WO2022187591A1 - Anti-glyco-cd44 antibodies and their uses - Google Patents
Anti-glyco-cd44 antibodies and their uses Download PDFInfo
- Publication number
- WO2022187591A1 WO2022187591A1 PCT/US2022/018863 US2022018863W WO2022187591A1 WO 2022187591 A1 WO2022187591 A1 WO 2022187591A1 US 2022018863 W US2022018863 W US 2022018863W WO 2022187591 A1 WO2022187591 A1 WO 2022187591A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- cdr
- antigen
- binding fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4223—CD44 not IgG
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2884—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD44
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/11—Antigen recognition domain
- A61K2239/13—Antibody-based
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/40—Immunoglobulins specific features characterized by post-translational modification
- C07K2317/41—Glycosylation, sialylation, or fucosylation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- CD44 is a heavily glycosylated transmembrane protein that is involved in cell-cell interactions, cell adhesion and migration, and has additionally been suggested as a marker for cancer stem cells.
- CD44 variants in humans, including the standard variant. The ten variants are differentially expressed in a variety of tumors (see Chen, et al., 2018, J Hematol Oncol.11(1):64). There are 117 potential O-linked glycosylation sites within the CD44 variant region, including 54 serines and 63 threonines.
- Antibodies targeting CD44 such as Bivatuzumab, which recognizes the cancer- associated isoform CD44v6, are known in the art.
- Bivatuzumab induces severe skin toxicities due to a low expression of CD44v6 in healthy skin. See, Börjesson et al., 2003. Clin Cancer Res.9(10 Pt 2):3961S–72S; Brentjens et al., 2013. Sci Transl Med.5(177):177ra38- 177ra38; Goodison et al., 1999, Mol Pathol.52(4):189–196; Grupp, et al.2013, N Engl J Med.
- glyco-CD44 epitopes that are overexpressed in cancer cells and new therapeutic modalities, such as antibodies and CARs, which utilize such glyco-CD44 epitopes.
- the disclosure captures the tumor specificity of glycopeptide variants by providing therapeutic and diagnostic agents based on antibodies and antigen-binding fragments that are selective for cancer-specific epitopes of glyco-CD44.
- the present disclosure provides anti-glyco-CD44 antibodies and antigen-binding fragments thereof that bind to a cancer-specific glycosylation variant of CD44.
- the present disclosure further provides fusion proteins and antibody-drug conjugates comprising anti-glyco- CD44 antibodies and antigen-binding fragments, and nucleic acids encoding the anti-glyco- CD44 antibodies, antigen-binding fragments and fusion proteins.
- the present disclosure further provides methods of using the anti-glyco-CD44 antibodies, antigen-binding fragments, fusion proteins, antibody-drug conjugates and nucleic acids for cancer therapy.
- the disclosure provides bispecific and other multispecific anti-glyco- CD44 antibodies and antigen-binding fragments that bind to a cancer-specific glycosylation variant of CD44 and to a second epitope.
- the second epitope can either be on CD44 itself, on another protein co-expressed on cancer cells with CD44, or on another protein presented on a different cell, such as an activated T cell.
- nucleic acids encoding such antibodies including nucleic acids comprising codon-optimized coding regions and nucleic acids comprising coding regions that are not codon-optimized for expression in a particular host cell.
- the anti-glyco-CD44 antibodies and antigen-binding fragments can be in the form of fusion proteins containing a fusion partner.
- the fusion partner can be useful to provide a second function, such as a signaling function of the signaling domain of a T cell signaling protein, a peptide modulator of T cell activation or an enzymatic component of a labeling system.
- T cell signaling proteins include 4-1BB, CD28, CD2, and fusion peptides, e.g., CD28-CD3-zeta, 4-1BB-CD3-zeta, CD2-CD3-zeta, CD28-CD2-CD3-zeta, and 4-1BB-CD2- CD3-zeta.4-1BB, or CD137, is a co-stimulatory receptor of T cells; CD2 is a co-stimulatory receptor of T and NL cells; CD3-zeta is a signal-transduction component of the T-cell antigen receptor.
- the moiety providing a second function can be a modulator of T cell activation, such as IL-15, IL-15R ⁇ , or an IL-15/IL-15R ⁇ fusion, can be an MHC-class I-chain-related (MIC) protein domain useful for making a MicAbody, or it can encode a label or an enzymatic component of a labeling system useful in monitoring the extent and/or location of binding in vivo or in vitro.
- Constructs encoding these prophylactically and therapeutically active biomolecules placed in the context of T cells, such as autologous T cells provide a powerful platform for recruiting adoptively transferred T cells to prevent or treat a variety of cancers in some embodiments of the disclosure.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy and/or light chain variable sequences (or encoded by the nucleotide sequences) set forth in Tables 1A through 1E.
- anti-glyco- CD44 antibody it is intended to include monospecific and multi- specific (including bispecific) anti-glyco-CD44 antibodies, antigen-binding fragments of the monospecific and multi-specific antibodies, and fusion proteins and conjugates containing the antibodies and their antigen-binding fragments, unless the context dictates otherwise.
- an anti-glyco-CD44 antibody or antigen-binding fragment comprises heavy and/or light chain CDR sequences (or encoded by the nucleotide sequences) set forth in Tables 1-3.
- the CDR sequences set forth in Tables 1A-1E include CDR sequences defined according to the IMGT (Lefranc et al., 2003, Dev Comparat Immunol 27:55- 77), Kabat (Kabat et al., 1991, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.), and Chothia (Al-Lazikani et al., 1997, J. Mol. Biol 273:927-948) schemes for defining CDR boundaries.
- IMGT Lefranc et al., 2003, Dev Comparat Immunol 27:55- 77
- Kabat Kabat
- Chothia Al-Lazikani et al., 1997, J. Mol. Biol 273:927-948
- the CDR sequences set forth in Tables 1F, 1G, and 1H are consensus sequences derived from the CDR sequences set forth in Tables 1A through 1D according to the IMGT, Kabat, and Chothia definitions, respectively.
- the CDR sequences set forth in Tables 1I, 1J, and 1K are consensus sequences derived from the CDR sequences set forth in Tables 1A through 1E according to the IMGT, Kabat, and Chothia definitions, respectively.
- the CDR sequences set forth in Tables 2A through 2E are the combined regions of overlap for the CDR sequences set forth in Tables 1A through 1E, respectively, with the IMGT, Kabat and Chothia sequences shown in underlined bold text.
- the CDR sequences set forth in Table 2F are the combined regions of overlap for the consensus CDR sequences set forth in Tables 1F-1H.
- the CDR sequences set forth in Table 2G are the combined regions of overlap for the consensus CDR sequences set forth in Tables 1I-1K.
- the CDR sequences set forth in Tables 3A-3E are the common regions of overlap for the CDR sequences shown in Tables 1A-1E, respectively.
- the CDR sequences set forth in Table 3F are the common regions of overlap for the CDR sequences set forth in Tables 1F-1H.
- the CDR sequences set forth in Table 3G are the common regions of overlap for the CDR sequences set forth in Tables 1I-1K.
- the framework sequences for such anti-glyco-CD44 antibody and antigen-binding fragment can be the native murine framework sequences of the VH and VL sequences set forth in Tables 1A-1D, can be the native rabbit framework sequences of the VH and VL sequences set forth in Table 1E, or can be non-native (e.g., humanized or human) framework sequences, e.g., as set forth in Tables 4A-4G.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises a combination of CDRs selected from CDR sequences set forth in Tables 1-3.
- CDR-H1 comprises the amino acid sequence of SEQ ID NO:3, 9, 15, 25, 31, 37, 47, 53, 59, 69, 75, 81, 89, 93, 97, 101, 107, 113, 119, 125, 129, 135, 141, 147, 153, 208, 214, 220, 228, 232, 236, 240, 246, 250, or 256.
- CDR-H2 comprises the amino acid sequence of SEQ ID NO:4, 10, 16, 26, 32, 38, 48, 54, 60, 70, 76, 82, 90, 94, 98, 102, 108, 114, 120, 126, 130, 136, 142, 148, 154, 209.215, 221, 229, 233, 237, 241, 247, 251, or 257.
- CDR-H3 comprises the amino acid sequence of SEQ ID NO:5, 11, 17, 27, 33, 39, 49, 55, 61, 71, 77, 83, 103, 109, 115, 121, 131, 137, 143, 149, 210, 216, 222, 242, or 252.
- CDR-L1 comprises the amino acid sequence of SEQ ID NO:6, 12, 18, 28, 34, 40, 50, 56, 62, 72, 78, 84, 104, 110, 116, 122, 132, 138, 144, 150, 211, 217, 223, 243, or 253.
- CDR-L2 comprises the amino acid sequence of SEQ ID NO:7, 13, 19, 29, 35, 41, 51, 57, 63, 73, 79, 85, 91, 95, 99, 105, 111, 117, 123, 127, 133, 139, 145, 151, 155, 212, 218, 224, 230, 234, 238, 244, 248, 254, or 258.
- CDR-L3 comprises the amino acid sequence of SEQ ID NO:8, 14, 20, 30, 36, 42, 52, 58, 64, 74, 80, 86, 92, 96, 100, 106, 112, 118, 124, 128, 134, 140, 146, 152, 156, 213, 219, 225, 231, 235, 239, 245, 249, 255, or 259.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises CDRs comprising the amino acid sequences of any of the CDR combinations set forth in numbered embodiments 13 to 275 of Group I.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises a CDR-H1 comprising the amino acid sequence of SEQ ID NO:89, SEQ ID NO:93, SEQ ID NO:97, SEQ ID NO:125, SEQ ID NO:153, SEQ ID NO:228, SEQ ID NO:232, SEQ ID NO:236, SEQ ID NO:246, or SEQ ID NO:256; a CDR-H2 comprising the amino acid sequence of SEQ ID NO:90, SEQ ID NO:94, SEQ ID NO:98, SEQ ID NO:229, SEQ ID NO:233, SEQ ID NO:237; a CDR-H3 comprising the amino acid sequence of SEQ ID NO:103, SEQ ID NO:109, SEQ ID NO:115, SEQ ID NO:121, SEQ ID NO:131, SEQ ID NO:137, SEQ ID NO:143, SEQ ID NO:149, SEQ ID NO:242, or SEQ ID NO:25
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:3-5 and light chain CDRs of SEQ ID NOS:6-8.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:9-11 and light chain CDRs of SEQ ID NOS:12-14.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:15-17 and light chain CDRs of SEQ ID NOS:18-20.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:25-27 and light chain CDRs of SEQ ID NOS:28-30.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:31-33 and light chain CDRs of SEQ ID NOS:34-36.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:37-39 and light chain CDRs of SEQ ID NOS:40-42.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:47-49 and light chain CDRs of SEQ ID NOS:50-52.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:53-55 and light chain CDRs of SEQ ID NOS:56-58.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:59-61 and light chain CDRs of SEQ ID NOS:62-64.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:69-71 and light chain CDRs of SEQ ID NOS:72-74.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:75-77 and light chain CDRs of SEQ ID NOS:78-80.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:81-83 and light chain CDRs of SEQ ID NOS:84-86.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:208-210 and light chain CDRs of SEQ ID NOS:211-213.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:214-216 and light chain CDRs of SEQ ID NOS:217-219.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:220-222 and light chain CDRs of SEQ ID NOS:223-225.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:101-103 and light chain CDRs of SEQ ID NOS:104-106.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:107-109 and light chain CDRs of SEQ ID NOS:110-112.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:113-115 and light chain CDRs of SEQ ID NOS:116-118.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:119- 121 and light chain CDRs of SEQ ID NOS:122-124.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:240-242 and light chain CDRs of SEQ ID NOS:243-245.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:129-131 and light chain CDRs of SEQ ID NOS:132-134.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:135-137 and light chain CDRs of SEQ ID NOS:138-140.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:141-143 and light chain CDRs of SEQ ID NOS:144-146.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:147- 149 and light chain CDRs of SEQ ID NOS:150-152.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:250-252 and light chain CDRs of SEQ ID NOS:253-255.
- the antibodies and antigen-binding fragments of the disclosure can be murine, rabbit, chimeric, humanized or human. Exemplary humanized sequences are provided in Tables 4A- 4G and the numbered embodiments of Group II (which also includes compositions, nucleic acids, host cells, and uses relating to such humanized sequences).
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure competes with an antibody or antigen-binding fragment comprising heavy and light chain variable regions of SEQ ID NOS:1 and 2, respectively.
- the disclosure provides an anti-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NOS:1 and 2, respectively.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure competes with an antibody or antigen-binding fragment comprising heavy and light chain variable regions of SEQ ID NOS:23 and 24, respectively.
- the disclosure provides an anti-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NOS:23 and 24, respectively.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure competes with an antibody or antigen-binding fragment comprising heavy and light chain variable regions of SEQ ID NOS:45 and 46, respectively.
- the disclosure provides an anti-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NOS:45 and 46, respectively.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure competes with an antibody or antigen-binding fragment comprising heavy and light chain variable regions of SEQ ID NOS:67 and 68, respectively.
- the disclosure provides an anti-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NOS:67 and 68, respectively.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure competes with an antibody or antigen-binding fragment comprising heavy and light chain variable regions of SEQ ID NOS:206 and 207, respectively.
- an anti-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NOS:206 and 207, respectively.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure is a single-chain variable fragment (scFv).
- An exemplary scFv comprises the heavy chain variable fragment N-terminal to the light chain variable fragment.
- the scFv heavy chain variable fragment and light chain variable fragment are covalently bound to a linker sequence of 4-15 amino acids.
- the scFv can be in the form of a bi-specific T-cell engager or within a chimeric antigen receptor (CAR).
- CAR chimeric antigen receptor
- the anti-glyco-CD44 antibodies and antigen-binding fragments can be in the form of a multimer of a single-chain variable fragment, a bispecific single-chain variable fragment and a multimer of a bispecific single-chain variable fragment.
- the multimer of a single chain variable fragment is selected a divalent single-chain variable fragment, a tribody or a tetrabody.
- the multimer of a bispecific single-chain variable fragment is a bispecific T-cell engager.
- nucleic acids encoding the anti-glyco-CD44 antibodies and antibody-binding fragments of the disclosure are drawn to nucleic acids encoding the anti-glyco-CD44 antibodies and antibody-binding fragments of the disclosure.
- the portion of the nucleic acid nucleic acid encoding an anti-glyco-CD44 antibody or antigen-binding fragment is codon-optimized for expression in a human cell.
- the disclosure provides an anti-glyco-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions encoded by a heavy chain nucleotide sequence having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NO:1, SEQ ID NO:23, SEQ ID NO:45, SEQ ID NO:67, or SEQ ID NO:206 and a light chain nucleotide sequence having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NO:2, SEQ ID NO:24, SEQ ID NO:46, SEQ ID NO:68, or SEQ ID NO:207.
- Vectors e.g., a viral vector such as a lentiviral vector
- host cells comprising the nucleic acids
- the heavy and light chains coding sequences can be present on a single vector or on separate vectors.
- a pharmaceutical composition comprising an anti-glyco-CD44 antibody, antigen-binding fragment, nucleic acid (or pair of nucleic acids), vector (or pair of vectors) or host cell according to the disclosure, and a physiologically suitable buffer, adjuvant, or diluent.
- Still another aspect of the disclosure is a method of making a chimeric antigen receptor comprising incubating a cell comprising a nucleic acid or a vector according to the disclosure, under conditions suitable for expression of the coding region and collecting the chimeric antigen receptor.
- Another aspect of the disclosure is a method of detecting cancer comprising contacting a biological sample (e.g., a cell, tissue sample, or extracellular vesicle) with an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure and detecting whether the antibody is bound to the biological sample (e.g., cell, tissue sample, or extracellular vesicle).
- Yet another aspect of the disclosure is an anti-glyco-CD44 antibody or antigen-binding fragment according to the disclosure for use in detecting cancer.
- a method of treating cancer comprising administering a prophylactically or therapeutically effective amount of an anti-glyco-CD44 antibody, antigen-binding fragment, nucleic acid, vector, host cell or pharmaceutical composition according to the disclosure to a subject in need thereof.
- an anti-glyco-CD44 antibody, antigen-binding fragment, nucleic acid, vector, host cell or pharmaceutical composition according to the disclosure for use in the treatment of cancer.
- CD44v6 peptides are also provided herein.
- the peptides can be 12-30 amino acids in length and comprise amino acids 4-13 of SEQ ID NO:165.
- the CD44v6 peptides are described in Section 6.10 and numbered embodiments 628 to 633 of Group I.
- the peptides can be included in a composition, as described in Section 6.10.1 and numbered embodiments 634 to 635 of Group I.
- FIGS.1A-1F show that antibody 4C8 specifically binds Tn-glycosylated CD44.
- FIG.1A ELISA performed with 1 ⁇ g/mL 4C8 mAb against various concentrations of non-glycosylated and Tn-glycosylated CD44 and MUC1.
- FIG.1B The affinity of 4C8 mAb for CD44v6 glycopeptide determined using Biacore and Octet technologies.
- FIG.1C HaCaT WT and COSMC KO cell staining using ⁇ -Golgi, various dilutions of 4C8 mAb supernatant, ⁇ -CD44v6, and a mouse IgG isotype control.
- FIG.1D HaCaT WT and COSMC KO cell immunofluorescence staining using 4C8 mAb, ⁇ -CD44v6, and ⁇ -Tn.
- FIG.1E HaCaT WT and COSMC KO cells grown into an organotypic skin model on a collagen-gel containing human fibroblasts, fixed, embedded in paraffin, and stained for immunofluorescence using 4C8 mAb and ⁇ -CD44v6.
- FIG.1F Biopsies from healthy human skin stained for immunofluorescence using 4C8 mAb and ⁇ -CD44v6.
- FIGS.2A-2B show that antibody 4C8 selectively stains several primary cancer tissues.
- FIG.2A Tissue microarrays for several carcinomas and adjacent healthy tissues stained for immunohistochemistry using 4C8 mAb, ⁇ -CD44, and a mouse IgG isotype control.
- FIG.2B Tables showing the distribution of strong, weak and negative stained tissue sections observed in the immunohistochemistry portrayed in FIG.2A, divided into grade 1, grade 2, and grade 3 carcinomas for each cancer type.
- FIG.3A-3C show that 4C8 CAR T cells selectively kill Tn-positive cancer cells.
- FIG.3A Results of cytotoxicity assay performed with 4C8 CAR T cells (Construct 1) co-cultured with HaCaT WT and COSMC KO cells.
- FIG.3B Concentration of IFN- ⁇ in co-culture supernatants analyzed by ELISA.
- FIG.3C Expression of T cell activation markers assessed using flow cytometry.
- FIG.4 shows results of a cytotoxicity assay performed with 4C8 CAR T cells co- cultured with HaCaT WT and COSMC KO cells at a 3 to 1 ratio.
- NV no vector
- NV no vector
- the orientation of light chain (L) at the N-terminus (Construct 1) was found to be more effective than the heavy chain at the N-terminus (Construct 4).
