thereof.
- an amino acid sequence which breaks immunological tolerance comprises the amino acid sequence of SEQ ID NO: 37, an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 37, ora functional fragment of the amino acid sequence of SEQ ID NO: 37, or the amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of SEQ ID NO: 37.
- an amino acid sequence which breaks immunological tolerance comprises the amino acid sequence of SEQ ID NO: 37.
- cap 5 '-cap structure selected from the group consisting of m2 7 2 °G(5 ’ )ppSp(5 ')G (in particular its D1 diastereomer), m 2 7 ’ 30 G(5')ppp(5')G, and m2 73 '0 Gppp(mi 2'" °)ApG.
- hAg-Kozak 5'-UTR sequence of the human alpha-globin niRNA with an optimized ‘Kozak sequence’ to increase translational efficiency.
- sec/MITD Fusion-protein tags derived from the sequence encoding the human MHC class I complex (HLA-B51 , haplotype A2, B27/B51 , Cw2/Cw3), which have been shown to improve antigen processing and presentation.
- Sec corresponds to the 78 bp fragment coding for the secretory signal peptide, which guides translocation of the nascent polypeptide chain into the endoplasmatic reticulum.
- MITD corresponds to the transmembrane and cytoplasmic domain of the MHC class 1 molecule, also called MHC class I trafficking domain.
- Antigen Sequences encoding the respective vaccine antigen/epitope.
- Glycine-serine linker (GS): Sequences coding for short peptide linkers predominantly consisting of the amino acids glycine (G) and serine (S), as commonly used for fusion proteins.
- P2P16 Sequence coding for tetanus toxoid-derived helper epitopes to break immunological tolerance.
- the 3'-UTR is a combination of two sequence elements derived from the “amino terminal enhancer of split” (AES) mRNA (called F) and the mitochondrial encoded 12S ribosomal RNA (called I). These were identified by an ex vivo selection process for sequences that confer RNA stability and augment total protein expression.
- AES amino terminal enhancer of split
- A30L70 A poly(A)-tail measuring 110 nucleotides in length, consisting of a stretch of 30 adenosine residues, followed by a 10 nucleotide linker sequence and another 70 adenosine residues designed to enhance RNA stability and translational efficiency in dendritic cells.
- vaccine RNA described herein has one of the following structures: cap-hAg-Kozak-sec-GS(l)-Antigen-GS(2)-P2P16-GS(3)-MITD-FI-A30L70 beta-S-ARCA(Dl)-hAg-Kozak-sec-GS(l)-Antigen-GS(2)-P2P16-GS(3)-MITD-FI-A30L70
- vaccine antigen described herein has the structure: sec-GS(l )-Antigen-GS(2)-P2P 16-GS(3)-MITD
- hAg-Kozak comprises the nucleotide sequence of SEQ ID NO: 12.
- sec comprises the amino acid sequence of SEQ ID NO: 35.
- P2P16 comprises the amino acid sequence of SEQ ID NO: 37.
- MITD comprises the amino acid sequence of SEQ ID NO: 36.
- GS(1) comprises the amino acid sequence of SEQ ID NO: 38.
- GS(2) comprises the amino acid sequence of SEQ ID NO: 39.
- GS(3) comprises the amino acid sequence of SEQ ID NO: 39.
- FI comprises the nucleotide sequence of SEQ ID NO: 13.
- A30L70 comprises the nucleotide sequence of SEQ ID NO: 14.
- the sequence encoding the vaccine antigen/epitope comprises a modified nucleoside replacing (partially or completely, preferably completely) uridine, wherein the modified nucleoside is selected from the group consisting of pseudouridine (y), N 1 -methyl-pseudouridine (m 1 y), and 5-methyl-uridine.
- the sequence encoding the vaccine antigen/epitope is codon-optimized.
- the G/C content of the sequence encoding the vaccine antigen/epitope is increased compared to the wild type coding sequence.
- the term "professional antigen presenting cells” relates to antigen presenting cells which constitutively express the Major Histocompatibility Complex class II (MHC class II) molecules required for interaction with naive T cells. If a T cell interacts with the MHC class II molecule complex on the membrane of the antigen presenting cell, the antigen presenting cell produces a co-stimulatory molecule inducing activation of the T cell.
- Professional antigen presenting cells comprise dendritic cells and macrophages.
- non-professional antigen presenting cells relates to antigen presenting cells which do not constitutively express MHC class II molecules, but upon stimulation by certain cytokines such as interferon-gamma.
- exemplary, non-professional antigen presenting cells include fibroblasts, thymic epithelial cells, thyroid epithelial cells, glial cells, pancreatic beta cells or vascular endothelial cells.
- dendritic cell refers to a subtype of phagocytic cells belonging to the class of antigen presenting cells.
- dendritic cells are derived from hematopoietic bone marrow progenitor cells. These progenitor cells initially transform into immature dendritic cells. These immature cells are characterized by high phagocytic activity and low T cell activation potential. Immature dendritic cells constantly sample the surrounding environment for pathogens such as viruses and bacteria. Once they have come into contact with a presentable antigen, they become activated into mature dendritic cells and begin to migrate to the spleen or to the lymph node.
- Immature dendritic cells phagocytose pathogens and degrade their proteins into small pieces and upon maturation present those fragments at their cell surface using MHC molecules. Simultaneously, they upregulate cell-surface receptors that act as co-receptors in T cell activation such as CD80, CD86, and CD40 greatly enhancing their ability to activate T cells. They also upregulate CCR7, a chemotactic receptor that induces the dendritic cell to travel through the blood stream to the spleen or through the lymphatic system to a lymph node. Here they act as antigen-presenting cells and activate helper T cells and killer T cells as well as B cells by presenting them antigens, alongside non-antigen specific co-stimulatory signals. Thus, dendritic cells can actively induce a T cell- or B cell-related immune response. In some embodiments, the dendritic cells are splenic dendritic cells.