- FIG.5A-5H schematic representations of representative 4C8 CAR constructs 1-8.
- FIG.5A Construct 1 (LH-4C8-CD8a-CART); FIG.5B: Construct 2 (LH-4C8-IgG4-CART); FIG.5C: Construct 3 (LH-4C8-IgG4-Long-CART); FIG.5D: Construct 4 (HL-4C8-CD8a-CART); FIG.5E: Construct 5 (HL-4C8-IgG4-CART); FIG.5F: Construct 6 (HL-4C8- IgG4-Long-CART); FIG.5G: Construct 7 (LHx2-4C8-CD8-CART); FIG.5H: Construct 8 (HLx2-4C8-CD8-CART).
- FIGS.5A- 5H disclose "(GGGGS)x3" as SEQ ID NO:184 and "(GGGGS)x1" as SEQ ID NO:183.
- FIG.6 schematic representation of a representative 10H4 CAR construct.
- FIG.6 discloses "(GGGGS)x3" as SEQ ID NO:184.
- FIGS.7A-7E schematic representations of representative 4C8 CAR-neuraminidase constructs 1-5.
- FIGS.7A-7E disclose "(GGGGS)x3" as SEQ ID NO:184 and “6xHis” as SEQ ID NO:315.
- FIGS.8A-8I show that humanized 4C8 antibodies bind Tn-glycosylated CD44.
- FIGS.8A- 8H ELISA performed with 1 ⁇ g/mL of humanized 4C8 antibody candidates 1-8 (as indicated) against various concentrations of non-glycosylated and Tn-glycosylated CD44 and MUC1.
- FIG. 8I ELISA performed with 1 ⁇ g/mL 4C8 mAb against various concentrations of non-glycosylated and Tn-glycosylated CD44 and MUC1.
- FIGS.9A-9I show cell binding of humanized 4C8 candidates 1-8 (FIGS.9A-9H, respectively) and 4C8 mAb (FIG.9I) to A549-COSMC-KO cells as determined by flow cytometry. 6.
- Each of the potential 117 O-linked glycosylation sites within the CD44 variant region have the potential to be targets for therapeutic antibodies. It is unknown which glycosylation sites can be effectively targeted.
- the CD44v6 domain alone includes 13 potential O-linked glycosylation sites, including 4 serines and 9 threonines. Each of these sites could potentially be used as an antibody target.
- the disclosure provides novel antibodies that are directed to a specific glycoform of CD44v6 present on tumor cells.
- antibodies 4C8, 2B2, 18G9, 1D12, and 10H4.4C8, 2B2, 18G9, and 1D12 were identified in a screen for murine antibodies that bind to a glycosylated peptide present in a particular glycoform of CD44v6, GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text (the “CD44v6 glycopeptide”) so as to mimic the glycosylation pattern of CD44v6 present on tumor cells.10H4 was identified in a screen for rabbit antibodies that bind to the same CD44v6 glycopeptide.
- the anti-glyco-CD44 antibodies of the disclosure are useful as tools in cancer diagnosis and therapy.
- the disclosure provides antibodies and antigen-binding fragments that bind to a glycoform of CD44 present on tumor cells (referred to herein as “glyco- CD44”), and preferably to the CD44v6 glycopeptide.
- the anti-glyco-CD44 antibodies of the disclosure may be polyclonal, monoclonal, genetically engineered, and/or otherwise modified in nature, including but not limited to chimeric antibodies, humanized antibodies, human antibodies, primatized antibodies, single chain antibodies, bispecific antibodies, dual-variable domain antibodies, etc.
- the antibodies comprise all or a portion of a constant region of an antibody.
- the constant region is an isotype selected from: IgA (e.g., IgA 1 or IgA 2 ), IgD, IgE, IgG (e.g., IgG 1 , IgG 2 , IgG 3 or IgG 4 ), and IgM.
- the anti-glyco-CD44 antibodies of the disclosure comprise an IgG1 constant region isotype.
- the term “monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology.
- a monoclonal antibody is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, by any means available or known in the art.
- Monoclonal antibodies useful with the present disclosure can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof.
- chimeric antibody refers to an antibody having variable sequences derived from a non-human immunoglobulin, such as a rat or a mouse antibody, and human immunoglobulin constant regions, typically chosen from a human immunoglobulin template.
- Methods for producing chimeric antibodies are known in the art. See, e.g., Morrison, 1985, Science 229(4719):1202-7; Oi et al., 1986, BioTechniques 4:214-221; Gillies et al., 1985, J.
- “Humanized” forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins that contain minimal sequences derived from non-human immunoglobulin.
- a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence.
- the humanized antibody can also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin consensus sequence.
- Fc immunoglobulin constant region
- Methods of antibody humanization are known in the art. See, e.g., Riechmann et al., 1988, Nature 332:323-7; U.S. Pat. Nos.5,530,101; 5,585,089; 5,693,761; 5,693,762; and 6,180,370 to Queen et al.; EP239400; PCT publication WO 91/09967; U.S. Pat. No.5,225,539; EP592106; EP519596; Padlan, 1991, Mol.
- Human antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulin and that do not express endogenous immunoglobulins. Human antibodies can be made by a variety of methods known in the art including phage display methods using antibody libraries derived from human immunoglobulin sequences.
- Fully human antibodies that recognize a selected epitope can be generated using a technique referred to as “guided selection.” In this approach, a selected non-human monoclonal antibody, e.g., a mouse antibody, is used to guide the selection of a completely human antibody recognizing the same epitope (see, Jespers et al., 1988, Biotechnology 12:899-903).
- variable region sequences for humanized antibodies and antigen- binding fragments are set forth in Tables 4A-4G.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:3, 4, and 264. In some embodiments, an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:3, 4, and 268. In some embodiments, an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:273, 4, and 268. In some embodiments, an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:3, 275, and 5.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy chain CDRs of SEQ ID NOS:273, 275, and 5. [0059] In some embodiments, an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises light chain CDRs of SEQ ID NOS:6, 7, and 8. In some embodiments, an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises light chain CDRs of SEQ ID NOS:280, 7, and 8. In some embodiments, an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises light chain CDRs of SEQ ID NOS:284, 7, and 8.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises light chain CDRs of SEQ ID NOS:288, 7, and 8.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises a VH comprising: (i) CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs:3, 4, and 264, respectively, (ii) CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs:3, 4, and 268, respectively, (iii) CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs:273, 4, and 268, respectively, (iv) CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs: 3, 275, and 5, respectively; or (v) CDR-H1, CDR-
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises a VH comprising CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs:3, 4, and 264, respectively, and a VL comprising CDR-L1, CDR-L2, and CDR-L3 having the amino acid sequences of SEQ ID NOs:6, 7, and 8, respectively.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises a VH comprising CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs: 3, 275, and 5, respectively, and a VL comprising CDR-L1, CDR-L2, and CDR- L3 having the amino acid sequences of SEQ ID NOs:6, 7, and 8, respectively.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises a VH having a first sequence at least 95% identical to the VH designated as HV1-18A (SEQ ID NO:263) and a VL having a second sequence at least 95% identical to the VL designated as LV7-43A (SEQ ID NO:277).
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises a VH having a first sequence at least 95% identical to the VH designated as HV7-4-1A (SEQ ID NO:271) and a VL having a second sequence at least 95% identical to the VL designated as LV7-43A (SEQ ID NO:277).
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises a VH having a first sequence at least 95% identical to the VH designated as HV1- 18A (SEQ ID NO:263) and a VL having a second sequence at least 95% identical to the VL designated as LV7-46A (SEQ ID NO:281).
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises a VH having a first sequence at least 95% identical to the VH designated as HV7-4-1A (SEQ ID NO:271) and a VL having a second sequence at least 95% identical to the VL designated as LV7-46A (SEQ ID NO:281).
- the first sequence identity is at least 97%, at least 99%, or 100% and/or the second sequence identity is at least 97%, at least 99%, or 100%.
- “Primatized antibodies” comprise monkey variable regions and human constant regions. Methods for producing primatized antibodies are known in the art. See, e.g., U.S. Pat. Nos.
- Anti-glyco-CD44 antibodies of the disclosure include both full-length (intact) antibody molecules, as well as antigen-binding fragments that are capable of binding glyco-CD44.
- antigen-binding fragments include by way of example and not limitation, Fab, Fab', F (ab') 2 , Fv fragments, single chain Fv fragments and single domain fragments.
- a Fab fragment contains the constant domain of the light chain (CL) and the first constant domain (CH1) of the heavy chain.
- Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxyl terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region.
- F(ab') fragments are produced by cleavage of the disulfide bond at the hinge cysteines of the F(ab') 2 pepsin digestion product. Additional chemical couplings of antibody fragments are known to those of ordinary skill in the art.
- Fab and F(ab') 1 fragments lack the Fc fragment of intact antibody, clear more rapidly from the circulation of animals, and may have less non-specific tissue binding than an intact antibody (see, e.g., Wahl et al., 1983, J. Nucl. Med.24:316).
- An “Fv” fragment is the minimum fragment of an antibody that contains a complete target recognition and binding site. This region consists of a dimer of one heavy and one light chain variable domain in a tight, non-covalent association (V H -V L dimer). It is in this configuration that the three CDRs of each variable domain interact to define a target binding site on the surface of the V H -V L dimer. Often, the six CDRs confer target binding specificity to the antibody. However, in some instances even a single variable domain (or half of an Fv comprising only three CDRs specific for a target) can have the ability to recognize and bind target, although at a lower affinity than the entire binding site.
- Single-chain Fv or “scFv” antigen-binding fragments comprise the V H and V L domains of an antibody, where these domains are present in a single polypeptide chain.
- the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains which enables the scFv to form the desired structure for target binding.
- Single domain antibodies are composed of single VH or VL domains which exhibit sufficient affinity to glyco-CD44.
- the single domain antibody is a camelized antibody (See, e.g., Riechmann, 1999, Journal of Immunological Methods 231:25- 38).
- the anti-glyco-CD44 antibodies of the disclosure may also be bispecific and other multiple specific antibodies.
- Bispecific antibodies are monoclonal, often human or humanized, antibodies that have binding specificities for two different epitopes on the same or different antigen.
- one of the binding specificities can be directed towards glyco-CD44, the other can be for any other antigen, e.g., for a cell-surface protein, receptor, receptor subunit, tissue-specific antigen, virally derived protein, virally encoded envelope protein, bacterially derived protein, or bacterial surface protein, etc.
- the bispecific and other multispecific anti-glyco-CD44 antibodies and antigen-binding fragments specifically bind to a second CD44 epitope, an epitope on another protein co-expressed on cancer cells with CD44, or an epitope on another protein presented on a different cell, such as an activated T cell.
- Bispecific antibodies of the disclosure include IgG format bispecific antibodies and single chain-based bispecific antibodies.
- IgG format bispecific antibodies of the disclosure can be any of the various types of IgG format bispecific antibodies known in the art, such as quadroma bispecific antibodies, “knobs- in-holes” bispecific antibodies, bispecific domain-exchanged antibodies (e.g., CrossMab bispecific antibodies), charge paired bispecific antibodies, common light chain bispecific antibodies, one-arm single-chain Fab-immunoglobulin gamma bispecific antibodies, disulfide stabilized Fv bispecific antibodies, DuetMabs, controlled Fab-arm exchange bispecific antibodies, strand-exchange engineered domain body bispecific antibodies, two-arm leucine zipper heterodimeric monoclonal bispecific antibodies, ⁇ -body bispecific antibodies, dual variable domain bispecific antibodies, and cross-over dual variable domain bispecific antibodies.
- quadroma bispecific antibodies e.g., “knobs- in-holes” bispecific antibodies, bispecific domain-exchanged antibodies (e.g., CrossMab bispecific antibodies), charge paired bispecific antibodies
- the bispecific antibodies of the disclosure are domain exchanged antibodies, such as but not limited to the domain-exchanged antibodies referred to in the scientific and patent literature as CrossMabs. See, e.g., Schaefer et al., 2011, Proc Natl Acad Sci USA 108:11187-92.
- the domain-exchanged antibody (e.g., CrossMab) technology is described in detail in WO 2009/080251, WO 2009/080252, WO 2009/080253, WO 2009/080254, WO 2013/026833, WO 2016/020309, and Schaefer et al., 2011, Proc Natl Acad Sci USA 108:11187-92, which are incorporated herein by reference in their entireties.
- the domain-exchanged antibody technology is based on a domain crossover between heavy and light chains within one Fab-arm of a bispecific IgG, which promotes correct chain association.
- a domain-exchanged bispecific antibody of the disclosure can be a bispecific IgG comprising a Fab-arm having a domain crossover between heavy and light chains (e.g., a “CrossMab FAB ” antibody, in which the heavy and light chains of the Fab portion of one arm of a bispecific IgG antibody are exchanged).
- a bispecific IgG comprising a Fab-arm having a domain crossover between heavy and light chains
- a “CrossMab FAB ” antibody in which the heavy and light chains of the Fab portion of one arm of a bispecific IgG antibody are exchanged.
- a domain-exchanged bispecific antibody of the disclosure can be a bispecific IgG comprising a Fab-arm having a domain crossover between variable heavy and variable light chains (e.g., a “CrossMab VH-VL ” antibody, in which the only the variable domains of the heavy and light chains of the Fab portion of one arm of a bispecific IgG antibody are exchanged).
- a bispecific IgG comprising a Fab-arm having a domain crossover between variable heavy and variable light chains (e.g., a “CrossMab VH-VL ” antibody, in which the only the variable domains of the heavy and light chains of the Fab portion of one arm of a bispecific IgG antibody are exchanged).
- a domain-exchanged bispecific antibody of the disclosure can be a bispecific IgG comprising a Fab-arm having a domain crossover between constant heavy and constant light chains (e.g., a “CrossMab CH1-CL ” antibody, in which only the constant domains of the heavy and light chains of the Fab portion of one arm of a bispecific IgG antibody are exchanged).
- a bispecific IgG comprising a Fab-arm having a domain crossover between constant heavy and constant light chains (e.g., a “CrossMab CH1-CL ” antibody, in which only the constant domains of the heavy and light chains of the Fab portion of one arm of a bispecific IgG antibody are exchanged).
- Bispecific IgG comprising a Fab-arm having a domain crossover between constant heavy and constant light chains antibodies, in contrast to bispecific IgG comprising a Fab-arm having a domain crossover between heavy and light chains and bispecific IgG comprising a Fab-arm having a domain crossover between variable heavy and variable light chains, do not have predicted side products and, therefore, in some embodiments bispecific IgG comprising a Fab-arm having a domain crossover between constant heavy and constant light chains are preferred. See, Klein et al., 2016, mAbs, 8(6):1010-1020. [0072] In some embodiments, the bispecific antibodies of the disclosure are controlled Fab-arm exchange bispecific antibodies.
- Fab-arm exchange bispecific antibodies are described in PCT Publication No. WO2011/131746 and Labrijn et al., 2014 Nat Protoc. 9(10):2450-63, which are incorporated herein by reference in their entireties.
- controlled Fab-arm exchange bispecific antibodies can be made by separately expressing two parental IgG 1 s containing single matching point mutations in the CH3 domain, mixing the parental IgG 1 s under redox conditions in vitro to enable recombination of half-molecules, and removing the reductant to allow reoxidation of interchain disulfide bonds, thereby forming the bispecific antibodies.
- the bispecific antibodies of the disclosure are “bottle opener,” “mAb-Fv,” “mAb-scFv,” “central-scFv,” “central-Fv,” “one-armed central-scFv” or “dual scFv” format bispecific antibodies.
- Bispecific antibodies of these formats are described in PCT Publication No. WO 2016/182751, the contents of which are incorporated herein by reference in their entireties.
- the first monomer comprises a scFv covalently linked to the N-terminus of a Fc subunit, optionally via a linker
- the second monomer comprises a heavy chain (comprising a VH, CH1, and second Fc subunit).
- a bottle opener format bispecific antibody further comprises a light chain capable of pairing with the second monomer to form a Fab.
- a mAb-Fv bispecific antibody format relies upon an “extra” VH domain attached to the C-terminus of one heavy chain monomer and an “extra” VL domain attached to the other heavy chain monomer, forming a third antigen binding domain.
- a mAb-Fv bispecific antibody comprises a first monomer comprising a first VH domain, CH1 domain and a first Fc subunit, with a VL domain covalently attached to the C-terminus.
- the second monomer comprises a VH domain, a CH1 domain a second Fc subunit, and a VH covalently attached to the C-terminus of the second monomer.
- the two C-terminally attached variable domains make up a Fv.
- the mAb-Fv further comprises two light chains, which when associated with the first and second monomers form Fabs.
- the mAb-scFv bispecific format relies on the use of a C-terminal attachment of a scFv to one of the monomers of a mAb, thus forming a third antigen binding domain.
- the first monomer comprises a first heavy chain (comprising a VH, CH1 and a first Fc subunit), with a C- terminally covalently attached scFv.
- mAb-scFv bispecific antibodies further comprise a second monomer (comprising a VH, CH1, and first Fc subunit) and two light chains, which when associated with the first and second monomers form Fabs.
- the central-scFv bispecific format relies on the use of an inserted scFv domain in a mAb, thus forming a third antigen binding domain.
- the scFv domain is inserted between the Fc subunit and the CH1 domain of one of the monomers, thus providing a third antigen binding domain.
- the first monomer can comprise a VH domain, a CH1 domain (and optional hinge) and a first Fc subunit, with a scFv covalently attached between the C-terminus of the CH1 domain and the N-terminus of the first Fc subunit using optional domain linkers.
- the other monomer can be a standard Fab side monomer.
- Central-scFv bispecific antibodies further comprise two light chains, which when associated with the first and second monomers form Fabs.
- the central-Fv bispecific format relies on the use of an inserted Fv domain thus forming a third antigen binding domain.
- Each monomer can contain a component of the Fv (e.g. one monomer comprises a variable heavy domain and the other a variable light domain).
- one monomer can comprise a VH domain, a CH1 domain, a first Fc subunit and a VL domain covalently attached between the C-terminus of the CH1 domain and the N-terminus of the first Fc subunit, optionally using domain linkers.
- the other monomer can comprise a VH domain, a CH1 domain, a second Fc subunit and an additional VH domain covalently attached between the C-terminus of the CH1 domain and the N-terminus of the second Fc domain, optionally using domain linkers.
- Central-Fv bispecific antibodies further comprise two light chains, which when associated with the first and second monomers form Fabs.
- the one-armed central-scFv bispecific format comprises one monomer comprising just a Fc subunit, while the other monomer comprises an inserted scFv domain thus forming a second antigen binding domain.
- one monomer can comprise a VH domain, a CH1 domain and a first Fc subunit, with a scFv covalently attached between the C-terminus of the CH1 domain and the N-terminus of the first Fc subunit, optionally using domain linkers.
- the second monomer can comprise an Fc domain.
- This embodiment further utilizes a light chain comprising a variable light domain and a constant light domain, that associates with the first monomer to form a Fab.