- macrophage refers to a subgroup of phagocytic cells produced by the differentiation of monocytes. Macrophages which are activated by inflammation, immune cytokines or microbial products nonspecifically engulf and kill foreign pathogens within the macrophage by hydrolytic and oxidative attack resulting in degradation of the pathogen. Peptides from degraded proteins are displayed on the macrophage cell surface where they can be recognized by T cells, and they can directly interact with antibodies on the B cell surface, resulting in T and B cell activation and further stimulation of the immune response. Macrophages belong to the class of antigen presenting cells. In some embodiments, the macrophages are splenic macrophages.
- allergen refers to a kind of antigen which originates from outside the body of a subject (i.e., the allergen can also be called “heterologous antigen”) and which produces an abnormally vigorous immune response in which the immune system of the subject fights off a perceived threat that would otherwise be harmless to the subject.
- allergen usually is an antigen which is able to stimulate a type-I hypersensitivity reaction in atopic individuals through immunoglobulin E (IgE) responses.
- IgE immunoglobulin E
- allergens include allergens derived from peanut proteins ⁇ e.g., Ara h 2.02), ovalbumin, grass pollen proteins (e.g., Phi p 5), and proteins of dust mites (e.g., Der p 2).
- growth factors refers to molecules which are able to stimulate cellular growth, proliferation, healing, and/or cellular differentiation. Typically, growth factors act as signaling molecules between cells.
- growth factors include particular cytokines and hormones which bind to specific receptors on the surface of their target cells.
- growth factors examples include bone morphogenetic proteins (BMPs), fibroblast growth factors (FGFs), vascular endothelial growth factors (VEGFs), such as VEGFA, epidermal growth factor (EGF), insulin-like growth factor, ephrins, macrophage colony- stimulating factor, granulocyte colony-stimulating factor, granulocyte macrophage colony-stimulating factor, neuregulins, neurotrophins (e.g., brain-derived neurotrophic factor (BDNF), nerve growth factor (NGF)), placental growth factor (PGF), platelet-derived growth factor (PDGF), renalase (RNLS) (anti- apoptotic survival factor), T-cell growth factor (TCGF), thrombopoietin (TPO), transforming growth factors (transforming growth factor alpha (TGF-a), transforming growth factor beta (TGF-b)), and tumor necrosis factor-alpha (TNF-a).
- BMPs bone morphogenetic proteins
- protease inhibitors refers to molecules, in particular peptides or proteins, which inhibit the function of proteases.
- Protease inhibitors can be classified by the protease which is inhibited (e.g., aspartic protease inhibitors) or by their mechanism of action (e.g., suicide inhibitors, such as serpins).
- protease inhibitors include serpins, such as alpha 1 -antitrypsin, aprotinin, and bestatin.
- enzymes refers to macromolecular biological catalysts which accelerate chemical reactions. Like any catalyst, enzymes are not consumed in the reaction they catalyze and do not alter the equilibrium of said reaction. Unlike many other catalysts, enzymes are much more specific.
- an enzyme is essential for homeostasis of a subject, e.g., any malfunction (in particular, decreased activity which may be caused by any of mutation, deletion or decreased production) of the enzyme results in a disease.
- examples of enzymes include herpes simplex virus type 1 thymidine kinase (HSV1-TK), hexosaminidase, phenylalanine hydroxylase, pseudocholinesterase, and lactase.
- receptors refers to protein molecules which receive signals (in particular chemical signals called ligands) from outside a cell.
- signals in particular chemical signals called ligands
- the binding of a signal (e.g., ligand) to a receptor causes some kind of response of the cell, e.g., the intracellular activation of a kinase.
- Receptors include transmembrane receptors (such as ion channel-linked (ionotropic) receptors, G protein-linked (metabotropic) receptors, and enzyme-linked receptors) and intracellular receptors (such as cytoplasmic receptors and nuclear receptors).
- receptors include steroid hormone receptors, growth factor receptors, and peptide receptors (i.e., receptors whose ligands are peptides), such as P-selectin glycoprotein ligand- 1 (PSGL-1).
- PSGL-1 P-selectin glycoprotein ligand- 1
- growth factor receptors refers to receptors which bind to growth factors.
- apoptosis regulators refers to molecules, in particular peptides or proteins, which modulate apoptosis, i.e., which either activate or inhibit apoptosis.
- Apoptosis regulators can be grouped into two broad classes: those which modulate mitochondrial function and those which regulate caspases.
- the first class includes proteins (e.g., BCL-2, BCL-xL) which act to preserve mitochondrial integrity by preventing loss of mitochondrial membrane potential and/or release of pro-apoptotic proteins such as cytochrome C into the cytosol.
- proapoptotic proteins e.g., BAX, BAK, BGM
- the second class includes proteins such as the inhibitors of apoptosis proteins (e.g., XIAJP) or FLIP which block the activation of caspases.
- transcription factors relates to proteins which regulate the rate of transcription of genetic information from DNA to messenger RNA, in particular by binding to a specific DNA sequence. Transcription factors may regulate cell division, cell growth, and cell death throughout life; cell migration and organization during embryonic development; and/or in response to signals from outside the cell, such as a hormone. Transcription factors contain at least one DNA-binding domain which binds to a specific DNA sequence, usually adjacent to the genes which are regulated by the transcription factors. Particular examples of transcription factors include MECP2, FOXP2, FOXP3, the STAT protein family, and the HOX protein family.
- tumor suppressor proteins relates to molecules, in particular peptides or proteins, which protect a cell from one step on the path to cancer.
- Tumor-suppressor proteins (usually encoded by corresponding tumor-suppressor genes) exhibit a weakening or repressive effect on the regulation of the cell cycle and/or promote apoptosis.
- Their functions may be one or more of the following: repression of genes essential for the continuing of the cell cycle; coupling the cell cycle to DNA damage (as long as damaged DNA is present in a cell, no cell division should take place); initiation of apoptosis, if the damaged DNA cannot be repaired; metastasis suppression (e.g., preventing tumor cells from dispersing, blocking loss of contact inhibition, and inhibiting metastasis); and DNA repair.
- tumor-suppressor proteins include p53, phosphatase and tensin homolog (PTEN), SWI/SNF (SWItch/Sucrose Non-Fermentable), von Hippel Lindau tumor suppressor (pVFIL), adenomatous polyposis coli (APC), CD95, suppression of tumorigenicity 5 (STS), suppression of tumorigenicity 5 (ST5), suppression of tumorigenicity 14 (STM), and Yippee-like 3 (YPEL3).
- PTEN phosphatase and tensin homolog
- SWI/SNF SWI/SNF
- pVFIL von Hippel Lindau tumor suppressor
- APC adenomatous polyposis coli
- CD95 suppression of tumorigenicity 5
- ST5 suppression of tumorigenicity 5
- STM suppression of tumorigenicity 14
- YPEL3 Yippee-like 3
- structural proteins refers to proteins which confer stiffness and rigidity to otherwise-fluid biological components. Structural proteins are mostly fibrous (such as collagen and elastin) but may also be globular (such as actin and tubulin). Usually, globular proteins are soluble as monomers, but polymerize to form long, fibers which, for example, may make up the cytoskeleton. Other structural proteins are motor proteins (such as myosin, kinesin, and dynein) which are capable of generating mechanical forces, and surfactant proteins. Particular examples of structural proteins include collagen, surfactant protein A, surfactant protein B, surfactant protein C, surfactant protein D, elastin, tubulin, actin, and myosin.
- reprogramming factors or "reprogramming transcription factors” relates to molecules, in particular peptides or proteins, which, when expressed in somatic cells optionally together with further agents such as further reprogramming factors, lead to reprogramming or de-differentiation of said somatic cells to cells having stem cell characteristics, in particular pluripotency.
- reprogramming factors include OCT4, SOX2, c-MYC, KLF4, LIN28, and NANOG.
- genomic engineering proteins relates to proteins which are able to insert, delete or replace DNA in the genome of a subject.
- genomic engineering proteins include meganucleases, zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), and clustered regularly spaced short palindromic repeat-CRISPR-associated protein 9 (CRISPR-Cas9).
- blood proteins relates to peptides or proteins which are present in blood plasma of a subject, in particular blood plasma of a healthy subject.
- Blood proteins have diverse functions such as transport (e.g., albumin, transferrin), enzymatic activity (e.g ., thrombin or ceruloplasmin), blood clotting (e.g., fibrinogen), defense against pathogens (e.g., complement components and immunoglobulins), protease inhibitors (e.g., alpha 1 -antitrypsin), etc.
- blood proteins include thrombin, serum albumin, Factor VII, Factor VIII, insulin, Factor IX, Factor X, tissue plasminogen activator, protein C, von Willebrand factor, antithrombin III, glucocerebrosidase, erythropoietin, granulocyte colony stimulating factor (G-CSF), modified Factor VIII, and anticoagulants.
- the pharmaceutically active peptide or protein is (i) a cytokine, preferably selected from the group consisting of erythropoietin (EPO), interleukin 4 (IL-2), and interleukin 10 (IL- 11), more preferably EPO; (ii) an adhesion molecule, in particular an integral ; (iii) an immunoglobulin, in particular an antibody; (iv) an immunologically active compound, in particular an antigen, such as a viral or bacterial antigen, e.g., an antigen of SARS-CoV-2; (v) a hormone, in particular vasopressin, insulin or growth hormone; (vi) a growth factor, in particular VEGFA; (vii) a protease inhibitor, in particular alpha 1 -antitrypsin; (viii) an enzyme, preferably selected from the group consisting of herpes simplex virus type 1 thymidine kinase (HSV1-TK), hex
- a pharmaceutically active peptide or protein comprises one or more antigens or one or more epitopes, /. ⁇ ?., administration ofthe peptide or protein to a subject elicits an immune response against the one or more antigens or one or more epitopes in a subject which may be therapeutic or partially or fully protective.
- the RNA (preferably mRNA) encodes at least one epitope, e.g., at least two epitopes, at least three epitopes, at least four epitopes, at least five epitopes, at least six epitopes, at least seven epitopes, at least eight epitopes, at least nine epitopes, or at least ten epitopes.
- the target antigen is a tumor antigen and the antigenic sequence (e.g., an epitope) is derived from the tumor antigen.
- the tumor antigen may be a "standard" antigen, which is generally known to be expressed in various cancers.
- the tumor antigen may also be a "neo-antigen", which is specific to an individual’ s tumor and has not been previously recognized by the immune system.
- a neo-antigen or neo-epitope may result from one or more cancer-specific mutations in the genome of cancer cells resulting in amino acid changes.
- the vaccine antigen preferably comprises an epitope or a fragment of said neo-antigen comprising one or more amino acid changes.
- tumor antigens include, without limitation, p53, ART-4, BAGE, beta-catenin/m, Bcr-abL CAMEL, CAP-1 , CASP-8, CDC27/m, CDK4/m, CEA, the cell surface proteins of the claudin family, such as CLAUDIN -6, CLAUDIN-18,2 and CLAUDIN-12, c-MYC, CT, Cyp-B, DAM, ELF2M, ETV6- AMLl, G250, GAGE, GnT-V, Gap 100, HAGE, HER-2/neu, HPV-E7, HPV-E6, HAST-2, hTERT (or hTRT), LAGE, LDLR/FUT, MAGE-A, preferably MAGE-A1 , MAGE-A2, MAGE- A3, MAGE-A4, MAGE-A5, MAGE-A6, MAGE-A7, MAGE-A8, MAGE-A9, MAGE-A 10, MAGE-A 1 1,
- Dendritic cells (DCs) residing in the spleen represent antigen-presenting cells of particular interest for RNA expression of immunogenic epitopes or antigens such as tumor epitopes. The use of multiple epitopes has been shown to promote therapeutic efficacy in tumor vaccine compositions.
- Rapid sequencing of the tumor mutanome may provide multiple epitopes for individualized vaccines which can be encoded by RNA (in particular mRNA) described herein, e.g., as a single polypeptide wherein the epitopes are optionally separated by linkers.