- the dual scFv bispecific format comprises a first monomer comprising a scFv covalently attached to the N-terminus of a first Fc subunit, optionally via a linker, and second monomer comprising a scFv covalently attached to the N-terminus of a second Fc subunit, optionally via a linker.
- Bispecific antibodies of the disclosure can comprise an Fc domain composed of a first and a second subunit.
- the Fc domain is an IgG Fc domain.
- the Fc domain is an IgG 1 Fc domain.
- the Fc domain is an IgG 4 Fc domain.
- the Fc domain is an IgG 4 Fc domain comprising an amino acid substitution at position S228 (Kabat EU index numbering), particularly the amino acid substitution S228P.
- EU numbering system also called the EU index, as described in Kabat et al., 1991, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. This amino acid substitution reduces in vivo Fab arm exchange of IgG 4 antibodies (see Stubenrauch et al., 2010, Drug Metabolism and Disposition 38:84-91).
- the Fc domain is a human Fc domain.
- the Fc domain is a human IgG 1 Fc domain.
- An exemplary sequence of a human IgG 1 Fc region is given in SEQ ID NO:166.
- the Fc domain comprises a modification promoting the association of the first and the second subunit of the Fc domain.
- the site of most extensive protein-protein interaction between the two subunits of a human IgG Fc domain is in the CH3 domain.
- said modification is in the CH3 domain of the Fc domain.
- said modification promoting the association of the first and the second subunit of the Fc domain is a so-called “knob-into-hole” modification, comprising a “knob” modification in one of the two subunits of the Fc domain and a “hole” modification in the other one of the two subunits of the Fc domain.
- the knob-into-hole technology is described e.g., in US 5,731,168; US 7,695,936; Ridgway et al., 1996, Prot Eng 9:617-621, and Carter, J, 2001, Immunol Meth 248:7-15.
- the method involves introducing a protuberance (“knob”) at the interface of a first polypeptide and a corresponding cavity (“hole”) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation.
- Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g., tyrosine or tryptophan).
- Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine).
- an amino acid residue in the CH3 domain of the first subunit of the Fc domain is replaced with an amino acid residue having a larger side chain volume, thereby generating a protuberance within the CH3 domain of the first subunit which is positionable in a cavity within the CH3 domain of the second subunit, and an amino acid residue in the CH3 domain of the second subunit of the Fc domain is replaced with an amino acid residue having a smaller side chain volume, thereby generating a cavity within the CH3 domain of the second subunit within which the protuberance within the CH3 domain of the first subunit is positionable.
- said amino acid residue having a larger side chain volume is selected from the group consisting of arginine (R), phenylalanine (F), tyrosine (Y), and tryptophan (W).
- said amino acid residue having a smaller side chain volume is selected from the group consisting of alanine (A), serine (S), threonine (T), and valine (V).
- the protuberance and cavity can be made by altering the nucleic acid encoding the polypeptides, e.g. by site-specific mutagenesis, or by peptide synthesis.
- the threonine residue at position 366 is replaced with a tryptophan residue (T366W), and in the second subunit of the Fc domain the tyrosine residue at position 407 is replaced with a valine residue (Y407V) and optionally the threonine residue at position 366 is replaced with a serine residue (T366S) and the leucine residue at position 368 is replaced with an alanine residue (L368A) (numbering according to Kabat EU index).
- the serine residue at position 354 is replaced with a cysteine residue (S354C) or the glutamic acid residue at position 356 is replaced with a cysteine residue (E356C) (particularly the serine residue at position 354 is replaced with a cysteine residue), and in the second subunit of the Fc domain additionally the tyrosine residue at position 349 is replaced by a cysteine residue (Y349C) (numbering according to Kabat EU index).
- the first subunit of the Fc domain comprises the amino acid substitutions S354C and T366W
- the second subunit of the Fc domain comprises the amino acid substitutions Y349C, T366S, L368A and Y407V (numbering according to Kabat EU index).
- electrostatic steering e.g., as described in Gunasekaran et al., 2010, J Biol Chem 285(25):19637-46) can be used to promote the association of the first and the second subunit of the Fc domain.
- the Fc domain comprises one or more amino acid substitutions that reduces binding to an Fc receptor and/or effector function.
- the Fc receptor is an Fc ⁇ receptor.
- the Fc receptor is a human Fc receptor.
- the Fc receptor is an activating Fc receptor.
- the Fc receptor is an activating human Fc ⁇ receptor, more specifically human Fc ⁇ RIIIa, Fc ⁇ RI or Fc ⁇ RIIa, most specifically human Fc ⁇ RIIIa.
- the effector function is one or more selected from the group of complement dependent cytotoxicity (CDC), antibody-dependent cell-mediated cytotoxicity (ADCC), antibody- dependent cellular phagocytosis (ADCP), and cytokine secretion.
- the effector function is ADCC.
- the same one or more amino acid substitution is present in each of the two subunits of the Fc domain.
- the one or more amino acid substitution reduces the binding affinity of the Fc domain to an Fc receptor.
- the one or more amino acid substitution reduces the binding affinity of the Fc domain to an Fc receptor by at least 2-fold, at least 5-fold, or at least 10-fold.
- the Fc domain comprises an amino acid substitution at a position selected from the group of E233, L234, L235, N297, P331 and P329 (numberings according to Kabat EU index).
- the Fc domain comprises an amino acid substitution at a position selected from the group of L234, L235 and P329 (numberings according to Kabat EU index). In some embodiments, the Fc domain comprises the amino acid substitutions L234A and L235A (numberings according to Kabat EU index). In one such embodiment, the Fc domain is an IgG 1 Fc domain, particularly a human IgG 1 Fc domain. In one embodiment, the Fc domain comprises an amino acid substitution at position P329. In a more specific embodiment, the amino acid substitution is P329A or P329G, particularly P329G (numberings according to Kabat EU index).
- the Fc domain comprises an amino acid substitution at position P329 and a further amino acid substitution at a position selected from E233, L234, L235, N297 and P331 (numberings according to Kabat EU index).
- the further amino acid substitution is E233P, L234A, L235A, L235E, N297A, N297D or P331S.
- the Fc domain comprises amino acid substitutions at positions P329, L234 and L235 (numberings according to Kabat EU index).
- the Fc domain comprises the amino acid mutations L234A, L235A and P329G (“P329G LALA”, “PGLALA” or “LALAPG”).
- each subunit of the Fc domain comprises the amino acid substitutions L234A, L235A and P329G (Kabat EU index numbering), i.e. in each of the first and the second subunit of the Fc domain the leucine residue at position 234 is replaced with an alanine residue (L234A), the leucine residue at position 235 is replaced with an alanine residue (L235A) and the proline residue at position 329 is replaced by a glycine residue (P329G) (numbering according to Kabat EU index).
- the Fc domain is an IgG1 Fc domain, particularly a human IgG 1 Fc domain.
- Single chain-based bispecific antibodies of the disclosure can be any of the various types of single chain-based bispecific antibodies known in the art, such as bispecific T-cell engagers (BiTEs), diabodies, tandem diabodies (tandabs), dual-affinity retargeting molecules (DARTs), and bispecific killer cell engagers.
- BiTEs bispecific T-cell engagers
- diabodies diabodies
- tandem diabodies tandem diabodies
- DARTs dual-affinity retargeting molecules
- bispecific killer cell engagers bispecific killer cell engagers
- the bispecific antibodies of the disclosure are bispecific T-cell engagers (BiTEs).
- BiTEs are single polypeptide chain molecules that having two antigen- binding domains, one of which binds to a T-cell antigen and the second of which binds to an antigen present on the surface of a target (See, PCT Publication WO 05/061547; Baeuerle et al., 2008, Drugs of the Future 33: 137-147; Bargou, et al., 2008, Science 321:974-977, incorporated herein by reference in their entireties).
- the BiTEs of the disclosure have an antigen binding domain that binds to a T-cell antigen, and a second antigen binding domain that is directed towards glyco-CD44.
- the bispecific antibodies of the disclosure are dual-affinity retargeting molecules (DARTs).
- DARTs comprise at least two polypeptide chains that associate (especially through a covalent interaction) to form at least two epitope binding sites, which may recognize the same or different epitopes.
- Each of the polypeptide chains of a DART comprise an immunoglobulin light chain variable region and an immunoglobulin heavy chain variable region, but these regions do not interact to form an epitope binding site.
- the immunoglobulin heavy chain variable region of one (e.g., the first) of the DART polypeptide chains interacts with the immunoglobulin light chain variable region of a different (e.g., the second) DARTTM polypeptide chain to form an epitope binding site.
- the immunoglobulin light chain variable region of one (e.g., the first) of the DART polypeptide chains interacts with the immunoglobulin heavy chain variable region of a different (e.g., the second) DART polypeptide chain to form an epitope binding site.
- DARTs may be monospecific, bispecific, trispecific, etc., thus being able to simultaneously bind one, two, three or more different epitopes (which may be of the same or of different antigens).
- DARTs may additionally be monovalent, bivalent, trivalent, tetravalent, pentavalent, hexavalent, etc., thus being able to simultaneously bind one, two, three, four, five, six or more molecules.
- These two attributes of DARTs i.e., degree of specificity and valency
- one of the binding specificities is directed towards glyco-CD44, and the other is directed to an antigen expressed on immune effector cells.
- immune effector cell or “effector cell” as used herein refers to a cell within the natural repertoire of cells in the mammalian immune system which can be activated to affect the viability of a target cell.
- Immune effector cells include cells of the lymphoid lineage such as natural killer (NK) cells, T cells including cytotoxic T cells, or B cells, but also cells of the myeloid lineage can be regarded as immune effector cells, such as monocytes or macrophages, dendritic cells and neutrophilic granulocytes.
- said effector cell is preferably an NK cell, a T cell, a B cell, a monocyte, a macrophage, a dendritic cell or a neutrophilic granulocyte.
- Recruitment of effector cells to aberrant cells means that immune effector cells are brought in close vicinity to the aberrant target cells such that the effector cells can directly kill, or indirectly initiate the killing of the aberrant cells that they are recruited to.
- the bispecific antibodies of the disclosure specifically recognize antigens on immune effector cells that are at least over- expressed by these immune effector cells compared to other cells in the body.
- Target antigens present on immune effector cells may include CD3, CD8, CD16, CD25, CD28, CD64, CD89, NKG2D and NKp46.
- the antigen on immune effector cells is CD3 expressed on T cells.
- CD3 refers to any native CD3 from any vertebrate source, including mammals such as primates (e.g. humans), non-human primates (e.g. cynomolgus monkeys) and rodents (e.g. mice and rats), unless otherwise indicated.
- the term encompasses “full- length,” unprocessed CD3 as well as any form of CD3 that results from processing in the cell.
- the term also encompasses naturally occurring variants of CD3, e.g., splice variants or allelic variants.
- the most preferred antigen on an immune effector cell is the CD3 epsilon chain. This antigen has been shown to be very effective in recruiting T cells to aberrant cells.
- a bispecific antibody of the disclosure preferably specifically recognizes CD3 epsilon.
- the amino acid sequence of human CD3 epsilon is shown in UniProt (www.uniprot.org) accession no.
- bispecific antibodies in which the CD3- binding domain specifically binds to the CD3 in the species utilized for the preclinical testing (e.g., cynomolgus CD3 for primate testing) can be used.
- a binding domain that “specifically binds to” or “specifically recognizes” a target antigen from a particular species does not preclude the binding to or recognition of the antigen from other species, and thus encompasses antibodies in which one or more of the binding domains have inter-species cross-reactivity.
- a CD3-binding domain that “specifically binds to” or “specifically recognizes” human CD3 may also bind to or recognize cyomolgus CD3, and vice versa.
- a bispecific antibody of the disclosure can compete with monoclonal antibody H2C (described in PCT publication no. WO2008/119567) for binding an epitope of CD3.
- a bispecific antibody of the disclosure can compete with monoclonal antibody V9 (described in Rodrigues et al., 1992, Int J Cancer Suppl 7:45-50 and U.S. Pat. No.6,054,297) for binding an epitope of CD3.
- a bispecific antibody of the disclosure can compete with monoclonal antibody FN18 (described in Nooij et al., 1986, Eur J Immunol 19:981-984) for binding an epitope of CD3.
- a bispecific antibody of the disclosure can compete with monoclonal antibody SP34 (described in Pessano et al., 1985, EMBO J 4:337-340) for binding an epitope of CD3.
- the anti-glyco-CD44 antibodies of the disclosure include derivatized antibodies.
- derivatized antibodies are typically modified by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein. Any of numerous chemical modifications can be carried out by known techniques, including, but not limited to, specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative can contain one or more non-natural amino acids, e.g., using ambrx technology (See, e.g., Wolfson, 2006, Chem. Biol.13(10):1011-2).
- the anti-glyco-CD44 antibodies or binding fragments may be antibodies or fragments whose sequences have been modified to alter at least one constant region-mediated biological effector function.
- an anti-glyco-CD44 antibody may be modified to reduce at least one constant region-mediated biological effector function relative to the unmodified antibody, e.g., reduced binding to the Fc receptor (Fc ⁇ R).
- Fc ⁇ R binding can be reduced by mutating the immunoglobulin constant region segment of the antibody at particular regions necessary for Fc ⁇ R interactions (See, e.g., Canfield and Morrison, 1991, J. Exp. Med. 173:1483-1491; and Lund et al., 1991, J.
- the anti-glyco-CD44 antibody or binding fragments described herein include antibodies and/or binding fragments that have been modified to acquire or improve at least one constant region-mediated biological effector function relative to an unmodified antibody, e.g., to enhance Fc ⁇ R interactions (See, e.g., US 2006/0134709).
- an anti-glyco-CD44 antibody of the disclosure can have a constant region that binds Fc ⁇ RIIA, Fc ⁇ RIIB and/or Fc ⁇ RIIIA with greater affinity than the corresponding wild type constant region.
- antibodies of the disclosure may have alterations in biological activity that result in increased or decreased opsonization, phagocytosis, or ADCC. Such alterations are known in the art. For example, modifications in antibodies that reduce ADCC activity are described in U.S. Pat. No.5,834,597. An exemplary ADCC lowering variant corresponds to “mutant 3” (shown in FIG.4 of U.S. Pat.
- ADCC lowering variant comprises amino acid mutations L234A, L235A and P329G (“P329G LALA”).
- P329G LALA amino acid mutations L234A, L235A and P329G
- the “P329G LALA” combination of amino acid substitutions almost completely abolishes Fc ⁇ receptor (as well as complement) binding of a human IgG 1 Fc domain, as described in PCT publication no. WO 2012/130831, incorporated herein by reference in its entirety.
- WO 2012/130831 also describes methods of preparing such mutant Fc domains and methods for determining its properties such as Fc receptor binding or effector functions.
- the anti-glyco-CD44 antibodies of the disclosure have low levels of, or lack, fucose.
- Antibodies lacking fucose have been correlated with enhanced ADCC activity, especially at low doses of antibody. See Shields et al., 2002, J. Biol. Chem.277:26733- 26740; Shinkawa et al., 2003, J. Biol. Chem.278:3466-73.
- Methods of preparing fucose-less antibodies include growth in rat myeloma YB2/0 cells (ATCC CRL 1662).
- the anti-glyco-CD44 antibodies or binding fragments include bisected oligosaccharides, e.g., in which a biantennary oligosaccharide attached to an Fc domain is bisected by GlcNAc. Such variants may have reduced fucosylation and/or improved ADCC function as described above.
- the anti-glyco-CD44 antibodies or binding fragments include modifications that increase or decrease their binding affinities to the fetal Fc receptor, FcRn, for example, by mutating the immunoglobulin constant region segment at particular regions involved in FcRn interactions (see, e.g., WO 2005/123780).
- an anti- glyco-CD44 antibody of the IgG class is mutated such that at least one of amino acid residues 250, 314, and 428 of the heavy chain constant region is substituted alone, or in any combinations thereof, such as at positions 250 and 428, or at positions 250 and 314, or at positions 314 and 428, or at positions 250, 314, and 428, with positions 250 and 428 a specific combination.
- the substituting amino acid residue can be any amino acid residue other than threonine, including, but not limited to, alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, leucine, methionine, asparagine, proline, glutamine, arginine, serine, valine, tryptophan, or tyrosine.
- the substituting amino acid residue can be any amino acid residue other than leucine, including, but not limited to, alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, methionine, asparagine, proline, glutamine, arginine, serine, threonine, valine, tryptophan, or tyrosine.
- the substituting amino acid residues can be any amino acid residue other than methionine, including, but not limited to, alanine, cysteine, aspartic acid, glutamic acid, phenylalanine, glycine, histidine, isoleucine, lysine, leucine, asparagine, proline, glutamine, arginine, serine, threonine, valine, tryptophan, or tyrosine.
- Specific combinations of suitable amino acid substitutions are identified in Table 1 of U.S. Pat. No.7,217,797, which is incorporated herein by reference. Such mutations increase binding to FcRn, which protects the antibody from degradation and increases its half-life.
- an anti-glyco-CD44 antibody of antigen-binding fragment of the disclosure has one or more amino acids inserted into one or more of its hypervariable regions, for example as described in Jung and Pluckthun, 1997, Protein Engineering 10:9, 959-966; Yazaki et al., 2004, Protein Eng. Des Sel.17(5):481-9. Epub 2004 Aug.17; and U.S. Pat. App. No.2007/0280931.
- an anti-glyco-CD44 antibody of antigen-binding fragment of the disclosure is attached to a detectable moiety.
- Detectable moieties include a radioactive moiety, a colorimetric molecule, a fluorescent moiety, a chemiluminescent moiety, an antigen, an enzyme, a detectable bead (such as a magnetic or electrodense (e.g., gold bead), or a molecule that binds to another molecule (e.g., biotin or streptavidin)).
- Radioisotopes or radionuclides may include 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 111 In, 125 I, 131 I.
- Fluorescent labels may include rhodamine, lanthanide phosphors, fluorescein and its derivatives, fluorochrome, GFP (GFP for “Green Fluorescent Protein”), dansyl, umbelliferone, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde, and fluorescamine.
- GFP Green Fluorescent Protein
- Enzymatic labels may include horseradish peroxidase, ⁇ galactosidase, luciferase, alkaline phosphatase, glucose-6-phosphate dehydrogenase (“G6PDH”), alpha-D-galactosidase, glucose oxidase, glucose amylase, carbonic anhydrase, acetylcholinesterase, lysozyme, malate dehydrogenase and peroxidase.
- Chemiluminescent labels or chemiluminescers such as isoluminol, luminol and the dioxetanes.
- detectable moieties include molecules such as biotin, digoxygenin or 5- bromodeoxyuridine.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure may be used in a detection system to detect a biomarker in a sample, such as, e.g., a patient-derived biological sample.
- the biomarker may be a protein biomarker (e.g., a tumor- associated glycoform of CD44, for example a glycoform of CD44v6, GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text (the “CD44v6 glycopeptide”) present on the surface of or within, e.g., a cancer cell (e.g., from a tissue biopsy or a circulating tumor cell) or a cancer-derived extracellular vesicle.
- Extracellular vesicles are lipid membranous vesicles released from almost all cell types.