- the RNA in particular mRNA
- the RNA encodes at least one epitope, at least two epitopes, at least three epitopes, at least four epitopes, at least five epitopes, at least six epitopes, at least seven epitopes, at least eight epitopes, at least nine epitopes, or at least ten epitopes.
- Exemplary embodiments include RNA (in particular, mRNA) that encodes at least five epitopes (termed a "pentatope") and RNA (in particular, mRNA) that encodes at least ten epitopes (termed a "decatope”).
- the epitope is derived from a pathogen-associated antigen, .
- the pharmaceutically active polypeptide and/or the antigen or epitope is derived from or is a protein of a pathogen, an immunogenic variant of the protein, or an immunogenic fragment of the protein or the immunogenic variant thereof.
- the pathogen is selected from viruses, bacteria, fungi, parasites, and other microorganisms.
- viruses include, but are not limited to, are severe acute respiratory syndrome coronavirus (SARS-CoV), such as SARS-CoV2, human immunodeficiency virus (HIV), Epstein-Barr virus (EBV), cytomegalovirus (CMV) (e.g., CMV5), human herpesviruses (HHV) (e.g., HHV6, 7 or 8), herpes simplex viruses (HSV), bovine herpes virus (BHV) (e.g., BHV4), equine herpes virus (EHV) (e.g., EHV2), human T-Cell leukemia viruses (HTLV)5, Varicella-Zoster virus (VZV), measles virus, papovaviruses (JC and BK), hepatitis viruses (e.g., HBV or HCV), myxoma virus, adenoviruses, rhinoviruses, enteroviruses, parvoviruses, polyoma
- Exemplary diseases caused by viral infection include, but are not limited to, SARS, acquired immune deficiency syndrome (AIDS), measles, chicken pox, cytomegalovirus infections, genital herpes, hepatitis (such as hepatitis B or C), influenza (flu, such as human flu, swine flu, dog flu, horse flu, and avian flu), HPV infection, shingles, rabies, common cold, gastroenteritis, rubella, and mumps.
- SARS acquired immune deficiency syndrome
- AIDS acquired immune deficiency syndrome
- measles such as hepatitis B or C
- influenza flu, such as human flu, swine flu, dog flu, horse flu, and avian flu
- HPV infection shingles, rabies, common cold, gastroenteritis, rubella, and mumps.
- Exemplary bacteria include, but are not limited to, Campylobacter (such as Campylobacter jejuni), Enterobacter species, Enterococcus faecium, Enterococcus faecalis, Escherichia coli (e.g., F. coli 0157:H7), Group A streptococci, Haemophilus influenzae, Helicobacter pylori, listeria, Mycobacterium tuberculosis, Pseudomonas aeruginosa, S.
- Campylobacter such as Campylobacter jejuni
- Enterobacter species Enterococcus faecium
- Enterococcus faecalis Enterococcus faecalis
- Escherichia coli e.g., F. coli 0157:H7
- Group A streptococci Haemophilus influenzae
- Helicobacter pylori listeria
- pneumoniae Salmonella, Shigella, Staphylococcus aureus, Staphylococcus epidermidis, Borrelia and Rickettsia, Chlamydiaceae, Neisseria gonorrhoeae, Bordetella pertussis, Clostridium tetani, Neisseria meningitidis, Streptococcus (such as Streptococcus pneumoniae or Streptococcus pyogenes), and Treponema pallidum.
- Exemplary diseases caused by bacterial infection include, but are not limited to, anthrax, cholera, diphtheria, foodbome illnesses, leprosy, meningitis, peptic ulcer disease, pneumonia, sepsis, septic shock, tetanus, tuberculosis, typhoid fever, urinary tract infection, Lyme disease, Rocky Mountain spotted fever, chlamydia, gonorrhea, pertussis, tetanus, meningitis, scarlet fever, and syphilis.
- Exemplary parasites include, but are not limited to, Plasmodium, Trypanosoma, Leishmania, Trichomonas, Dientamoeba, Giardia, Entamoeba histolytica, Naegleria, Isospora, Toxoplasma, Sarcocystis, Rhinosporidium seeberi, and Balantidium.
- Exemplary diseases caused by parasite infection include, but are not limited to, malaria, trypanosomiasis, Chagas disease, leishmaniasis, trichomoniasis, proamoebiasis, giardiasis, amebic dysentery, coccidiosis, toxoplasmosis, sarcocystosis, rhinosporidiosis, and balantidiasis.
- the pathogen is an infectious pathogen, in particular a pathogen causing an infectious disease, such as a viral disease, a bacterial disease, or a parasitic disease.
- the pathogen is a virus, bacterium, or parasite.
- the RNA (in particular mRNA) and/or compositions described herein can be used to prevent and/or treat an infectious disease caused by said pathogen.
- the epitope is derived from a viral antigen.
- the antigen or epitope is derived from a coronavirus protein, an immunogenic variant thereof, or an immunogenic fragment of the coronavirus protein or the immunogenic variant thereof.
- the mRNA used in the present disclosure encodes an amino acid sequence comprising a coronavirus protein, an immunogenic variant thereof, or an immunogenic fragment of the coronavirus protein or the immunogenic variant thereof.
- the antigen or epitope is derived from a coronavirus S protein, an immunogenic variant thereof, or an immunogenic fragment of the coronavirus S protein or the immunogenic variant thereof.
- the RNA (in particular, mRNA) described in the present disclosure encodes an amino acid sequence comprising a coronavirus S protein, an immunogenic variant thereof, or an immunogenic fragment of the coronavirus S protein or the immunogenic variant thereof.
- the coronavirus is MERS-CoV.
- the coronavirus is SARS-CoV.
- the coronavirus is SARS-CoV -2.
- Coronaviruses are enveloped, positive-sense, single-stranded RNA ((+) ssRNA) viruses. They have the largest genomes (26-32 kb) among known RNA viruses and are phylogenetically divided into four genera (a, b, g, and d), with betacoronaviruses further subdivided into four lineages (A, B, C, and D). Coronaviruses infect a wide range of avian and mammalian species, including humans. Some human coronaviruses generally cause mild respiratory diseases, although severity can be greater in infants, the elderly, and the immunocompromised.
- SARS-CoV-2 severe acute respiratory syndrome coronavirus-2
- SARS-CoV-2 SARS-CoV-2
- MN908947.3 belongs to betacoronavirus lineage B. It has at least 70% sequence similarity to SARS-CoV.
- coronaviruses have four structural proteins, namely, envelope (E), membrane (M), nucleocapsid (N), and spike (S).
- E and M proteins have important functions in the viral assembly, and the N protein is necessary for viral RNA synthesis.
- the critical glycoprotein S is responsible for virus binding and entry into target cells.
- the S protein is synthesized as a single-chain inactive precursor that is cleaved by furin-like host proteases in the producing cell into two noncovalently associated subunits, SI and S2.
- the SI subunit contains the receptor-binding domain (RBD), which recognizes the host-cell receptor.
- the S2 subunit contains the fusion peptide, two heptad repeats, and a transmembrane domain, all of which are required to mediate fusion of the viral and host-cell membranes by undergoing a large conformational rearrangement.
- the SI and S2 subunits trimerize to form a large prefusion spike.
- the S precursor protein of SARS-CoV-2 can be proteolytically cleaved into SI (685 aa) and S2 (588 aa) subunits.
- SI subunit comprises the receptor-binding domain (RBD), which mediates virus entry into sensitive cells through the host angiotensin-converting enzyme 2 (ACE2) receptor.
- RBD receptor-binding domain
- ACE2 angiotensin-converting enzyme 2
- the antigen or epitope is derived from a SARS-CoV-2 S protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof.
- the RNA (preferably mRNA) described in the present disclosure encodes an amino acid sequence comprising a SARS-CoV-2 S protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof.
- the encoded amino acid sequence comprises an epitope of SARS-CoV-2 S protein or an immunogenic variant thereof for inducing an immune response against coronavirus S protein, in particular SARS-CoV-2 S protein in a subject.
- the RNA (preferably mRNA) comprises an ORF encoding a full-length SARS-CoV2 S protein variant with proline residue substitutions at positions 986 and 987 of SEQ ID NO:l.
- the SARS-CoV 2 S protein variant has at least 80% identity (such as at least 85% identity, at least 90% identity, at least 91% identity, at least 92% identity, at least 93% identity, at least 94% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, or at least 99% identity) to SEQ ID NO:7.
- RNA in particular, mRNA
- an immune response e.g., antibodies and/or immune effector cells, which is targeted to target antigen (coronavirus S protein, in particular SARS-CoV-2 S protein) or a procession product thereof.
- the immune response which is to be induced according to the present disclosure is a B cell-mediated immune response, i.e., an antibody- mediated immune response.
- the immune response which is to be induced according to the present disclosure is a T cell-mediated immune response.
- the immune response is an anti-coronavirus, in particular anti-SARS-CoV-2 immune response.
- an immunogenic fragment of the SARS-CoV-2 S protein comprises the SI subunit of the SARS-CoV-2 S protein, or the receptor binding domain (RBD) of the SI subunit of the SARS-CoV-2 S protein.
- the RNA e.g., mRNA
- the RNA described in the present disclosure comprises an open reading frame encoding a polypeptide that comprises a receptor-binding portion of a SARS-CoV-2 S protein, which RNA is suitable for intracellular expression of the polypeptide.
- such an encoded polypeptide does not comprise the complete S protein.
- the encoded polypeptide comprises the receptor binding domain (RBD), for example, as shown in SEQ ID NO: 5.
- the encoded polypeptide comprises the peptide according to SEQ ID NO: 29 or 31.
- SARS-CoV-2 coronavirus full length spike (S) protein consist of 1273 amino acids and has the following amino acid sequence shown in SEQ ID NO: 1.
- amino acid sequence shown in SEQ ID NO: 1 is considered the wildtype SARS-CoV-2 S protein amino acid sequence.
- Position numberings in SARS-CoV-2 S protein given herein are in relation to the amino acid sequence according to SEQ ID NO: 1 and corresponding positions in SARS-CoV-2 S protein variants.
- full length spike (S) protein according to SEQ ID NO: 1 is modified in such a way that the prototypical prefusion conformation is stabilized. Stabilization of the prefusion conformation may be obtained by introducing two consecutive proline substitutions at amino acid residues 986 and 987 in the full-length spike protein.
- spike (S) protein stabilized protein variants are obtained in a way that the amino acid residue at position 986 is exchanged to proline and the amino acid residue at position 987 is also exchanged to proline.
- a SARS- CoV-2 S protein variant wherein the prototypical prefusion conformation is stabilized comprises the amino acid sequence shown in SEQ ID NO: 7.
- RNA in particular, mRNA described herein ⁇ e.g., contained in the compositions of the present disclosure and/or used in the methods of the present disclosure) encodes an amino acid sequence which comprises, consists essentially of or consists of a spike (S) protein of SARS-CoV-2, a variant thereof, or a fragment thereof.
- S spike
- the amino acid sequence of amino acids 327 to 528 of SEQ ID NO: 1, a variant thereof, or a fragment thereof is also referred to herein as "RBD" or "RBD domain".
- the amino acid sequence comprising a SARS-CoV-2 S protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof is able to form a multimeric complex, in particular a trimeric complex.
- the amino acid sequence comprising a SARS-CoV-2 S protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof may comprise a domain allowing the formation of a multimeric complex, in particular a trimeric complex of the amino acid sequence comprising a SARS-CoV-2 S protein, an immunogenic variant thereof, or an immunogenic fragment of the SARS-CoV-2 S protein or the immunogenic variant thereof.
- the domain allowing the formation of a multimeric complex comprises a trimerization domain, for example, a trimerization domain as described herein.
- the trimerization domain is fused, either directly or through a linker, e.g., a glycine/serine linker, to a SARS-CoV-2 S protein, a variant thereof, or a fragment thereof, i.e., the antigenic peptide or protein.