- EVs carry complex molecular cargoes, such as proteins, RNAs (e.g., mRNA and noncoding RNAs (microRNA, transfer RNA, circular RNA and long noncoding RNA)), and DNA fragments.
- RNAs e.g., mRNA and noncoding RNAs (microRNA, transfer RNA, circular RNA and long noncoding RNA)
- DNA fragments e.g., DNA fragments.
- the molecular contents of EVs largely reflect the cell of origin and thus show cell- type specificity.
- cancer-derived EVs contain and present on their surfaces cancer- specific molecules expressed by parental cancer cells (see, e.g., Yá ⁇ ez-Mó et al., 2015, J Extracell Vesicles.4:27066; and Li et al., 2015, Cell Res.25:981-984)
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure is used in a method of detecting a biomarker in a sample comprising EVs (e.g., a liquid biopsy).
- the biomarker is recognized by the anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure.
- the biomarker may be present on the surface of EVs.
- Exemplary methods of detecting the biomarker include, but are not limited to, immunoassays, such as immunoprecipitation; Western blot; ELISA; immunohistochemistry; immunocytochemistry; flow cytometry; and immuno-PCR.
- an immunoassay can be a chemiluminescent immunoassay.
- an immunoassay can be a high-throughput and/or automated immunoassay platform.
- the method of detecting a biomarker in a sample comprises contacting a sample with an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure. In some embodiments, such methods further comprise contacting the sample with one or more detection labels.
- an anti-glyco-CD44 antibody or antigen- binding fragment of the disclosure is labeled with one or more detection labels.
- a capture assay is performed to selectively capture EVs from a sample such as a liquid biopsy sample exemplary examples of capture assays for EVs are described in US2021/0214806, which is hereby incorporated by reference in its entirety.
- a capture assay is performed to selectively capture EVs of a certain size range, and/or certain characteristic(s), for example, EVs associated with cancer (e.g., a tumor- associated glycoform of CD44, for example a glycoform of CD44v6, GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text (the “CD44v6 glycopeptide”) present on the surface of or within, e.g., a cancer cell or a cancer-derived extracellular vesicle.
- cancer e.g., a tumor- associated glycoform of CD44, for example a glycoform of CD44v6, GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text (the “CD44v6 glycopeptide”) present on the surface of or within
- a sample prior to performing the capture assay, a sample may be pre-processed to remove non-EVs, including but not limited to, e.g., soluble proteins and interfering entities such as, e.g., cell debris.
- EVs are purified from a sample using size exclusion chromatography.
- the method for detecting a biomarker comprises analyzing individual EVs (e.g., a single EV assay).
- such an assay may involve (i) a capture assay such as an antibody capture assay and (ii) one or more detection assays for at least one or more additional biomarkers, wherein the capture assay is performed prior to the detection assay.
- a capture assay comprises a step of contacting a sample with at least one capture agent comprising an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure.
- the capture agent may be immobilized on a solid substrate.
- the solid substrate may be provided in a form that is suitable for capturing EVs and does not interfere with downstream handling, processing, and/or detection.
- a solid substrate may be or comprise a bead (e.g., a magnetic bead).
- a solid substrate may be or comprise a surface.
- such a surface may be a capture surface of an assay chamber (e.g., a tube, a well, a microwell, a plate, a filter, a membrane, a matrix, etc.).
- a capture agent is or comprises a magnetic bead comprising a capture moiety (e.g., an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure) conjugated thereto. See, e.g., US2021/0214806.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure competes with 4C8 or an antibody or antigen-binding fragment comprising heavy and light chain variable regions of 4C8 (SEQ ID NOS:1-2, respectively).
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure competes with 2B2 or an antibody or antigen-binding fragment comprising heavy and light chain variable regions of 2B2 (SEQ ID NOS:23-24, respectively).
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure competes with 18G9 or an antibody or antigen-binding fragment comprising heavy and light chain variable regions of 18G9 (SEQ ID NOS:45-46, respectively).
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure competes with 1D12 or an antibody or antigen-binding fragment comprising heavy and light chain variable regions of 1D12 (SEQ ID NOS:67-68, respectively).
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure competes with 10H4 or an antibody or antigen-binding fragment comprising heavy and light chain variable regions of 10H4 (SEQ ID NOS:206-207, respectively).
- Competition can be assayed on cells that express the glyco-CD44 epitope bound by 4C8, 2B2, 18G9, 1D12, or 10H4 or on a glycosylated CD44 peptide containing the epitope bound by 4C8, 2B2, 18G9, 1D12, or 10H4, e.g., the CD44v6 glycopeptide.
- Cells that do not express the epitope or unglycosylated peptides can be used as controls.
- Cells on which a competition assay can be carried out include but are not limited to COSMC knock-out HaCaT cells and recombinant cells (e.g., COSMC knock-out HEK293 cells) that are engineered to express the glyco-CD44 epitope.
- HEK293 cells which are inherently Tn-negative but can be induced to express the Tn-antigen by knock- out of the COSMC chaperone, are engineered to express CD44, yielding cells expressing the Tn glycoform of CD44 to which 4C8, 2B2, 18G9, 1D12, and 10H4 bind.
- Cells expressing the unglycosylated form of CD44 can be used as a negative control.
- Cells expressing the Tn- antigen can also be generated, for example, by treating CD44 expressing cells with a glycosylation inhibitor, knock out of core-1 synthase or ZIP9, or by cleavage of existing glycans.
- Assays for competition include, but are not limited to, a radioactive material labeled immunoassay (RIA), an enzyme-linked immunosorbent assay (ELISA), a sandwich ELISA, fluorescence activated cell sorting (FACS) assays, surface plasmon resonance (e.g., Biacore) assays, and bio-layer interferometry (BLI) assays.
- RIA radioactive material labeled immunoassay
- ELISA enzyme-linked immunosorbent assay
- FACS fluorescence activated cell sorting
- surface plasmon resonance e.g., Biacore
- BLI bio-layer interferometry
- antibody competition assays can be carried out using BLI (e.g., using an Octet-HTX system (Molecular Devices)).
- Antibody competition or epitope binning of monoclonal antibodies can be assessed in tandem against their specific antigen using BLI.
- the antigen in a BLI assay, can be immobilized onto a biosensor and presented to two competing antibodies in consecutive steps. The binding to non- overlapping epitopes occurs if saturation with the first antibody does not block the binding of the second antibody.
- antibody competition assays can be carried out using surface plasmon resonance (e.g., using a Biacore system (Cytiva)).
- one or more antibodies can be immobilized onto a biosensor and presented with an analyte (e.g., the glyco-CD44v6 peptide of SEQ ID NO:165 or a negative control analyte such as a glyco-MUC1 peptide of SEQ ID NO:205 or SEQ ID NO:260 or an unglycosylated CD44v6 peptide of SEQ ID NO:165).
- analyte e.g., the glyco-CD44v6 peptide of SEQ ID NO:165 or a negative control analyte such as a glyco-MUC1 peptide of SEQ ID NO:205 or SEQ ID NO:260 or an unglycosylated CD44v6 peptide of SEQ ID NO:165.
- the antibodies are contacted with a saturating concentration of the analyte, for example a concentration of at least about 0.5 ⁇ M. In some embodiments the saturating concentration is about 1 ⁇ M, about 1.5 ⁇ M
- the affinities of both antibodies are preferably measured using the same concentration of both antibodies, e.g., measured using a 1 ⁇ M concentration of each antibody.
- a detectable label such as a fluorophore, biotin or an enzymatic (or even radioactive) label to enable subsequent identification.
- cells expressing glyco-CD44 are incubated with unlabeled test antibody, labeled reference antibody is added, and the intensity of the bound label is measured.
- the intensity will be decreased relative to a control reaction carried out without test antibody.
- concentration of labeled reference antibody that yields 80% of maximal binding (“conc 80% ”) under the assay conditions is first determined, and a competition assay carried out with 10 x conc 80% of unlabeled test antibody and conc 80% of labeled reference antibody.
- K i inhibition constant
- IC 50 concentration of test antibody that yields a 50% reduction in binding of the reference antibody
- K D dissociation constant of the reference antibody, a measure of its affinity for glyco-CD44.
- Antibodies that compete with anti-glyco-CD44 antibodies disclosed herein can have a K i from 10 pM to 10 nM under assay conditions described herein.
- a test antibody is considered to compete with a reference antibody if it decreases binding of the reference antibody by at least about 20% or more, for example, by at least about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95% or even more, or by a percentage ranging between any of the foregoing values, at a reference antibody concentration that is 80% of maximal binding under the specific assay conditions used, and a test antibody concentration that is 10-fold higher than the reference antibody concentration.
- the CD44v6 glycopeptide is adhered onto a solid surface, e.g., a microwell plate, by contacting the plate with a solution of the peptide (e.g., at a concentration of 1 ⁇ g/mL in PBS over night at 4°C).
- a solution of the peptide e.g., at a concentration of 1 ⁇ g/mL in PBS over night at 4°C.
- the plate is washed (e.g., 0.1% Tween 20 in PBS) and blocked (e.g., in Superblock, Thermo Scientific, Rockford, IL).
- a mixture of sub- saturating amount of biotinylated 4C8, 2B2, 18G9, 1D12, or 10H4 e.g., at a concentration of 80 ng/mL
- unlabeled antibody the “reference” antibody
- competing anti-glyco-CD44 antibody the “test” antibody
- serial dilution e.g., at a concentration of 2.8 ⁇ g/mL, 8.3 ⁇ g/mL, or 25 ⁇ g/mL
- ELISA buffer e.g., 1% BSA and 0.1% Tween 20 in PBS
- the plate is washed, 1 ⁇ g/mL HRP-conjugated Streptavidin diluted in ELISA buffer is added to each well and the plates incubated for 1 hour. Plates are washed and bound antibodies detected by addition of substrate (e.g., TMB, Biofx Laboratories Inc., Owings Mills, MD). The reaction is terminated by addition of stop buffer (e.g., Bio FX Stop Reagents, Biofx Laboratories Inc., Owings Mills, MD) and the absorbance is measured at 650 nm using microplate reader (e.g., VERSAmax, Molecular Devices, Sunnyvale, CA).
- substrate e.g., TMB, Biofx Laboratories Inc., Owings Mills, MD
- stop buffer e.g., Bio FX Stop Reagents, Biofx Laboratories Inc., Owings Mills, MD
- the absorbance is measured at 650 nm using microplate reader (e.g.,
- Variations on this competition assay can also be used to test competition between 4C8, 2B2, 18G9, 1D12, 10H4 and another anti-glyco-CD44 antibodies.
- the anti-glyco-CD44 antibody is used as a reference antibody and 4C8, 2B2, 18G9, 1D12, or 10H4 is used as a test antibody.
- membrane-bound glyco-CD44 expressed on cell surface for example on the surface of one of the cell types mentioned above
- transfectants e.g., about 10 5 transfectants, are used.
- an anti-glyco-CD44 antibody of the disclosure reduces the binding of labeled 4C8, 2B2, 18G9, 1D12, or 10H4 by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by a percentage ranging between any of the foregoing values (e.g., an anti-glyco-CD44 antibody of the disclosure reduces the binding of labeled 4C8, 2B2, 18G9, 1D12, or 10H4 by 50% to 70%) when the anti-glyco-CD44 antibody is used at a concentration of 0.08 ⁇ g/mL, 0.4 ⁇ g/mL, 2 ⁇ g/mL, 10 ⁇ g/mL, 50 ⁇ g/mL, 100 ⁇ g/mL or at a concentration ranging between any of the foregoing values (e.g., at a concentration ranging
- 4C8, 2B2, 18G9, 1D12, or 10H4 reduces the binding of a labeled anti-glyco-CD44 antibody of the disclosure by at least 40%, by at least 50%, by at least 60%, by at least 70%, by at least 80%, by at least 90%, or by a percentage ranging between any of the foregoing values (e.g., 4C8, 2B2, 18G9, 1D12, or 10H4 reduces the binding of a labeled an anti-glyco-CD44 antibody of the disclosure by 50% to 70%) when 4C8, 2B2, 18G9, 1D12, or 10H4 is used at a concentration of 0.4 ⁇ g/mL, 2 ⁇ g/mL, 10 ⁇ g/mL, 50 ⁇ g/mL, 250 ⁇ g/mL or at a concentration ranging between any of the foregoing values (e.g., at a concentration ranging from 2 ⁇ g/mL to 10 ⁇ g/m
- the 4C8, 2B2, 18G9, 1D12, or 10H4 antibody can be replaced by any antibody or antigen-binding fragment comprising the CDRs or the heavy and light chain variable regions of 4C8, 2B2, 18G9, 1D12, or 10H4, such as a humanized or chimeric counterpart of 4C8, 2B2, 18G9, 1D12, or 10H4.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure has an epitope which is the same or similar to the epitope of 4C8, 2B2, 18G9, 1D12, or 10H4.
- the epitope of an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure can be characterized by performing alanine scanning.
- the antibody or antigen-binding fragment’s epitope can be mapped.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy and/or light chain variable sequences (or encoded by the nucleotide sequences) set forth in Tables 1A-1E.
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure comprises heavy and/or light chain CDR sequences (or encoded by the nucleotide sequences) set forth in Tables 1-3.
- the framework sequences for such anti-glyco-CD44 antibody and antigen-binding fragment can be the native murine framework sequences of the VH and VL sequences set forth in Tables 1A-1D, the native rabbit framework sequence of the VH and VL sequence set forth in Table 1E, or can be non-native (e.g., humanized or human) framework sequences.
- the disclosure provides an anti-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NOS:1-2, respectively.
- the disclosure provides an anti-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NOS:23-24, respectively.
- the disclosure provides an anti-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NOS:45-46, respectively.
- the disclosure provides an anti-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NOS:67-68, respectively.
- the disclosure provides an anti-CD44 antibody or antigen-binding fragment having heavy and light chain variable regions having at least 95%, 98%, 99%, or 99.5% sequence identity to SEQ ID NOS:206-207, respectively.
- the disclosure provides an anti-CD44 antibody or antigen-binding fragment having a heavy chain variable region having at least 95%, 98%, 99%, or 99.5% sequence identity to a heavy chain variable region set forth in Tables 4A-D (e.g., SEQ ID NO:263, 265, 266, 267, 269, 270, 271, 272, 274, or 276), and a light chain variable region having at least 95%, 98%, 99%, or 99.5% sequence identity to a light chain variable region of Tables 4E-G (e.g., SEQ ID NO:277, 278, 279, 281, 282, 283, 285, 286, or 287).
- an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure is a single-chain variable fragment (scFv).
- An exemplary scFv comprises the heavy chain variable fragment N-terminal to the light chain variable fragment.
- Another exemplary scFv comprises the light chain variable fragment N-terminal to the heavy chain variable fragment.
- the scFv heavy chain variable fragment and light chain variable fragment are covalently bound to a linker sequence of 4-15 amino acids.
- the scFv can be in the form of a bi-specific T-cell engager or within a chimeric antigen receptor (CAR).
- ADCs antibody drug conjugates
- the ADCs generally comprise an anti-glyco-CD44 antibody and/or binding fragment as described herein having one or more cytotoxic and/or cytostatic agents linked thereto by way of one or more linkers.
- the ADCs are compounds according to structural formula (I): [D-L-XY] n -Ab or salts thereof, where each “D” represents, independently of the others, a cytotoxic and/or cytostatic agent (“drug”); each “L” represents, independently of the others, a linker; “Ab” represents an anti-glyco-CD44 antigen binding domain, such as an anti-glyco-CD44 antibody or binding fragment described herein; each “XY” represents a linkage formed between a functional group R x on the linker and a "complementary" functional group R y on the antibody, and n represents the number of drugs linked to, or drug-to-antibody ratio (DAR), of the ADC.
- DAR drug-to-antibody ratio
- the various antibodies (Ab) that can comprise the ADCs include the various embodiments of anti-glyco-CD44 antibodies and/or binding fragments described above.
- each D is the same and/or each L is the same.
- the ADC comprises an amanitin toxin.
- Amanitins are bicyclic peptides of eight amino acids that are naturally occurring poisons found in several species of the Amanita genus of mushrooms. Amanitin toxins inhibit RNA polymerase II, which results in apoptosis of a cell.
- a glycan of an anti-glyco-CD44 antibodies and antigen-binding fragments of the disclosure can be modified and a cytotoxic and/or cytostatic agent attached to the glycan. Van Geel et al., 2015, Bioconjugate Chem.26(11):2233-2242.
- a chemoenzymatic protocol provides for the highly controlled attachment of a drug to an N-glycan at or around Asn-297 via two stages: i) enzymatic remodeling via trimming and tagging with azide; and ii) ligation of a drug via copper- free click chemistry.
- Such methods are applicable to any IgG isotype, irrespective of glycosylation profile.
- compositions and methods for conjugating a drug to a glycan of an anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure are described, for example, in WO 2015/057063; WO 2015/057064; WO 2015/057065; WO 2015/057066; WO 2015/112013; WO 2016/022027; WO 2016/053107; WO 2016/170186; WO 2017/137423; WO 2017/137456; and WO 2017/137457, each of which is hereby incorporated by reference in its entirety.
- cytotoxic and/or cytostatic agents (D) and linkers (L) that can comprise the anti-glyco-CD44 ADCs of the disclosure, as well as the number of cytotoxic and/or cytostatic agents linked to the ADCs, are described in more detail below. 6.2.1. Cytotoxic and/or Cytostatic Agents [0151]
- the cytotoxic and/or cytostatic agents may be any agents known to inhibit the growth and/or replication of and/or kill cells, and in particular cancer and/or tumor cells. Numerous agents having cytotoxic and/or cytostatic properties are known in the literature.
- Non-limiting examples of classes of cytotoxic and/or cytostatic agents include, by way of example and not limitation, radionuclides, alkylating agents, topoisomerase I inhibitors, topoisomerase II inhibitors, DNA intercalating agents (e.g., groove binding agents such as minor groove binders), RNA/DNA antimetabolites, cell cycle modulators, kinase inhibitors, protein synthesis inhibitors, histone deacetylase inhibitors, mitochondria inhibitors, and antimitotic agents.
- radionuclides e.g., alkylating agents, topoisomerase I inhibitors, topoisomerase II inhibitors, DNA intercalating agents (e.g., groove binding agents such as minor groove binders), RNA/DNA antimetabolites, cell cycle modulators, kinase inhibitors, protein synthesis inhibitors, histone deacetylase inhibitors, mitochondria inhibitors, and antimitotic agents.