- a trimerization domain is fused to the above described amino acid sequences derived from SARS-CoV-2 S protein or immunogenic fragments thereof (antigenic peptides or proteins) comprised by the encoded amino acid sequences described above (which may optionally be fused to a signal peptide as described above).
- trimerization domains are preferably located at the C-terminus of the antigenic peptide or protein, without being limited thereto.
- Trimerization domains as defined herein preferably allow the trimerization of the antigenic peptide or protein as encoded by the RNA.
- trimerization domains as defined herein include, without being limited thereto, foldon, the natural trimerization domain of T4 fibritin.
- the C -terminal domain of T4 fibritin (foldon) is obligatory for the formation of the fibritin trimer structure and can be used as an artificial trimerization domain.
- the trimerization domain as defined herein includes, without being limited thereto, a sequence comprising the amino acid sequence of SEQ ID NO: 10 or a functional variant thereof.
- the trimerization domain as defined herein includes, without being limited thereto, a sequence comprising the amino acid sequence of amino acids 3 to 29 of SEQ ID NO: 10 or a functional variant thereof. In one embodiment, the trimerization domain as defined herein includes, without being limited thereto, a sequence comprising the amino acid sequence of SEQ ED NO: 10 or a functional variant thereof.
- a trimerization domain comprises the amino acid sequence of amino acids 3 to 29 of SEQ ID NO: 10, an amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of amino acids 3 to 29 of SEQ ID NO: 10, or a functional fragment of the amino acid sequence of amino acids 3 to 29 of SEQ ID NO: 10, or the amino acid sequence having at least 99%, 98%, 97%, 96%, 95%, 90%, 85%, or 80% identity to the amino acid sequence of amino acids 3 to 29 of SEQ ID NO: 10, In some embodiments, a trimerization domain comprises the amino acid sequence of amino acids 3 to 29 of SEQ ID NO: 10.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Oil, Petroleum & Natural Gas (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Virology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Physics & Mathematics (AREA)
- Biomedical Technology (AREA)
- Nanotechnology (AREA)
- Optics & Photonics (AREA)
- Oncology (AREA)
- Communicable Diseases (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US18/554,947 US20240226132A1 (en) | 2021-04-12 | 2022-04-11 | Rna compositions comprising a buffer substance and methods for preparing, storing and using the same |
| AU2022256732A AU2022256732A1 (en) | 2021-04-12 | 2022-04-11 | Rna compositions comprising a buffer substance and methods for preparing, storing and using the same |
| CA3215103A CA3215103A1 (en) | 2021-04-12 | 2022-04-11 | Rna compositions comprising a buffer substance and methods for preparing, storing and using the same |
| CN202280041220.1A CN117615752A (zh) | 2021-04-12 | 2022-04-11 | 包含缓冲物质的rna组合物及其制备、储存和使用方法 |
| JP2024505491A JP2024514364A (ja) | 2021-04-12 | 2022-04-11 | 緩衝物質を含むrna組成物ならびにその製造、保存および使用のための方法 |
| EP22719594.8A EP4322925A2 (en) | 2021-04-12 | 2022-04-11 | Rna compositions comprising a buffer substance and methods for preparing, storing and using the same |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EPPCT/EP2021/059460 | 2021-04-12 | ||
| PCT/EP2021/059460 WO2022218503A1 (en) | 2021-04-12 | 2021-04-12 | Lnp compositions comprising rna and methods for preparing, storing and using the same |
| EPPCT/EP2021/087882 | 2021-12-30 | ||
| EP2021087882 | 2021-12-30 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2022218891A2 true WO2022218891A2 (en) | 2022-10-20 |
| WO2022218891A3 WO2022218891A3 (en) | 2022-11-24 |
Family
ID=81393053
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2022/059555 Ceased WO2022218891A2 (en) | 2021-04-12 | 2022-04-11 | Rna compositions comprising a buffer substance and methods for preparing, storing and using the same |
Country Status (6)
| Country | Link |
|---|---|
| US (1) | US20240226132A1 (https=) |
| EP (1) | EP4322925A2 (https=) |
| JP (1) | JP2024514364A (https=) |
| AU (1) | AU2022256732A1 (https=) |
| CA (1) | CA3215103A1 (https=) |
| WO (1) | WO2022218891A2 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024089229A1 (en) * | 2022-10-28 | 2024-05-02 | CureVac SE | Improved formulations comprising lipid-based carriers encapsulating rna |
Citations (24)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5876969A (en) | 1992-01-31 | 1999-03-02 | Fleer; Reinhard | Fusion polypeptides comprising human serum albumin, nucleic acids encoding same, and recombinant expression thereof |
| US20020086356A1 (en) | 2000-03-30 | 2002-07-04 | Whitehead Institute For Biomedical Research | RNA sequence-specific mediators of RNA interference |
| US20050287153A1 (en) | 2002-06-28 | 2005-12-29 | Genentech, Inc. | Serum albumin binding peptides for tumor targeting |
| US20070003549A1 (en) | 2004-08-24 | 2007-01-04 | Olga Ignatovich | Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor |
| US7176278B2 (en) | 2001-08-30 | 2007-02-13 | Biorexis Technology, Inc. | Modified transferrin fusion proteins |
| US20070048282A1 (en) | 2004-02-09 | 2007-03-01 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| WO2007036366A2 (de) | 2005-09-28 | 2007-04-05 | Johannes Gutenberg-Universität Mainz, Vertreten Durch Den Präsidenten | Modifikationen von rna, die zu einer erhöhten transkriptstabilität und translationseffizienz führen |
| US20070178082A1 (en) | 2002-11-08 | 2007-08-02 | Ablynx N.V. | Stabilized single domain antibodies |
| US20070269422A1 (en) | 2006-05-17 | 2007-11-22 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
| WO2009083804A2 (en) | 2007-12-27 | 2009-07-09 | Novartis Ag | Improved fibronectin-based binding molecules and their use |
| WO2009133208A1 (en) | 2008-05-02 | 2009-11-05 | Novartis Ag | Improved fibronectin-based binding molecules and uses thereof |
| US20100113339A1 (en) | 2006-09-08 | 2010-05-06 | Ablynx N. V. | Serum albumin binding proteins with long half-lives |
| WO2011124718A1 (en) | 2010-04-09 | 2011-10-13 | Novozymes A/S | Albumin derivatives and variants |
| US8158579B2 (en) | 2006-07-24 | 2012-04-17 | Biorexis Pharmaceutical Corporation | Fusion protein of an exendin to modified transferrin |
| US20120094909A1 (en) | 2010-04-13 | 2012-04-19 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to pcsk9 |
| WO2013075066A2 (en) | 2011-11-18 | 2013-05-23 | Eleven Biotherapeutics, Inc. | Proteins with improved half-life and other properties |
| US20140220017A1 (en) | 2011-09-23 | 2014-08-07 | Universitat Stuttgart | Serum half-life extension using igbd |
| WO2015014789A1 (en) | 2013-07-31 | 2015-02-05 | L'oreal | Anhydrous cosmetic composition comprising alkylcellulose, at least one branched dextrin ester and at least one fatty alcohol |
| WO2016005324A1 (en) | 2014-07-11 | 2016-01-14 | Biontech Rna Pharmaceuticals Gmbh | Stabilization of poly(a) sequence encoding dna sequences |
| WO2016176330A1 (en) | 2015-04-27 | 2016-11-03 | The Trustees Of The University Of Pennsylvania | Nucleoside-modified rna for inducing an adaptive immune response |
| WO2017075531A1 (en) | 2015-10-28 | 2017-05-04 | Acuitas Therapeutics, Inc. | Novel lipids and lipid nanoparticle formulations for delivery of nucleic acids |
| WO2017182524A1 (en) | 2016-04-22 | 2017-10-26 | Biontech Rna Pharmaceuticals Gmbh | Methods for providing single-stranded rna |
| WO2018078053A1 (en) | 2016-10-26 | 2018-05-03 | Curevac Ag | Lipid nanoparticle mrna vaccines |
| WO2018081480A1 (en) | 2016-10-26 | 2018-05-03 | Acuitas Therapeutics, Inc. | Lipid nanoparticle formulations |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11219634B2 (en) * | 2015-01-21 | 2022-01-11 | Genevant Sciences Gmbh | Methods, compositions, and systems for delivering therapeutic and diagnostic agents into cells |
| WO2017218704A1 (en) * | 2016-06-14 | 2017-12-21 | Modernatx, Inc. | Stabilized formulations of lipid nanoparticles |
-
2022
- 2022-04-11 AU AU2022256732A patent/AU2022256732A1/en active Pending
- 2022-04-11 US US18/554,947 patent/US20240226132A1/en active Pending
- 2022-04-11 JP JP2024505491A patent/JP2024514364A/ja active Pending
- 2022-04-11 EP EP22719594.8A patent/EP4322925A2/en active Pending
- 2022-04-11 CA CA3215103A patent/CA3215103A1/en active Pending
- 2022-04-11 WO PCT/EP2022/059555 patent/WO2022218891A2/en not_active Ceased
Patent Citations (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5876969A (en) | 1992-01-31 | 1999-03-02 | Fleer; Reinhard | Fusion polypeptides comprising human serum albumin, nucleic acids encoding same, and recombinant expression thereof |
| US20020086356A1 (en) | 2000-03-30 | 2002-07-04 | Whitehead Institute For Biomedical Research | RNA sequence-specific mediators of RNA interference |
| US7176278B2 (en) | 2001-08-30 | 2007-02-13 | Biorexis Technology, Inc. | Modified transferrin fusion proteins |
| US20050287153A1 (en) | 2002-06-28 | 2005-12-29 | Genentech, Inc. | Serum albumin binding peptides for tumor targeting |
| US20070178082A1 (en) | 2002-11-08 | 2007-08-02 | Ablynx N.V. | Stabilized single domain antibodies |
| US20070048282A1 (en) | 2004-02-09 | 2007-03-01 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| US20070003549A1 (en) | 2004-08-24 | 2007-01-04 | Olga Ignatovich | Ligands that have binding specificity for VEGF and/or EGFR and methods of use therefor |
| WO2007036366A2 (de) | 2005-09-28 | 2007-04-05 | Johannes Gutenberg-Universität Mainz, Vertreten Durch Den Präsidenten | Modifikationen von rna, die zu einer erhöhten transkriptstabilität und translationseffizienz führen |
| US20070269422A1 (en) | 2006-05-17 | 2007-11-22 | Ablynx N.V. | Serum albumin binding proteins with long half-lives |
| US8158579B2 (en) | 2006-07-24 | 2012-04-17 | Biorexis Pharmaceutical Corporation | Fusion protein of an exendin to modified transferrin |
| US20100113339A1 (en) | 2006-09-08 | 2010-05-06 | Ablynx N. V. | Serum albumin binding proteins with long half-lives |
| WO2009083804A2 (en) | 2007-12-27 | 2009-07-09 | Novartis Ag | Improved fibronectin-based binding molecules and their use |
| WO2009133208A1 (en) | 2008-05-02 | 2009-11-05 | Novartis Ag | Improved fibronectin-based binding molecules and uses thereof |
| WO2011124718A1 (en) | 2010-04-09 | 2011-10-13 | Novozymes A/S | Albumin derivatives and variants |
| US20120094909A1 (en) | 2010-04-13 | 2012-04-19 | Bristol-Myers Squibb Company | Fibronectin based scaffold domain proteins that bind to pcsk9 |
| US20140220017A1 (en) | 2011-09-23 | 2014-08-07 | Universitat Stuttgart | Serum half-life extension using igbd |
| US20170145062A1 (en) | 2011-09-23 | 2017-05-25 | Universitat Stuttgart | Serum half-life extension using igbd |