- Alkylating Agents asaley ((L-Leucine, N-[N-acetyl-4-[bis-(2-chloroethyl)amino]-DL- phenylalanyl]-, ethylester; NSC 167780; CAS Registry No.3577897)); AZQ ((1,4- cyclohexadiene-1,4-dicarbamic acid, 2,5-bis(1-aziridinyl)-3,6-dioxo-, diethyl ester; NSC 182986; CAS Registry No.57998682)); BCNU ((N,N'-Bis(2-chloroethyl)-N-nitrosourea; NSC 409962; CAS Registry No.154938)); busulfan (1,4-butanediol dimethanesulfonate; NSC 750; CAS Registry No.55981); (carboxyphthalato)platinum (
- melphalan NSC 8806; CAS Registry No.3223072
- methyl CCNU ((1-(2- chloroethyl)-3-(trans-4-methylcyclohexane)-1-nitrosourea; NSC 95441; 13909096); mitomycin C (NSC 26980; CAS Registry No.50077); mitozolamide (NSC 353451; CAS Registry No.
- NSC 762; CAS Registry No.55867 nitrogen mustard ((bis(2-chloroethyl)methylamine hydrochloride; NSC 762; CAS Registry No.55867); PCNU ((1-(2-chloroethyl)-3-(2,6-dioxo-3-piperidyl)-1-nitrosourea; NSC 95466; CAS Registry No.13909029)); piperazine alkylator ((1-(2-chloroethyl)-4-(3- chloropropyl)-piperazine dihydrochloride; NSC 344007)); piperazinedione (NSC 135758; CAS Registry No.41109802); pipobroman ((N,N-bis(3-bromopropionyl) piperazine; NSC 25154; CAS Registry No.54911)); porfiromycin (N-methylmitomycin C; NSC 56410; CAS Registry No.
- spirohydantoin mustard (NSC 172112; CAS Registry No.56605164); teroxirone (triglycidylisocyanurate; NSC 296934; CAS Registry No.2451629); tetraplatin (NSC 363812; CAS Registry No.62816982); thio-tepa (N,N',N''-tri-1,2-ethanediylthio phosphoramide; NSC 6396; CAS Registry No.52244); triethylenemelamine (NSC 9706; CAS Registry No.51183); uracil nitrogen mustard (desmethyldopan; NSC 34462; CAS Registry No.66751); Yoshi-864 ((bis(3-mesyloxy propyl)amine hydrochloride; NSC 102627; CAS Registry No.3458228).
- Topoisomerase I Inhibitors camptothecin (NSC 94600; CAS Registry No.7689-03-4); various camptothecin derivatives and analogs (for example, NSC 100880, NSC 603071, NSC 107124, NSC 643833, NSC 629971, NSC 295500, NSC 249910, NSC 606985, NSC 74028, NSC 176323, NSC 295501, NSC 606172, NSC 606173, NSC 610458, NSC 618939, NSC 610457, NSC 610459, NSC 606499, NSC 610456, NSC 364830, and NSC 606497); morpholinisoxorubicin (NSC 354646; CAS Registry No.89196043); SN-38 (NSC 673596; CAS Registry No.86639-52-3).
- camptothecin NSC 94600; CAS Registry No.7689-03-4
- Topoisomerase II Inhibitors doxorubicin (NSC 123127; CAS Registry No.25316409); amonafide (benzisoquinolinedione; NSC 308847; CAS Registry No.69408817); m-AMSA ((4'- (9-acridinylamino)-3'-methoxymethanesulfonanilide; NSC 249992; CAS Registry No.
- anthrapyrazole derivative ((NSC 355644); etoposide (VP-16; NSC 141540; CAS Registry No.33419420); pyrazoloacridine ((pyrazolo[3,4,5-kl]acridine-2(6H)-propanamine, 9- methoxy-N, N-dimethyl-5-nitro-, monomethanesulfonate; NSC 366140; CAS Registry No.
- DNA Intercalating Agents anthramycin (CAS Registry No.4803274); chicamycin A (CAS Registry No.89675376); tomaymycin (CAS Registry No.35050556); DC-81 (CAS Registry No.81307246); sibiromycin (CAS Registry No.12684332); pyrrolobenzodiazepine derivative (CAS Registry No.945490095); SGD-1882 ((S)-2-(4-aminophenyl)-7-methoxy-8-(3- 4(S)-7-methoxy-2-(4-methoxyphenyl)-- 5-oxo-5,11a-dihydro-1H-benzo[e]pyrrolo[1,2- a][1,4]diazepin-8-yl)oxy)propox-
- RNA/DNA Antimetabolites L-alanosine (NSC 153353; CAS Registry No.59163416); 5- azacytidine (NSC 102816; CAS Registry No.320672); 5-fluorouracil (NSC 19893; CAS Registry No.51218); acivicin (NSC 163501; CAS Registry No.42228922); aminopterin derivative N-[2-chloro-5-[[(2,4-diamino-5-methyl-6-quinazolinyl)methyl]amino]benzoyl- ]L- aspartic acid (NSC 132483); aminopterin derivative N-[4-[[(2,4-diamino-5-ethyl-6- quinazolinyl)methyl]amino]benzoyl]L-asparti- c acid (NSC 184692); aminopterin derivative N-[2- chloro-4-[[(2,4-diamino-6-p
- NSC 368390; CAS Registry No.96201886 ftorafur ((pro-drug; 5-fluoro- 1-(tetrahydro-2-furyl)-uracil; NSC 148958; CAS Registry No.37076689); 5,6-dihydro-5- azacytidine (NSC 264880; CAS Registry No.62402317); methotrexate (NSC 740; CAS Registry No.59052); methotrexate derivative (N-[[4-[[(2,4-diamino-6- pteridinyl)methyl]methylamino]-1-naphthalenyl]car- bonyl]L-glutamic acid; NSC 174121); PALA ((N-(phosphonoacetyl)-L-aspartate; NSC 224131; CAS Registry No.603425565); pyrazofurin (NSC 143095; CAS Registry No.
- DNA Antimetabolites 3-HP (NSC 95678; CAS Registry No.3814797); 2'-deoxy-5- fluorouridine (NSC 27640; CAS Registry No.50919); 5-HP (NSC 107392; CAS Registry No. 19494894); ⁇ -TGDR ( ⁇ -2'-deoxy-6-thioguanosine; NSC 71851 CAS Registry No.2133815); aphidicolin glycinate (NSC 303812; CAS Registry No.92802822); ara C (cytosine arabinoside; NSC 63878; CAS Registry No.69749); 5-aza-2'-deoxycytidine (NSC 127716; CAS Registry No.
- Cell Cycle Modulators silibinin (CAS Registry No.22888-70-6); epigallocatechin gallate (EGCG; CAS Registry No.989515); procyanidin derivatives (e.g., procyanidin A1 [CAS Registry No.103883030], procyanidin B1 [CAS Registry No.20315257], procyanidin B4 [CAS Registry No.29106512], arecatannin B1 [CAS Registry No.79763283]); isoflavones (e.g., genistein [4%5,7-trihydroxyisoflavone; CAS Registry No.446720], daidzein [4',7- dihydroxyisoflavone, CAS Registry No.486668]; indole-3-carbinol (CAS Registry No.700061); quercetin (NSC 9219; CAS Registry No.117395); estramustine (NSC 89201; CAS Registry No.
- ARRY-438162 (binimetinib) (CAS Registry No.606143899); bosutinib (CAS Registry No.380843754); cabozantinib (CAS Registry No.1140909483); ceritinib (CAS Registry No.1032900256); crizotinib (CAS Registry No.877399525); dabrafenib (CAS Registry No.1195765457); dasatinib (NSC 732517; CAS Registry No.302962498); erlotinib (NSC 718781; CAS Registry No.183319699); everolimus (NSC 733504; CAS Registry No.
- ARRY-142886 (selumetinib) (NSC 741078; CAS Registry No.606143-52-6); sirolimus (NSC 226080; CAS Registry No.53123889); sorafenib (NSC 724772; CAS Registry No.475207591); sunitinib (NSC 736511; CAS Registry No.341031547); tofacitinib (CAS Registry No.477600752); temsirolimus (NSC 683864; CAS Registry No.163635043); trametinib (CAS Registry No.871700173); vandetanib (CAS Registry No.443913733); vemurafenib (CAS Registry No.918504651); SU6656 (CAS Registry No.330161870); CEP- 701 (lesaurtinib) (CAS Registry No.111358884); XL019 (CAS Registry No.945755566); PD- 32
- Protein Synthesis Inhibitors acriflavine (CAS Registry No.65589700); amikacin (NSC 177001; CAS Registry No.39831555); arbekacin (CAS Registry No.51025855); astromicin (CAS Registry No.55779061); azithromycin (NSC 643732; CAS Registry No.83905015); bekanamycin (CAS Registry No.4696768); chlortetracycline (NSC 13252; CAS Registry No.
- ketolides such as telithromycin (CAS Registry No.191114484), cethromycin (CAS Registry No.205110481), and solithromycin (CAS Registry No.760981837); lincomycin (CAS Registry No.154212); lymecycline (CAS Registry No.992212); meclocycline (NSC 78502; CAS Registry No.2013583); metacycline (rondomycin; NSC 356463; CAS Registry No.914001); midecamycin (CAS Registry No.35457808); minocycline (NSC 141993; CAS Registry No.
- miocamycin CAS Registry No.55881077
- neomycin CAS Registry No.119040
- netilmicin CAS Registry No.56391561
- oleandomycin CAS Registry No.3922905
- oxazolidinones such as eperezolid (CAS Registry No.165800044), linezolid (CAS Registry No. 165800033), posizolid (CAS Registry No.252260029), radezolid (CAS Registry No. 869884786), ranbezolid (CAS Registry No.392659380), tilezolid (CAS Registry No.
- 168828588 tedizolid
- oxytetracycline NSC 9169; CAS Registry No.2058460
- paromomycin CAS Registry No.7542372
- penimepicycline CAS Registry No.4599604
- peptidyl transferase inhibitors e.g., chloramphenicol (NSC 3069; CAS Registry No.56757) and derivatives such as azidamfenicol (CAS Registry No.13838089), florfenicol (CAS Registry No.73231342), and thiamphenicol (CAS Registry No.15318453
- pleuromutilins such as rumblemulin (CAS Registry No.224452668), tiamulin (CAS Registry No.
- valnemulin CAS Registry No.101312929
- pirlimycin CAS Registry No. 79548735
- puromycin NSC 3055; CAS Registry No.53792
- quinupristin CAS Registry No. 120138503
- ribostamycin CAS Registry No.53797356
- rokitamycin CAS Registry No. 74014510
- rolitetracycline CAS Registry No.751973
- roxithromycin CAS Registry No. 80214831
- sisomicin CAS Registry No.32385118
- spectinomycin CAS Registry No.
- spiramycin CAS Registry No.8025818
- streptogramins such as pristinamycin (CAS Registry No.270076603), quinupristin/dalfopristin (CAS Registry No.126602899), and virginiamycin (CAS Registry No.11006761); streptomycin (CAS Registry No.57921); tetracycline (NSC 108579; CAS Registry No.60548); tobramycin (CAS Registry No. 32986564); troleandomycin (CAS Registry No.2751099); tylosin (CAS Registry No.1401690); verdamicin (CAS Registry No.49863481).
- Histone Deacetylase Inhibitors abexinostat (CAS Registry No.783355602); belinostat (NSC 726630; CAS Registry No.414864009); chidamide (CAS Registry No.743420022); entinostat (CAS Registry No.209783802); givinostat (CAS Registry No.732302997); mocetinostat (CAS Registry No.726169739); panobinostat (CAS Registry No.404950807); quisinostat (CAS Registry No.875320299); resminostat (CAS Registry No.864814880); romidepsin (CAS Registry No.128517077); sulforaphane (CAS Registry No.4478937); thioureidobutyronitrile (KevetrinTM; CAS Registry No.6659890); valproic acid (NSC 93819; CAS Registry No.99661); vorinostat (NSC 701852;
- Mitochondria Inhibitors pancratistatin (NSC 349156; CAS Registry No.96281311); rhodamine-123 (CAS Registry No.63669709); edelfosine (NSC 324368; CAS Registry No. 70641519); d-alpha-tocopherol succinate (NSC 173849; CAS Registry No.4345033); compound 11 ⁇ (CAS Registry No.865070377); aspirin (NSC 406186; CAS Registry No.
- Antimitotic Agents allocolchicine (NSC 406042); auristatins, such as MMAE (monomethyl auristatin E; CAS Registry No.474645-27-7) and MMAF (monomethyl auristatin F; CAS Registry No.745017-94-1; halichondrin B (NSC 609395); colchicine (NSC 757; CAS Registry No.64868); cholchicine derivative (N-benzoyl-deacetyl benzamide; NSC 33410; CAS Registry No.63989753); dolastatin 10 (NSC 376128; CAS Registry No 110417-88-4); maytansine (NSC 153858; CAS Registry No.35846-53-8); rhozoxin (NSC 332598; CAS Registry No.90996546); taxol (NSC 125973; CAS Registry No.33069624); taxol derivative ((2'- N-[3-(di)
- the cytotoxic and/or cytostatic agent is an antimitotic agent.
- the cytotoxic and/or cytostatic agent is an auristatin, for example, monomethyl auristatin E ("MMAE") or monomethyl auristatin F (“MMAF”). 6.2.2.
- Linkers [0168] In the anti-glyco-CD44 ADCs of the disclosure, the cytotoxic and/or cytostatic agents are linked to the antibody by way of linkers.
- the linker linking a cytotoxic and/or cytostatic agent to the antibody of an ADC may be short, long, hydrophobic, hydrophilic, flexible or rigid, or may be composed of segments that each independently have one or more of the above-mentioned properties such that the linker may include segments having different properties.
- the linkers may be polyvalent such that they covalently link more than one agent to a single site on the antibody, or monovalent such that covalently they link a single agent to a single site on the antibody. [0169] As will be appreciated by skilled artisans, the linkers link cytotoxic and/or cytostatic agents to the antibody by forming a covalent linkage to the cytotoxic and/or cytostatic agent at one location and a covalent linkage to antibody at another.
- linker is intended to include (i) unconjugated forms of the linker that include a functional group capable of covalently linking the linker to a cytotoxic and/or cytostatic agent and a functional group capable of covalently linking the linker to an antibody; (ii) partially conjugated forms of the linker that includes a functional group capable of covalently linking the linker to an antibody and that is covalently linked to a cytotoxic and/or cytostatic agent, or vice versa; and (iii) fully conjugated forms of the linker that is covalently linked to both a cytotoxic and/or cytostatic agent and an antibody.
- linkers and anti-glyco-CD44 ADCs of the disclosure as well as synthons used to conjugate linker-agents to antibodies, moieties comprising the functional groups on the linker and covalent linkages formed between the linker and antibody are specifically illustrated as R x and XY, respectively.
- the linkers are preferably, but need not be, chemically stable to conditions outside the cell, and may be designed to cleave, immolate and/or otherwise specifically degrade inside the cell. Alternatively, linkers that are not designed to specifically cleave or degrade inside the cell may be used. Choice of stable versus unstable linker may depend upon the toxicity of the cytotoxic and/or cytostatic agent.
- linkers For agents that are toxic to normal cells, stable linkers are preferred. Agents that are selective or targeted and have lower toxicity to normal cells may utilize, chemical stability of the linker to the extracellular milieu is less important.
- linkers useful for linking drugs to antibodies in the context of ADCs are known in the art. Any of these linkers, as well as other linkers, may be used to link the cytotoxic and/or cytostatic agents to the antibody of the anti-glyco-CD44 ADCs of the disclosure.
- Exemplary polyvalent linkers that may be used to link many cytotoxic and/or cytostatic agents to a single antibody molecule are described, for example, in WO 2009/073445; WO 2010/068795; WO 2010/138719; WO 2011/120053; WO 2011/171020; WO 2013/096901; WO 2014/008375; WO 2014/093379; WO 2014/093394; WO 2014/093640, the content of which are incorporated herein by reference in their entireties.
- the Fleximer linker technology developed by Mersana et al. has the potential to enable high-DAR ADCs with good physicochemical properties.
- the Mersana technology is based on incorporating drug molecules into a solubilizing poly-acetal backbone via a sequence of ester bonds.
- the methodology renders highly-loaded ADCs (DAR up to 20) while maintaining good physicochemical properties.
- Additional examples of dendritic type linkers can be found in US 2006/116422; US 2005/271615; de Groot et al. (2003) Angew. Chem. Int. Ed.42:4490-4494; Amir et al. (2003) Angew. Chem. Int. Ed.42:4494-4499; Shamis et al. (2004) J. Am. Chem. Soc.126:1726-1731; Sun et al.
- Exemplary monovalent linkers that may be used are described, for example, in Nolting, 2013, Antibody-Drug Conjugates, Methods in Molecular Biology 1045:71-100; Kitson et al., 2013, CROs/CMOs--Chemica Oggi--Chemistry Today 31(4):30-38; Ducry et al., 2010, Bioconjugate Chem.21:5-13; Zhao et al., 2011, J. Med. Chem.54:3606-3623; U.S. Pat. No. 7,223,837; U.S. Pat. No.8,568,728; U.S. Pat. No.8,535,678; and WO2004010957, each of which is incorporated herein by reference.
- Additional exemplary linkers and associated methods and chemistries are provided that are stable in blood, provide for site-specific and stable conjugation, and provides for cancer- specific activation via specific enzymes found in cancer cells.
- Site specific conjugation allows for production of homogenous ADCs, while plasma-stable linkers enable cancer-specific toxin release.
- a functionalized prenyl substrate can be covalently joined to Cys of CaaX amino acid sequence introduced at the C-terminus of a light chain by prenyl transferase (e.g., farnesyl transferase). Drug conjugation may then occur via click chemistry or oxime ligation between isoprenoid and linker functionalities.
- linkers, associate methods, and associate chemistries that may be used are described in, for example, WO 2012/153193, WO 2015/182984; WO 2017/089890; WO 2017/089894; WO 2017/089895; WO 2017/051249; WO 2017/051254; WO 2018/182341; WO 2020/222573; WO 2021/137646; and WO 2020/141923, each of which is hereby incorporated by reference in its entirety.
- some cleavable and non-cleavable linkers that may be included in the anti-glyco-CD44 ADCs of the disclosure are described below. 6.2.3.
- Cleavable Linkers may include chemically or enzymatically unstable or degradable linkages.
- Cleavable linkers generally rely on processes inside the cell to liberate the drug, such as reduction in the cytoplasm, exposure to acidic conditions in the lysosome, or cleavage by specific proteases or other enzymes within the cell.
- Cleavable linkers generally incorporate one or more chemical bonds that are either chemically or enzymatically cleavable while the remainder of the linker is non-cleavable.
- a linker comprises a chemically labile group such as hydrazone and/or disulfide groups.
- Linkers comprising chemically labile groups exploit differential properties between the plasma and some cytoplasmic compartments.
- the intracellular conditions to facilitate drug release for hydrazone containing linkers are the acidic environment of endosomes and lysosomes, while the disulfide containing linkers are reduced in the cytosol, which contains high thiol concentrations, e.g., glutathione.
- the plasma stability of a linker comprising a chemically labile group may be increased by introducing steric hindrance using substituents near the chemically labile group.
- Acid-labile groups such as hydrazone, remain intact during systemic circulation in the blood's neutral pH environment (pH 7.3-7.5) and undergo hydrolysis and release the drug once the ADC is internalized into mildly acidic endosomal (pH 5.0-6.5) and lysosomal (pH 4.5-5.0) compartments of the cell. This pH dependent release mechanism has been associated with nonspecific release of the drug.
- the linker may be varied by chemical modification, e.g., substitution, allowing tuning to achieve more efficient release in the lysosome with a minimized loss in circulation.
- Hydrazone-containing linkers may contain additional cleavage sites, such as additional acid-labile cleavage sites and/or enzymatically labile cleavage sites.
- ADCs including exemplary hydrazone-containing linkers include the following structures:
- linker (Ig) the linker comprises two cleavable groups--a disulfide and a hydrazone moiety.
- linkers such as (Ih) and (Ii) have been shown to be effective with a single hydrazone cleavage site.
- Additional linkers which remain intact during systemic circulation and undergo hydrolysis and release the drug when the ADC is internalized into acidic cellular compartments include carbonates.
- linkers can be useful in cases where the cytotoxic and/or cytostatic agent can be covalently attached through an oxygen.
- Other acid-labile groups that may be included in linkers include cis-aconityl-containing linkers. cis-Aconityl chemistry uses a carboxylic acid juxtaposed to an amide bond to accelerate amide hydrolysis under acidic conditions.
- Cleavable linkers may also include a disulfide group. Disulfides are thermodynamically stable at physiological pH and are designed to release the drug upon internalization inside cells, wherein the cytosol provides a significantly more reducing environment compared to the extracellular environment.
- Scission of disulfide bonds generally requires the presence of a cytoplasmic thiol cofactor, such as (reduced) glutathione (GSH), such that disulfide-containing linkers are reasonably stable in circulation, selectively releasing the drug in the cytosol.
- GSH cytoplasmic thiol cofactor
- the intracellular enzyme protein disulfide isomerase, or similar enzymes capable of cleaving disulfide bonds, may also contribute to the preferential cleavage of disulfide bonds inside cells.
- GSH is reported to be present in cells in the concentration range of 0.5-10 mM compared with a significantly lower concentration of GSH or cysteine, the most abundant low-molecular weight thiol, in circulation at approximately 5 Tumor cells, where irregular blood flow leads to a hypoxic state, result in enhanced activity of reductive enzymes and therefore even higher glutathione concentrations.
- the in vivo stability of a disulfide-containing linker may be enhanced by chemical modification of the linker, e.g., use of steric hindrance adjacent to the disulfide bond.
- ADCs including exemplary disulfide-containing linkers include the following structures: wherein D and Ab represent the drug and antibody, respectively, n represents the number of drug-linkers linked to the antibody and R is independently selected at each occurrence from hydrogen or alkyl, for example. In certain embodiments, increasing steric hindrance adjacent to the disulfide bond increases the stability of the linker. Structures such as (Ij) and (Il) show increased in vivo stability when one or more R groups is selected from a lower alkyl such as methyl. [0183] Another type of cleavable linker that may be used is a linker that is specifically cleaved by an enzyme.
- linkers are typically peptide-based or include peptidic regions that act as substrates for enzymes.
- Peptide based linkers tend to be more stable in plasma and extracellular milieu than chemically labile linkers. Peptide bonds generally have good serum stability, as lysosomal proteolytic enzymes have very low activity in blood due to endogenous inhibitors and the unfavorably high pH value of blood compared to lysosomes. Release of a drug from an antibody occurs specifically due to the action of lysosomal proteases, e.g., cathepsin and plasmin. These proteases may be present at elevated levels in certain tumor cells.
- the cleavable peptide is selected from tetrapeptides such as Gly-Phe-Leu-Gly (SEQ ID NO:181), Ala-Leu-Ala-Leu (SEQ ID NO:182) or dipeptides such as Val-Cit, Val-Ala, Met-(D)Lys, Asn-(D)Lys, Val-(D)Asp, Phe-Lys, Ile-Val, Asp-Val, His-Val, NorVal-(D)Asp, Ala-(D)Asp 5, Met-Lys, Asn-Lys, Ile-Pro, Me3Lys-Pro, PhenylGly-(D)Lys, Met- (D)Lys, Asn-(D)Lys, Pro-(D)Lys, Met-(D)Lys, Asn-(D)Lys, AM Met-(D)Lys, Asn
- dipeptides are preferred over longer polypeptides due to hydrophobicity of the longer peptides.
- dipeptide-based cleavable linkers useful for linking drugs such as doxorubicin, mitomycin, camptothecin, pyrrolobenzodiazepine, tallysomycin and auristatin/auristatin family members to antibodies have been described (see, Dubowchik et al., 1998, J. Org. Chem.67:1866-1872; Dubowchik et al., 1998, Bioorg. Med. Chem. Lett. 8(21):3341-3346; Walker et al., 2002, Bioorg. Med. Chem.
- dipeptide linkers that may be used include those found in ADCs such as Seattle Genetics' Brentuximab Vendotin SGN-35 (AdcetrisTM), Seattle Genetics SGN-75 (anti-CD-70, Val-Cit-monomethyl auristatin F(MMAF), Seattle Genetics SGN-CD33A (anti-CD-33, Val-Ala-(SGD-1882)), Celldex Therapeutics glembatumumab (CDX-011) (anti-NMB, Val-Cit-monomethyl auristatin E (MMAE), and Cytogen PSMA-ADC (PSMA-ADC-1301) (anti-PSMA, Val-Cit-MMAE).
- ADCs such as Seattle Genetics' Brentuximab Vendotin SGN-35 (AdcetrisTM), Seattle Genetics SGN-75 (anti-CD-70, Val-Cit-monomethyl auristatin F(MMAF), Seattle Genetics SGN-CD33A (anti
- Enzymatically cleavable linkers may include a self-immolative spacer to spatially separate the drug from the site of enzymatic cleavage.
- the direct attachment of a drug to a peptide linker can result in proteolytic release of an amino acid adduct of the drug, thereby impairing its activity.
- the use of a self-immolative spacer allows for the elimination of the fully active, chemically unmodified drug upon amide bond hydrolysis.
- One self-immolative spacer is the bifunctional para-aminobenzyl alcohol group, which is linked to the peptide through the amino group, forming an amide bond, while amine containing drugs may be attached through carbamate functionalities to the benzylic hydroxyl group of the linker (PABC).
- PABC benzylic hydroxyl group of the linker
- the resulting prodrugs are activated upon protease-mediated cleavage, leading to a 1,6-elimination reaction releasing the unmodified drug, carbon dioxide, and remnants of the linker group.
- the following scheme depicts the fragmentation of p-amidobenzyl ether and release of the drug: wherein X-D represents the unmodified drug.
- the enzymatically cleavable linker is a ⁇ -glucuronic acid-based linker. Facile release of the drug may be realized through cleavage of the ⁇ -glucuronide glycosidic bond by the lysosomal enzyme ⁇ -glucuronidase. This enzyme is present abundantly within lysosomes and is overexpressed in some tumor types, while the enzyme activity outside cells is low.
- ⁇ -Glucuronic acid-based linkers may be used to circumvent the tendency of an ADC to undergo aggregation due to the hydrophilic nature of ⁇ -glucuronides.
- ⁇ -glucuronic acid-based linkers are preferred as linkers for ADCs linked to hydrophobic drugs. The following scheme depicts the release of the drug from and ADC containing a ⁇ -glucuronic acid-based linker:
- ⁇ -glucuronic acid-based linkers may be used in the anti-glyco-CD44 ADCs of the disclosure.
- cytotoxic and/or cytostatic agents containing a phenol group can be covalently bonded to a linker through the phenolic oxygen.
- One such linker described in WO 2007/089149, relies on a methodology in which a diamino-ethane "SpaceLink" is used in conjunction with traditional "PABO"-based self-immolative groups to deliver phenols.
- Cleavable linkers may include noncleavable portions or segments, and/or cleavable segments or portions may be included in an otherwise non-cleavable linker to render it cleavable.
- polyethylene glycol (PEG) and related polymers may include cleavable groups in the polymer backbone.
- a polyethylene glycol or polymer linker may include one or more cleavable groups such as a disulfide, a hydrazone or a dipeptide.
- linkers include ester linkages formed by the reaction of PEG carboxylic acids or activated PEG carboxylic acids with alcohol groups on a biologically active agent, wherein such ester groups generally hydrolyze under physiological conditions to release the biologically active agent.
- Hydrolytically degradable linkages include, but are not limited to, carbonate linkages; imine linkages resulting from reaction of an amine and an aldehyde; phosphate ester linkages formed by reacting an alcohol with a phosphate group; acetal linkages that are the reaction product of an aldehyde and an alcohol; orthoester linkages that are the reaction product of a formate and an alcohol; and oligonucleotide linkages formed by a phosphoramidite group, including but not limited to, at the end of a polymer, and a 5' hydroxyl group of an oligonucleotide.
- the linker comprises an enzymatically cleavable peptide moiety, for example, a linker comprising structural formula (IVa) or (IVb): or a salt thereof, wherein: peptide represents a peptide (illustrated C ⁇ N and not showing the carboxy and amino “termini”) cleavable by a lysosomal enzyme; T represents a polymer comprising one or more ethylene glycol units or an alkylene chain, or combinations thereof; R a is selected from hydrogen, alkyl, sulfonate and methyl sulfonate; p is an integer ranging from 0 to 5; q is 0 or 1; x is 0 or 1; y is 0 or 1; represents the point of attachment of the linker to a cytotoxic and/or cytostatic agent; and * represents the point of attachment to the remainder of the linker.
- structural formula (IVa) or (IVb): or a salt thereof wherein: peptide represents a
- the peptide is selected from a tripeptide or a dipeptide.
- the dipeptide is selected from: Val-Cit; Cit-Val; Ala-Ala; Ala-Cit; Cit-Ala; Asn-Cit; Cit-Asn; Cit-Cit; Val-Glu; Glu-Val; Ser-Cit; Cit-Ser; Lys-Cit; Cit-Lys; Asp-Cit; Cit-Asp; Ala-Val; Val-Ala; Phe-Lys; Val-Lys; Ala-Lys; Phe-Cit; Leu-Cit; Ile-Cit; Phe-Arg; and Trp-Cit.
- the dipeptide is selected from: Cit-Val; and Ala-Val.
- linkers according to structural formula (IVa) that may be included in the anti-glyco-CD44 ADCs of the disclosure include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody):
- linkers according to structural formula (IVb) that may be included in the anti-glyco-CD44 ADCs of the disclosure include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody): (IVb.1)
- the linker comprises an enzymatically cleavable peptide moiety, for example, a linker comprising structural formula (IVc) or (IVd): or a salt thereof, wherein: peptide represents a peptide (illustrated C ⁇ N and not showing the carboxy and amino “termini”) cleavable by a lysosomal enzyme; T represents a polymer comprising one or more ethylene glycol units or an alkylene chain, or combinations thereof; R a is selected from hydrogen, alkyl, sulfonate and methyl sulfonate; p is an integer ranging from 0 to 5; q is 0 or 1; x is 0 or 1; y is 0 or 1; x represents the point of attachment of the linker to a cytotoxic and/or cytostatic agent; and * represents the point of attachment to the remainder of the linker.
- structural formula (IVc) or (IVd): or a salt thereof wherein: peptide represents
- linkers according to structural formula (IVc) that may be included in the anti-glyco-CD44 ADCs of the disclosure include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody): [0200]
- Specific exemplary embodiments of linkers according to structural formula (IVd) that may be included in the anti-glyco-CD44 ADCs of the disclosure include the linkers illustrated below (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody): [0201]
- the linker comprising structural formula (IVa), (IVb), (IVc), or (IVd) further comprises a carbonate moiety cleavable by exposure to an acidic medium.
- the linker is attached through an oxygen to a cytotoxic and/or cytostatic agent. 6.2.4. Non-Cleavable Linkers [0202] Although cleavable linkers may provide certain advantages, the linkers comprising the anti-glyco-CD44 ADC of the disclosure need not be cleavable. For noncleavable linkers, the release of drug does not depend on the differential properties between the plasma and some cytoplasmic compartments. The release of the drug is postulated to occur after internalization of the ADC via antigen-mediated endocytosis and delivery to lysosomal compartment, where the antibody is degraded to the level of amino acids through intracellular proteolytic degradation.
- ADCs with noncleavable linkers have greater stability in circulation than ADCs with cleavable linkers.
- Non-cleavable linkers may be alkylene chains, or maybe polymeric in natures, such as, for example, based upon polyalkylene glycol polymers, amide polymers, or may include segments of alkylene chains, polyalkylene glycols and/or amide polymers.
- a variety of non-cleavable linkers used to link drugs to antibodies have been described. See, Jeffrey et al., 2006, Bioconjug. Chem.17; 831-840; Jeffrey et al., 2007, Bioorg. Med. Chem. Lett.17:2278-2280; and Jiang et al., 2005, J. Am. Chem. Soc.127:11254-11255, each of which is incorporated herein by reference.
- linker is non-cleavable in vivo, for example a linker according to structural formula (VIa), (VIb), (VIc) or (VId) (as illustrated, the linkers include a group suitable for covalently linking the linker to an antibody:
- R a is selected from hydrogen, alkyl, sulfonate and methyl sulfonate
- R x is a moiety including a functional group capable of covalently linking the linker to an antibody
- R x is a moiety including a functional group capable of covalently linking the linker to an antibody
- R x is a moiety including a functional group capable of covalently linking the linker to an antibody
- R x is a moiety including a functional group capable of covalently linking the linker to an antibody
- R x is a moiety including a functional group capable of covalently linking the linker to an antibody
- Attachment groups can be electrophilic in nature and include: maleimide groups, activated disulfides, active esters such as NHS esters and HOBt esters, haloformates, acid halides, alkyl and benzyl halides such as haloacetamides.
- maleimide groups activated disulfides
- active esters such as NHS esters and HOBt esters
- haloformates acid halides
- alkyl and benzyl halides such as haloacetamides
- Polytherics has disclosed a method for bridging a pair of sulfhydryl groups derived from reduction of a native hinge disulfide bond. See, Badescu et al., 2014, Bioconjugate Chem. 25:1124-1136. The reaction is depicted in the schematic below. An advantage of this methodology is the ability to synthesize enriched DAR4 ADCs by full reduction of IgGs (to give 4 pairs of sulfhydryls) followed by reaction with 4 equivalents of the alkylating agent. ADCs containing "bridged disulfides" are also claimed to have increased stability. [0209] Similarly, as depicted below, a maleimide derivative (1, below) that is capable of bridging a pair of sulfhydryl groups has been developed. See WO2013/085925.
- linker selected for a particular ADC may be influenced by a variety of factors, including but not limited to, the site of attachment to the antibody (e.g., lys, cys or other amino acid residues), structural constraints of the drug pharmacophore and the lipophilicity of the drug.
- the specific linker selected for an ADC should seek to balance these different factors for the specific antibody/drug combination.
- ADCs have been observed to effect killing of bystander antigen-negative cells present in the vicinity of the antigen-positive tumor cells.
- the mechanism of bystander cell killing by ADCs has indicated that metabolic products formed during intracellular processing of the ADCs may play a role.
- the linker is selected to attenuate the bystander killing effect caused by cellular metabolites of the ADC. In certain embodiments, the linker is selected to increase the bystander killing effect.
- the properties of the linker may also impact aggregation of the ADC under conditions of use and/or storage.
- ADCs reported in the literature contain no more than 3-4 drug molecules per antibody molecule (see, e.g., Chari, 2008, Acc Chem Res 41:98-107).
- DAR drug-to-antibody ratios
- the linker incorporates chemical moieties that reduce aggregation of the ADCs during storage and/or use.
- a linker may incorporate polar or hydrophilic groups such as charged groups or groups that become charged under physiological pH to reduce the aggregation of the ADCs.
- a linker may incorporate charged groups such as salts or groups that deprotonate, e.g., carboxylates, or protonate, e.g., amines, at physiological pH.
- exemplary polyvalent linkers that have been reported to yield DARs as high as 20 that may be used to link numerous cytotoxic and/or cytostatic agents to an antibody are described in WO 2009/073445; WO 2010/068795; WO 2010/138719; WO 2011/120053; WO 2011/171020; WO 2013/096901; WO 2014/008375; WO 2014/093379; WO 2014/093394; WO 2014/093640, the content of which are incorporated herein by reference in their entireties.
- the aggregation of the ADCs during storage or use is less than about 10% as determined by size-exclusion chromatography (SEC).
- the aggregation of the ADCs during storage or use is less than 10%, such as less than about 5%, less than about 4%, less than about 3%, less than about 2%, less than about 1%, less than about 0.5%, less than about 0.1%, or even lower, as determined by size- exclusion chromatography (SEC). 6.2.7. Methods of Making Anti-Glyco-CD44 ADCs [0215]
- the anti-glyco-CD44 ADCs of the disclosure may be synthesized using chemistries that are well-known. The chemistries selected will depend upon, among other things, the identity of the cytotoxic and/or cytostatic agent(s), the linker and the groups used to attach linker to the antibody.
- ADCs according to formula (I) may be prepared according to the following scheme: D-L-R x +Ab-R y ⁇ [D-L-XY] n -Ab (I) [0216] where D, L, Ab, XY and n are as previously defined, and R x and R y represent complementary groups capable of forming covalent linkages with one another, as discussed above. [0217] The identities of groups R x and R y will depend upon the chemistry used to link synthon D-L- R x to the antibody. Generally, the chemistry used should not alter the integrity of the antibody, for example its ability to bind its target. Preferably, the binding properties of the conjugated antibody will closely resemble those of the unconjugated antibody.
- a number of functional groups R x and chemistries useful for linking synthons to accessible lysine residues are known, and include by way of example and not limitation NHS- esters and isothiocyanates.
- a number of functional groups R x and chemistries useful for linking synthons to accessible free sulfhydryl groups of cysteine residues are known, and include by way of example and not limitation haloacetyls and maleimides.
- conjugation chemistries are not limited to available side chain groups. Side chains such as amines may be converted to other useful groups, such as hydroxyls, by linking an appropriate small molecule to the amine.
- the antibody may also be engineered to include amino acid residues for conjugation.
- An approach for engineering antibodies to include non-genetically encoded amino acid residues useful for conjugating drugs in the context of ADCs is described by Axup et al., 2012, Proc Natl Acad Sci USA.109(40):16101-16106, as are chemistries and functional group useful for linking synthons to the non-encoded amino acids.
- the synthons are linked to the side chains of amino acid residues of the antibody, including, for example, the primary amino group of accessible lysine residues or the sulfhydryl group of accessible cysteine residues. Free sulfhydryl groups may be obtained by reducing interchain disulfide bonds.
- R y is a sulfhydryl group (for example, when R x is a maleimide)
- the antibody is generally first fully or partially reduced to disrupt interchain disulfide bridges between cysteine residues.
- Cysteine residues that do not participate in disulfide bridges may engineered into an antibody by mutation of one or more codons.
- positions for incorporating engineered cysteines include, by way of example and not limitation, positions S112C, S113C, A114C, S115C, A176C, 5180C, S252C, V286C, V292C, S357C, A359C, S398C, S428C (Kabat numbering) on the human IgG 1 heavy chain and positions V110C, S114C, S121C, S127C, S168C, V205C (Kabat numbering) on the human Ig kappa light chain (see, e.g., U.S. Pat. No. 7,521,541, U.S.