| WO2013075066A2 (en) | 2011-11-18 | 2013-05-23 | Eleven Biotherapeutics, Inc. | Proteins with improved half-life and other properties |
| WO2015014789A1 (en) | 2013-07-31 | 2015-02-05 | L'oreal | Anhydrous cosmetic composition comprising alkylcellulose, at least one branched dextrin ester and at least one fatty alcohol |
| WO2016005324A1 (en) | 2014-07-11 | 2016-01-14 | Biontech Rna Pharmaceuticals Gmbh | Stabilization of poly(a) sequence encoding dna sequences |
| WO2016176330A1 (en) | 2015-04-27 | 2016-11-03 | The Trustees Of The University Of Pennsylvania | Nucleoside-modified rna for inducing an adaptive immune response |
| WO2017075531A1 (en) | 2015-10-28 | 2017-05-04 | Acuitas Therapeutics, Inc. | Novel lipids and lipid nanoparticle formulations for delivery of nucleic acids |
| WO2017182524A1 (en) | 2016-04-22 | 2017-10-26 | Biontech Rna Pharmaceuticals Gmbh | Methods for providing single-stranded rna |
| WO2018078053A1 (en) | 2016-10-26 | 2018-05-03 | Curevac Ag | Lipid nanoparticle mrna vaccines |
| WO2018081480A1 (en) | 2016-10-26 | 2018-05-03 | Acuitas Therapeutics, Inc. | Lipid nanoparticle formulations |
Non-Patent Citations (21)
| Title |
|---|
| "Helvetica Chimica Acta", 1995, article "A multilingual glossary of biotechnological terms: (IUPAC Recommendations" |
| "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
| B.H. ZIMM, J. CHEM. PHYS., vol. 13, 1945, pages 141 |
| BUCHHOLZ ET AL., ELECTROPHORESIS, vol. 22, 2001, pages 4118 - 4128 |
| GIBALDI, M. ET AL.: "Pharmacokinetics", 1982, MARCEL DEKKER |
| GOULD ET AL., ANTIVIRAL RES., vol. 87, 2010, pages 111 - 124 |
| HOLTKAMP ET AL., BLOOD, vol. 108, 2006, pages 4009 - 4017 |
| JOSE ET AL., FUTURE MICROBIOL., vol. 4, 2009, pages 837 - 856 |
| KACZMAREK, J. C. ET AL., GENOME MEDICINE, vol. 9, 2017, pages 60 |
| KONTERMANN, EXPERT OPIN BIOL THER, vol. 16, no. 7, July 2016 (2016-07-01), pages 903 - 15 |
| KOPPEL, D., J. CHEM. PHYS., vol. 57, 1972, pages 4814 - 4820 |
| MARCH: "Remington's Pharmaceutical Sciences", 1985, MACK PUBLISHING CO. |
| NEDDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| P. DEBYE, J. APPL. PHYS., vol. 15, 1944, pages 338 |
| PEARSONLIPMAN, PROC. NATL ACAD. SCI. USA, vol. 88, 1988, pages 2444 |
| PETERS ET AL., PHARMACOKINETIC ANALYSIS: A PRACTICAL APPROACH, 1996 |
| S. M. BERGE ET AL.: "Pharmaceutical Salts", J. PHARM. SCI., vol. 66, 1977, pages 1 - 19, XP002675560, DOI: 10.1002/jps.2600660104 |
| SMITHWATERMAN, ADS APP. MATH., vol. 2, 1981, pages 482 |
| STREITWIESERHEATHCOOK: "Organische Chemie", 1995, DEUTSCHER VERLAG DER WISSENSCHAFTEN |
| TUSCHL T. ET AL., THE SIRNA USER GUIDE, 11 October 2002 (2002-10-11) |
| W. BURCHARD, ANAL. CHEM., vol. 75, 2003, pages 4279 - 4291 |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2024089229A1 (en) * | 2022-10-28 | 2024-05-02 | CureVac SE | Improved formulations comprising lipid-based carriers encapsulating rna |
Also Published As
| Publication number | Publication date |
|---|---|
| US20240226132A1 (en) | 2024-07-11 |
| CA3215103A1 (en) | 2022-10-20 |
| EP4322925A2 (en) | 2024-02-21 |
| JP2024514364A (ja) | 2024-04-01 |
| AU2022256732A1 (en) | 2023-10-19 |
| WO2022218891A3 (en) | 2022-11-24 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230414747A1 (en) | Lnp compositions comprising rna and methods for preparing, storing and using the same | |
| EP4243787A1 (en) | Pharmaceutical compositions comprising particles and mrna and methods for preparing and storing the same | |
| US20240408032A1 (en) | Lipid-based rna formulations suitable for therapy | |
| EP4565275A1 (en) | Nucleic acid compositions comprising amphiphilic oligo ethylene glycol (oeg)-conjugated compounds and methods of using such compounds and compositions | |
| US20250222097A1 (en) | Lipid-based formulations for administration of rna | |
| WO2024028445A1 (en) | Rna for preventing or treating tuberculosis | |
| US20250222132A1 (en) | Nucleic acid compositions comprising a multivalent anion, such as an inorganic polyphosphate, and methods for preparing, storing and using the same | |
| WO2022218503A1 (en) | Lnp compositions comprising rna and methods for preparing, storing and using the same | |
| WO2024027910A1 (en) | Rna for preventing or treating tuberculosis | |
| US20240226132A1 (en) | Rna compositions comprising a buffer substance and methods for preparing, storing and using the same | |
| WO2024213776A1 (en) | Rna for preventing or treating tuberculosis | |
| EP4694919A1 (en) | Rna for preventing or treating tuberculosis | |
| CN120712350A (zh) | 用于药物用途的rna制剂 | |
| WO2023067193A2 (en) | Compositions for administration of different doses of rna | |
| CN117615752A (zh) | 包含缓冲物质的rna组合物及其制备、储存和使用方法 | |
| WO2025223684A1 (en) | Methods and compositions for stimulating immune response |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22719594 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: AU2022256732 Country of ref document: AU Ref document number: 2022256732 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2024505491 Country of ref document: JP Ref document number: 3215103 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022256732 Country of ref document: AU Date of ref document: 20220411 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022719594 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2022719594 Country of ref document: EP Effective date: 20231113 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202280041220.1 Country of ref document: CN |