- the number of cytotoxic and/or cytostatic agents linked to an antibody molecule may vary, such that a collection of ADCs may be heterogeneous in nature, where some antibodies contain one linked agent, some two, some three, etc. (and some none).
- the degree of heterogeneity will depend upon, among other things, the chemistries used for linking the cytotoxic and/or cytostatic agents. For example, where the antibodies are reduced to yield sulfhydryl groups for attachment, heterogeneous mixtures of antibodies having zero, 2, 4, 6 or 8 linked agents per molecule are often produced.
- DAR4 can refer to an ADC preparation that has not been subjected to purification to isolate specific DAR peaks and can comprise a heterogeneous mixture of ADC molecules having different numbers of cytostatic and/or cytotoxic agents attached per antibody (e.g., 0, 2, 4, 6, 8 agents per antibody), but has an average drug-to-antibody ratio of 4.
- DAR2 refers to a heterogeneous ADC preparation in which the average drug- to-antibody ratio is 2.
- antibodies having defined numbers of linked cytotoxic and/or cytostatic agents may be obtained via purification of heterogeneous mixtures, for example, via column chromatography, e.g., hydrophobic interaction chromatography.
- Purity may be assessed by a variety of methods, as is known in the art. As a specific example, an ADC preparation may be analyzed via HPLC or other chromatography and the purity assessed by analyzing areas under the curves of the resultant peaks.
- CARs chimeric antigen receptors
- the CAR comprises one or more scFvs (e.g., one or two) as described herein.
- a CAR can comprise two scFvs covalently connected by a linker sequence (e.g., of 4-15 amino acids).
- exemplary linkers include GGGGS (SEQ ID NO:183) and (GGGGS) 3 (SEQ ID NO:184).
- the CARs of the disclosure typically comprise an extracellular domain operably linked to a transmembrane domain which is in turn operably linked to an intracellular domain for signaling.
- the CARs can further comprise a signal peptide at the N-terminus of the extracellular domain (e.g., a human CD8 signal peptide).
- a CAR of the disclosure comprises a human CD8 signal peptide comprising the amino acid sequence MALPVTALLLPLALLLHAARP (SEQ ID NO:175).
- the extracellular domains of the CARs of the disclosure comprise the sequence of an anti-glyco-CD44 antibody or antigen-binding fragment (e.g., as described in Section 6.1 or numbered embodiments 1 to 359 of Group I and 1-147 of Group II).
- Exemplary transmembrane domain sequence and intracellular domain sequences are described in Sections 6.3.1 and 6.3.2, respectively.
- fusion proteins described herein are CARs, and the CAR-related disclosures apply to such fusion proteins.
- Other fusion proteins described herein are T cell receptor fusion proteins (e.g., numbered embodiments 462 to 490 of Group I and 236 to 264 of Group II), which includes STARs (e.g., numbered embodiments 491 to 517 of Group I and 265 to 309 of Group II).
- the TCR fusion protein and STAR-related disclosures apply to such fusion proteins. 6.3.1.
- the CAR can be designed to comprise a transmembrane domain that is operably linked (e.g., fused) to the extracellular domain of the CAR.
- the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
- Transmembrane regions of particular use in this disclosure may be derived from (i.e., comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
- a variety of human hinges can be employed as well including the human Ig (immunoglobulin) hinge.
- the transmembrane domain is synthetic (i.e., non-naturally occurring).
- transmembrane domains are peptides comprising predominantly hydrophobic residues such as leucine and valine. Preferably a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.
- a glycine-serine doublet provides a particularly suitable linker.
- the transmembrane domain in the CAR of the disclosure is the CD8 transmembrane domain.
- the CD8 transmembrane domain comprises the amino acid sequence YLHLGALGRDLWGPSPVTGYHPLL (SEQ ID NO:185).
- the transmembrane domain in the CAR of the disclosure is the CD28 transmembrane domain.
- the CD28 transmembrane domain comprises the amino acid sequence FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO:186).
- the transmembrane domain of the CAR of the disclosure is linked to the extracellular domain by a CD8a hinge domain.
- the CD8a hinge domain comprises the amino acid sequence TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFAC (SEQ ID NO:187). In another embodiment, the CD8a hinge domain comprises the amino acid sequence TTTPAPRPPTPAPTIASPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO:176). [0239] In some instances, the transmembrane domain of the CAR of the disclosure is linked to the extracellular domain by a human IgG4-short hinge. In one embodiment, the human IgG4- short hinge comprises the amino acid sequence ESKYGPPCPSCP (SEQ ID NO:177).
- the transmembrane domain of the CAR of the disclosure is linked to the extracellular domain by a human IgG4-long hinge.
- the human IgG4- long hinge comprises the amino acid sequence ESKYGPPCPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDG VEVHNAKTKPREEQFQSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPR EPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKM (SEQ ID NO:178).
- the intracellular signaling domain of the CAR of the disclosure is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR is expressed.
- effector function refers to a specialized function of a cell. Effector function of a T cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
- intracellular signaling domain refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire chain.
- intracellular signaling domain for use in the CAR of the disclosure include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability.
- TCR T cell receptor
- T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co- stimulatory signal (secondary cytoplasmic signaling sequences).
- primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
- Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
- ITAM containing primary cytoplasmic signaling sequences that are of particular use in the CARs of the disclosure include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD5, CD22, CD79a, CD79b, and CD66d. It is particularly preferred that cytoplasmic signaling molecule in the CAR of the disclosure comprises a cytoplasmic signaling sequence from CD3-zeta.
- the cytoplasmic domain of the CAR is designed to include an ITAM containing primary cytoplasmic signaling sequences domain (e.g., that of CD3-zeta) by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of the disclosure.
- the cytoplasmic domain of the CAR can include a CD3 zeta chain portion and a costimulatory signaling region.
- the costimulatory signaling region refers to a portion of the CAR comprising the intracellular domain of one or more costimulatory molecules.
- a costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen.
- examples of such molecules include CD27, CD28, 4- 1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83, DAP10, GITR, and the like, and combinations thereof.
- the cytoplasmic signaling sequences within the cytoplasmic signaling portion of the CAR of the disclosure may be linked to each other in a random or specified order.
- the cytoplasmic domain comprises the signaling domain of CD3- zeta and the signaling domain of CD28.
- the signaling domain of CD3- zeta comprises the amino acid sequence RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYN ELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO:180).
- the signaling domain of CD28 comprises the amino acid sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO:179).
- the cytoplasmic domain comprises the signaling domain of CD3-zeta and the signaling domain of 4-1BB.
- the cytoplasmic domain comprises the signaling domain of CD3-zeta and the signaling domain of CD2.
- the signaling domain of CD2 comprises the amino acid sequence TKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSHR PPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN (SEQ ID NO:289).
- the cytoplasmic domain comprises the signaling domain of CD3-zeta, the signaling domain of CD28, and the signaling domain of CD2.
- the cytoplasmic domain comprises the signaling domain of CD3-zeta, the signaling domain of 4-1BB, and the signaling domain of CD2.
- inclusion of the CD2 signaling domain and the CD28 signaling domain in the costimulatory signaling region of the cytoplasmic domain results in the release of significantly less IL2 relative to T cells expressing a CAR with CD28 but not CD2.
- a CAR T cell releasing less IL2 can result in reduced proliferation of immunosuppressive Treg cells.
- inclusion of the CD2 signaling domain in the costimulatory signaling region of the cytoplasmic domain significantly reduces calcium influx in the CAR T cell. This has been shown to reduce activation-induced CAR T cell death.
- TCR T cell receptor
- the TCR fusion protein comprises a Fab as described herein.
- the TCR fusion protein comprises one or more scFvs (e.g., one or two) as described herein.
- the two scFvs can be covalently connected by a linker sequence (e.g., of 4-15 amino acids).
- linkers include GGGGS (SEQ ID NO:183) and (GGGGS) 3 (SEQ ID NO:184).
- the TCR fusion proteins of the disclosure typically comprise an extracellular domain operably linked to a transmembrane domain, which is in turn operably linked to an intracellular signaling domain.
- the extracellular domain comprises an antigen- binding fragment of the disclosure.
- the extracellular domain comprises an antigen-binding fragment and the extracellular domain of a TCR complex subunit or a fragment thereof.
- a fragment of the extracellular domain of the TCR complex subunit comprises all or a fragment of the constant region of the TCR complex subunit.
- the fragment of the extracellular domain of the TCR complex comprises all or a fragment of the variable region of the TCR complex subunit.
- the fragment of the extracellular domain of the TCR complex comprises all or a fragment of the constant region of the TCR complex subunit and all or a fragment of the variable region of the TCR complex subunit.
- TCR complex refers to the octameric TCR complex comprising: ⁇ and ⁇ TCR chains, or ⁇ and ⁇ TCR chains; and the three signaling dimers CD3 ⁇ , CD3 ⁇ , and CD3 ⁇ .
- TCR complex subunit refers to the individual monomers that associate to form the TCR complex (e.g., TCR ⁇ chain, TCR ⁇ chain, TCR ⁇ chain, TCR ⁇ chain, CD3 ⁇ , CD3 ⁇ , and CD3 ⁇ ).
- a TCR fusion protein comprises an antigen-binding fragment of the disclosure, a transmembrane domain of a TCR complex subunit, and an intracellular signaling domain of a TCR complex subunit.
- the TCR fusion protein comprises, in amino- to carboxy-terminal order, an antigen-binding fragment of the disclosure, a transmembrane domain of a TCR complex subunit, and an intracellular signaling domain of a TCR complex subunit.
- a TCR fusion protein comprises an antigen-binding fragment of the disclosure, an extracellular domain of a TCR complex subunit or a fragment thereof, a transmembrane domain of a TCR complex subunit, and an intracellular signaling domain of a TCR complex subunit.
- the TCR fusion protein comprises, in amino- to carboxy-terminal order an antigen-binding fragment of the disclosure, an extracellular domain of a TCR complex subunit or a fragment thereof, a transmembrane domain of a TCR complex subunit, and an intracellular signaling domain of a TCR complex subunit.
- the extracellular domain of the TCR complex subunit, the transmembrane domain of the TCR complex subunit, and the intracellular signaling domain of the TCR complex subunit can be from the same TCR complex subunit (e.g., TCR ⁇ chain), or can be from different TCR complex subunits (e.g., the extracellular domain of CD3 ⁇ or a fragment thereof, the transmembrane domain of CD3 ⁇ and the intracellular signaling domain of TCR ⁇ chain).
- the antigen-binding fragment of a TCR fusion protein comprises a variable heavy (V H ) region of an anti-glyco-CD44 antibody of the disclosure.
- the antigen binding fragment can also include a CH1 domain.
- the V H can pair with a V L region on a separate polypeptide.
- the antigen-binding fragment includes V H and CH1 regions, these regions can pair with a separate polypeptide comprising V L and C L regions to form a Fab.
- the antigen-binding fragment of a TCR fusion protein comprises a variable light (V L ) region of an anti-glyco-CD44 antibody of the disclosure.
- the antigen binding fragment can also include a C L domain.
- the V L can pair with a V H region on a separate polypeptide.
- a first TCR fusion protein comprises an antigen-binding fragment including a V H region and a second TCR fusion protein comprises an antigen-binding fragment including a V L region.
- the first and second TCR fusion proteins can associate, bringing the V H of the first TCR fusion protein and the V L of the second TCR fusion protein into association.
- the first TCR fusion protein can include the V H region of an anti- glyco-CD44 antibody of the disclosure and at least the intermembrane and intracellular signaling domains of TCR ⁇
- the second TCR fusion protein can include the V L region of an anti-glyco-CD44 antibody of the disclosure and at least the intermembrane and intracellular signaling domains of TCR ⁇ .
- the first and second TCR fusion proteins can then associate to form a TCR ⁇ / ⁇ dimer and a V H /V L glyco-CD44 binding domain.
- a TCR fusion protein comprises a modification promoting the association of the first and second TCR fusion proteins.
- the modification occurs in an extracellular constant region of a TCR complex subunit (e.g., the constant region of TCR ⁇ , TCR ⁇ , TCR ⁇ , or TCR ⁇ chains).
- said modification promoting association of the first and second TCR fusion proteins is a so-called “knob-into-hole” modification, comprising a “knob” modification in one of the TCR fusion proteins and a “hole” modification in the other TCR fusion protein.
- the knob-into-hole technology as it relates to TCRs is described, e.g., in WO 2016/187349A1, the contents of which are incorporated herein by reference in their entirety.
- the method involves introducing a protuberance (“knob”) at the interface of a first polypeptide and a corresponding cavity (“hole”) in the interface of a second polypeptide, such that the protuberance can be positioned in the cavity so as to promote heterodimer formation and hinder homodimer formation.
- Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide with larger side chains (e.g., tryptophan, lysine, arginine, phenylalanine, cysteine, or tyrosine).
- Compensatory cavities of identical or similar size to the protuberances are created in the interface of the second polypeptide by replacing large amino acid side chains with smaller ones (e.g., glycine, serine, threonine, valine, or alanine).
- the antigen-binding fragment and the TCR complex subunit domains can be connected via a peptide linker.
- the peptide linker comprises or consists of a glycine-serine linker.
- a TCR fusion protein of the disclosure in capable of functionally associating with or otherwise integrating into a TCR complex.
- a TCR fusion protein of the disclosure is capable of functionally interacting with at least one endogenous TCR complex subunit in a T cell, and preferably is capable of functionally interacting with or integrating into an endogenous TCR complex.
- TCR complexes comprising one or more TCR fusion proteins of the disclosure.
- the TCR complex is a TCR ⁇ / ⁇ TCR complex.
- the TCR complex is a TCR ⁇ / ⁇ TCR complex.
- T cells comprising a TCR fusion protein of the disclosure.
- the T cells comprise TCR complexes that incorporate one or more TCR fusion proteins of the disclosure.
- TCR fusion proteins and TCR complexes comprising the same are described in the art, and include T cell receptor fusion constructs (TRuCs) and subunits thereof described in, e.g., WO 2016/187349A1, WO 2018/026953A1, and WO 2019/222275; antibody-T-cell receptor (AbTCR) constructs and subunits thereof describe in, e.g., WO 2017/070608A1; and synthetic T cell receptor (TCR) and antigen receptors (STARs) described in, e.g., Liu et al., 2021, Sci Transl Med, 13:eabb5191 and WO 2020/029774.
- the present disclosure provides synthetic T cell receptor (TCR) and antigen receptors (STARs) comprising the anti-glyco-CD44 antibodies or antigen-binding fragments described herein.
- the STAR comprises at least one anti-glyco-CD44 variable heavy chain and at least one anti-glyco-CD44 variable light chain as described herein.
- the STARs of the disclosure typically comprise two polypeptide chains connected by a furin-p2A cleavable peptide.
- the STAR comprises, from N- to C-terminus, a first polypeptide chain comprising an anti-glyco-CD44 variable heavy chain and a TCR ⁇ chain constant region domain; a cleavable peptide linker; and a second polypeptide chain comprising an anti-glyco- CD44 variable light chain and a TCR ⁇ constant region domain (configuration STAR 1).
- the STAR comprises, from N- to C-terminus, a first polypeptide chain comprising an anti-glyco-CD44 variable heavy chain and a TCR ⁇ chain constant region domain; a cleavable peptide linker; and a second polypeptide chain comprising an anti-glyco- CD44 variable light chain and a TCR ⁇ constant region domain (configuration STAR 2).
- the STAR comprises, from N- to C-terminus, a first polypeptide chain comprising an anti-glyco-CD44 variable light chain and a TCR ⁇ chain constant region domain; a cleavable peptide linker; and a second polypeptide chain comprising an anti-glyco-CD44 variable heavy chain and a TCR ⁇ constant region domain (configuration STAR 3).
- the STAR comprises, from N- to C-terminus, a first polypeptide chain comprising an anti-glyco-CD44 variable light chain and a TCR ⁇ chain constant region domain; a cleavable peptide linker; and a second polypeptide chain comprising an anti-glyco-CD44 variable heavy chain and a TCR ⁇ constant region domain (configuration STAR 4).
- the TCR ⁇ chain constant region domain and the TCR ⁇ chain constant region domain of any one of configurations STAR 1 through STAR 4 can be replaced by TCR ⁇ and TCR ⁇ constant region domains, respectively.
- the STARs of the present disclosure can form complexes with CD3 subunits (e.g., ⁇ , ⁇ , ⁇ , and ⁇ ) endogenously expressed in T cells. These complexes provide for TCR signaling controlled by binding of the anti-glyco-CD44 heavy and light variable chains by its target.
- 6.4.1.1 TCR Constant Region Domains With respect to the TCR constant region domains, the STAR can be designed to comprise constant regions that are derived from, e.g., human peripheral blood T cells. Nucleotide and corresponding amino acid sequences for TCR constant regions for use in STARs according to the disclosure are provided in Table 5.
- the TCR constant regions of the STAR can be modified to provide for additional bonds between the two TCR constant regions of the STAR.
- the residue at position 48 of the wildtype TCR ⁇ constant region is mutated to cysteine and the residue at position 57 of the wildtype TCR ⁇ constant region is mutated to cysteine. This results in the formation of a disulfide linkage between TCR ⁇ and TCR ⁇ constant regions, resulting in a disulfide bond between the first and second polypeptide chains of the STAR.
- the residue at position 85 of the wildtype TCR ⁇ constant region is mutated to alanine and the residue at position 88 of the wildtype TCR ⁇ constant region is mutated to glycine.
- the two polypeptide chains of the STARs of the disclosure are linked via a peptide linker.
- the peptide linker is a cleavable linker.
- the two polypeptide chains of the STAR are linked via a furin-P2A peptide linker, which provides a protease cleavage site between the two polypeptide chains.
- the two polypeptide chains can thus be transcribed and translated into a fusion protein, which is subsequently cleaved by a protease into two distinct protein subunits.
- the two resulting protein subunits are covalently bound through disulfide bonds, and subsequently form a complex with the endogenous CD3 subunits ( ⁇ , ⁇ , ⁇ , and ⁇ ) of T cells.
- the furin-P2A peptide linker comprises the sequence RAKRSGSGATNFSLLKQAGDVEENPGP (SEQ ID NO:302).
- the furin-P2A peptide linker comprises the sequence ATNFSLLKQAGDVEENPGP (SEQ ID NO:303).
- MicAbodies are fusion proteins comprising an antibody or antigen-binding fragment and an engineered MHC-class I-chain-related (MIC) protein domain.
- MIC proteins are the natural ligands of human NKG2D receptors expressed on the surface of NK cells, and the ⁇ 1- ⁇ 2 domain of MIC proteins provides the binding site for the NKG2D receptor.
- an engineered MIC protein domain e.g. an engineered ⁇ 1- ⁇ 2 domain
- T-cells expressing an engineered NKG2D receptor capable of binding the engineered MIC protein domain can be targeted to cancer cells.
- Engineered MIC protein domains that can be included in MicAbodies of the disclosure, and NKG2D receptors capable of binding the engineered MIC protein domains, CARs and CAR T cells comprising the NKG2D receptors are described in U.S. publication nos. US 2011/0183893, US2011/0311561, US 2015/0165065, and US 2016/0304578 and PCT publication nos. WO 2016/090278, WO 2017/024131, WO 2017/222556, and WO 2019/191243, the contents of which are incorporated herein by reference in their entireties.
- the MicAbodies of the disclosure comprise ⁇ 1- ⁇ 2 domains which are at least 80% identical or homologous to the ⁇ 1- ⁇ 2 domain of an NKG2D ligand (e.g., MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, or OMCP).
- NKG2D ligand e.g., MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, or OMCP.
- Exemplary amino acid sequences of MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, and OMCP are set forth as SEQ ID NOs: 1-9 of WO 2019/191243, respectively, the sequences of which are incorporated herein by reference.
- the ⁇ 1- ⁇ 2 domain is 85% identical to a native or natural ⁇ 1- ⁇ 2 domain of an NKG2D ligand. In yet other embodiments, the ⁇ 1- ⁇ 2 domain is 90% identical to a native or natural ⁇ 1- ⁇ 2 domain of a natural NKG2D ligand protein and binds non-natural NKG2D.
- the MicAbodies of the disclosure comprise ⁇ 1- ⁇ 2 domains which are at least 80% identical or homologous to a native or natural ⁇ 1- ⁇ 2 domain of a human MICA or MICB protein and bind NKG2D.
- the ⁇ 1- ⁇ 2 domain is 85% identical to a native or natural ⁇ 1- ⁇ 2 domain of a human MICA or MICB protein and binds NKG2D. In other embodiments, the ⁇ 1- ⁇ 2 domain is 90%, 95%, 96%, 97%, 98%, or 99% identical to a native or natural ⁇ 1- ⁇ 2 platform domain of a human MICA or MICB protein and binds NKG2D.
- specific mutations in ⁇ 1- ⁇ 2 domains of NKG2D ligands can be made to create non-natural ⁇ 1- ⁇ 2 domains that bind non-natural NKG2D receptors, themselves engineered so as to have reduced affinity for natural NKG2D ligands. This can be done, for example, through genetic engineering.
- a non-natural NKG2D receptor so modified can be used to create on the surface of NK- or T-cells of the immune system an NKG2D-based CAR that can preferentially bind to and be activated by molecules comprised of the non-natural ⁇ 1- ⁇ 2 domains.
- Non-natural NKG2D receptors and their cognate non-natural NKG2D ligands can provide important safety, efficacy, and manufacturing advantages for treating cancer and viral infections as compared to traditional CAR-T cells and CAR-NK cells.
- Activation of CAR-T cells and CAR-NK cells having a NKG2D-based CAR can be controlled by administration of a MicAbody.
- the dosing regimen of the MicAbody can be modified rather than having to deploy an induced suicide mechanism to destroy the infused CAR cells.
- MicAbodies can be generated by attaching an antibody or antigen-binding fragment to an engineered ⁇ 1- ⁇ 2 domain via a linker, e.g., APTSSSGGGGS (SEQ ID NO:188) or GGGS (SEQ ID NO:189).
- a linker e.g., APTSSSGGGGS (SEQ ID NO:188) or GGGS (SEQ ID NO:189).
- an ⁇ 1- ⁇ 2 domain can be fused to the C-terminus of an IgG heavy chain or light chain, for example, as described in WO 2019/191243.
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWD RETRDLTGWGTTLLMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLET LEWTMPQSSRAQTLAMNVRNFLKEDAMETDIGYRLMRADCLSELRRYLKSGVVLRRTV (SEQ ID NO:190) (MICA25.17).
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWD RETRDLTGWGTFLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLET LEWTMPQSSRAQTLAMNVRNFLKEDAMETDRSGLLMRADCLSELRRYLKSGVVLRRTV (SEQ ID NO:191) (MICA25.18).
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence AAEPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKA QNPVLREVVDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFD SEKRMWTTVHPGARKMKEKWENDKVVATTLYTWSMGDCIGWLEDFLMGMDSTLEPSAGAP (SEQ ID NO:192) (ULBP2.S1).
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence AAEPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKA QNPVLREVVDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFD SEKRMWTTVHPGARKMKEKWENDKVVATLMRIWSMGDCIGWLEDFLMGMDSTLEPSAGAP (SEQ ID NO:193) (ULBP2.S2).
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence AAEPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKA QNPVLREVVDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFD SEKRMWTTVHPGARKMKEKWENDKVVATKLYLWSMGDCIGWLEDFLMGMDSTLEPSAGAP (SEQ ID NO:194) (ULBP2.S3).
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence AAEPHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAW GKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCESEADGYIRGSWQFSFDGRKFL LFDSNNRKWTVVHAGARRMKEKWEKDSGLTTDLIRRSMGDCKSWLRDFLMHRKKRLEPTAP (SEQ ID NO:195) (ULBP3.S1).
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence AAEPHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAW GKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCESEADGYIRGSWQFSFDGRKFL LFDSNNRKWTVVHAGARRMKEKWEKDSGLTTYFYLRSMGDCKSWLRDFLMHRKKRLEPTAP (SEQ ID NO:196) (ULBP3.S2).
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence EPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQN PVLREVVDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSE KRMWTTVHPGARKMKEKWENDKVVATILWQTSMGDCIGWLEDFLMGMDSTLEPS (SEQ ID NO:197) (ULBP2.C).
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence EPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQN PVLREVVDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSE KRMWTTVHPGARKMKEKWENDKVVATLLWGWSMGDCIGWLEDFLMGMDSTLEPS (SEQ ID NO:198) (ULBP2.R).
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence EPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQN PVLREVVDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSE KRMWTTVHPGARKMKEKWENDKVVATMFWSWSMGDCIGWLEDFLMGMDSTLEPS (SEQ ID NO:199) (ULBP2.AA).
- the MicAbodies of the disclosure comprise an engineered ⁇ 1- ⁇ 2 domain comprising the amino acid sequence EPHSLSYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQN PVLREVVDILTEQLWDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSE KRMWTTVHPGARKMKEKWENDKVVATLMWQWSMGDCIGWLEDFLMGMDSTLEPS (SEQ ID NO:200) (ULBP2.AB).
- An exemplary engineered NKG2D receptor comprises the amino acid sequence NSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKE DQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCST PNTYICMQRTV (SEQ ID NO:201) in which the tyrosine at position 73 has been replaced with another amino acid, for example alanine.
- Another exemplary engineered NKG2D receptor comprises the amino acid sequence FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYS KEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENC STPNTYICMQRTV (SEQ ID NO:202) in which the tyrosines are positions 75 and 122 have been replaced with another amino acid, for example alanine at position 75 and phenylalanine at position 122.
- the present disclosure encompasses nucleic acid molecules encoding immunoglobulin light and heavy chain genes for anti-glyco-CD44 antibodies, vectors comprising such nucleic acids, and host cells capable of producing the anti-glyco-CD44 antibodies of the disclosure.
- the nucleic acid molecules encode, and the host cells are capable of expressing, the anti-glyco-CD44 antibodies and antibody-binding fragments of the disclosure (e.g., as described in Section 6.1 and numbered embodiments 1 to 384 of Group I and numbered embodiment 1 to 172 of Group II) as well as fusion proteins (e.g., as described in numbered embodiments 385 to 414 of Group I and numbered embodiments 173 to 197 of Group II) and chimeric antigen receptors (e.g., as described in Section 6.3 and numbered embodiments 415 to 451 of Group I and 198 to 225 of Group II) containing them, and TCR fusion proteins (e.g., as described in Section 6.4 and numbered embodiments 462 to 490 of Group I and 236 to 264 of Group II).
- the anti-glyco-CD44 antibodies and antibody-binding fragments of the disclosure e.g., as described in Section 6.1 and numbered embodiments 1 to 384 of Group I and numbered embodiment 1
- Exemplary vectors of the disclosure are described in numbered embodiments 520 to 522 of Group I and 312 to 314 of Group II and exemplary host cells are described in numbered embodiments 523 to 542 of Group I and 315 to 335 of Group II.
- An anti-glyco-CD44 antibody of the disclosure can be prepared by recombinant expression of immunoglobulin light and heavy chain genes in a host cell.
- a host cell is transfected with one or more recombinant expression vectors carrying DNA fragments encoding the immunoglobulin light and heavy chains of the antibody such that the light and heavy chains are expressed in the host cell and, optionally, secreted into the medium in which the host cells are cultured, from which medium the antibodies can be recovered.
- Standard recombinant DNA methodologies are used to obtain antibody heavy and light chain genes, incorporate these genes into recombinant expression vectors and introduce the vectors into host cells, such as those described in Molecular Cloning; A Laboratory Manual, Second Edition (Sambrook, Fritsch and Maniatis (eds), Cold Spring Harbor, N. Y., 1989), Current Protocols in Molecular Biology (Ausubel, F.
- DNA fragments encoding the light and heavy chain variable regions are first obtained. These DNAs can be obtained by amplification and modification of germline DNA or cDNA encoding light and heavy chain variable sequences, for example using the polymerase chain reaction (PCR).
- PCR polymerase chain reaction
- Germline DNA sequences for human heavy and light chain variable region genes are known in the art (See, e.g., the “VBASE” human germline sequence database; see also Kabat et al., 1991, Sequences of Proteins of Immunological Interest, Fifth Edition, U.S.
- DNA fragments encoding anti-glyco-CD44 antibody-related V H and V L segments are obtained, these DNA fragments can be further manipulated by standard recombinant DNA techniques, for example to convert the variable region genes to full-length antibody chain genes, to Fab fragment genes or to a scFv gene.
- a V H - or V L -encoding DNA fragment is operatively linked to another DNA fragment encoding another protein, such as an antibody constant region or a flexible linker.
- the term “operatively linked,” as used in this context, is intended to mean that the two DNA fragments are joined such that the amino acid sequences encoded by the two DNA fragments remain in-frame.
- the isolated DNA encoding the V H region can be converted to a full-length heavy chain gene by operatively linking the V H -encoding DNA to another DNA molecule encoding heavy chain constant regions (CH 1 , CH 2 , CH 3 and, optionally, CH 4 ).
- the sequences of human heavy chain constant region genes are known in the art (See, e.g., Kabat et al., 1991, Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No.91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
- the heavy chain constant region can be an IgG 1 , IgG 2 , IgG 3 , IgG 4 , IgA, IgE, IgM or IgD constant region, but in certain embodiments is an IgG 1 or IgG 4 constant region.
- the V H -encoding DNA can be operatively linked to another DNA molecule encoding only the heavy chain CH1 constant region.
- the isolated DNA encoding the V L region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the V L -encoding DNA to another DNA molecule encoding the light chain constant region, CL.
- the sequences of human light chain constant region genes are known in the art (See, e.g., Kabat et al., 1991, Sequences of Proteins of Immunological Interest, Fifth Edition, U.S.
- the light chain constant region can be a kappa or lambda constant region, but in certain embodiments is a kappa constant region.
- the V H - and V L -encoding DNA fragments can be operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly 4 ⁇ Ser) 3 (SEQ ID NO:184), such that the V H and V L sequences can be expressed as a contiguous single-chain protein, with the V H and V L regions joined by the flexible linker (See, e.g., Bird et al., 1988, Science 242:423-426; Huston et al., 1988, Proc. Natl. Acad. Sci.
- a flexible linker e.g., encoding the amino acid sequence (Gly 4 ⁇ Ser) 3 (SEQ ID NO:184
- DNAs encoding partial or full-length light and heavy chains, obtained as described above, are inserted into expression vectors such that the genes are operatively linked to transcriptional and translational control sequences.
- operatively linked is intended to mean that an antibody gene is ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the antibody gene.
- the expression vector and expression control sequences are chosen to be compatible with the expression host cell used.
- the antibody light chain gene and the antibody heavy chain gene can be inserted into separate vectors or, more typically, both genes are inserted into the same expression vector.
- the antibody genes are inserted into the expression vector by standard methods (e.g., ligation of complementary restriction sites on the antibody gene fragment and vector, or blunt end ligation if no restriction sites are present).
- the expression vector Prior to insertion of the anti-glyco-CD44 antibody-related light or heavy chain sequences, the expression vector can already carry antibody constant region sequences.
- one approach to converting the anti-glyco- CD44 monoclonal antibody-related V H and V L sequences to full-length antibody genes is to insert them into expression vectors already encoding heavy chain constant and light chain constant regions, respectively, such that the V H segment is operatively linked to the CH segment(s) within the vector and the V L segment is operatively linked to the CL segment within the vector.
- the recombinant expression vector can encode a signal peptide that facilitates secretion of the antibody chain from a host cell.
- the antibody chain gene can be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the antibody chain gene.
- the signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide (i.e., a signal peptide from a non-immunoglobulin protein).
- the recombinant expression vectors of the disclosure carry regulatory sequences that control the expression of the antibody chain genes in a host cell.
- the term “regulatory sequence” is intended to include promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
- regulatory sequences are described, for example, in Goeddel, Gene Expression Technology: Methods in Enzymology 185, Academic Press, San Diego, Calif., 1990.
- Suitable regulatory sequences for mammalian host cell expression include viral elements that direct high levels of protein expression in mammalian cells, such as promoters and/or enhancers derived from cytomegalovirus (CMV) (such as the CMV promoter/enhancer), Simian Virus 40 (SV40) (such as the SV40 promoter/enhancer), adenovirus, (e.g., the adenovirus major late promoter (AdMLP)) and polyoma.
- CMV cytomegalovirus
- SV40 Simian Virus 40
- AdMLP adenovirus major late promoter
- the recombinant expression vectors of the disclosure can carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
- the selectable marker gene facilitates selection of host cells into which the vector has been introduced (See, e.g., U.S. Pat.
- the selectable marker gene confers resistance to drugs, such as G418, hygromycin or methotrexate, on a host cell into which the vector has been introduced.
- Suitable selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in DHFR- host cells with methotrexate selection/amplification) and the neo gene (for G418 selection).
- DHFR dihydrofolate reductase
- the expression vector(s) encoding the heavy and light chains is transfected into a host cell by standard techniques.
- transfection are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, lipofection, calcium-phosphate precipitation, DEAE--dextran transfection and the like.
- prokaryotic or eukaryotic host cells e.g., electroporation, lipofection, calcium-phosphate precipitation, DEAE--dextran transfection and the like.
- expression of antibodies is performed in eukaryotic cells, e.g., mammalian host cells, of optimal secretion of a properly folded and immunologically active antibody.
- Exemplary mammalian host cells for expressing the recombinant antibodies of the disclosure include Chinese Hamster Ovary (CHO cells) (including DHFR- CHO cells, described in Urlaub and Chasin, 1980, Proc. Natl. Acad. Sci. USA 77:4216- 4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp, 1982, Mol. Biol.159:601-621), NSO myeloma cells, COS cells and SP2 cells.
- Chinese Hamster Ovary CHO cells
- DHFR- CHO cells described in Urlaub and Chasin, 1980, Proc. Natl. Acad. Sci. USA 77:4216- 4220, used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp, 1982, Mol. Biol.159:601-621
- NSO myeloma cells COS cells and SP2 cells.
- the antibodies When recombinant expression vectors encoding antibody genes are introduced into mammalian host cells, the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or secretion of the antibody into the culture medium in which the host cells are grown. Antibodies can be recovered from the culture medium using standard protein purification methods. Host cells can also be used to produce portions of intact antibodies, such as Fab fragments or scFv molecules. It is understood that variations on the above procedure are within the scope of the present disclosure. For example, it can be desirable to transfect a host cell with DNA encoding either the light chain or the heavy chain (but not both) of an anti-glyco-CD44 antibody of this disclosure.
- the host cell is a T cell, preferably a human T cell.
- the host cell exhibits an anti-tumor immunity when the cell is cross-linked with CD44 on a tumor cell.
- Detailed methods for producing the T cells of the disclosure are described in Section 6.6.1.
- the host cell is a T cell, preferably a human T cell.
- the host cell exhibits an anti-tumor immunity when the cell is cross-linked with glyco-CD44 on a tumor cell.
- Detailed methods for producing the T cells of the disclosure are described in Section 6.6.1.
- the host cell is a T cell, preferably a human T cell.
- the host cell exhibits an anti-tumor immunity when the cell is cross-linked with glyco-CD44 on a tumor cell.
- Recombinant DNA technology can also be used to remove some or all of the DNA encoding either or both of the light and heavy chains that is not necessary for binding to glyco- CD44.
- the molecules expressed from such truncated DNA molecules are also encompassed by the antibodies of the disclosure.
- the host cell can be co-transfected with two expression vectors of the disclosure, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide.
- the two vectors can contain identical selectable markers, or they can each contain a separate selectable marker.
- a single vector can be used which encodes both heavy and light chain polypeptides.
- nucleic acid encoding one or more portions of an anti-glyco-CD44 antibody further alterations or mutations can be introduced into the coding sequence, for example to generate nucleic acids encoding antibodies with different CDR sequences, antibodies with reduced affinity to the Fc receptor, or antibodies of different subclasses.
- the anti-glyco-CD44 antibodies of the disclosure can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd ed., 1984 The Pierce Chemical Co., Rockford, Ill.).
- Variant antibodies can also be generated using a cell-free platform (See, e.g., Chu et al., Biochemia No.2, 2001 (Roche Molecular Biologicals) and Murray et al., 2013, Current Opinion in Chemical Biology, 17:420-426).
- a cell-free platform See, e.g., Chu et al., Biochemia No.2, 2001 (Roche Molecular Biologicals) and Murray et al., 2013, Current Opinion in Chemical Biology, 17:420-426).
- an anti-glyco-CD44 antibody of the disclosure Once an anti-glyco-CD44 antibody of the disclosure has been produced by recombinant expression, it can be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
- chromatography e.g
- the anti-glyco-CD44 antibodies of the present disclosure and/or binding fragments can be fused to heterologous polypeptide sequences described herein or otherwise known in the art to facilitate purification.
- the anti-glyco-CD44 antibody can, if desired, be further purified, e.g., by high performance liquid chromatography (see, e.g., Fisher, Laboratory Techniques In Biochemistry And Molecular Biology, Work and Burdon, eds., Elsevier, 1980), or by gel filtration chromatography on a SuperdexTM 75 column (Pharmacia Biotech AB, Uppsala, Sweden). 6.6.1.
- nucleic acids encoding the anti-glyco-CD44 CARs, TCR fusion proteins, or STARs of the disclosure are delivered into cells using a retroviral or lentiviral vector.
- CAR-, TCR fusion protein-, or STAR-expressing retroviral and lentiviral vectors can be delivered into different types of eukaryotic cells as well as into tissues and whole organisms using transduced cells as carriers or cell-free local or systemic delivery of encapsulated, bound or naked vectors.
- the method used can be for any purpose where stable expression is required or sufficient.
- the CAR, TCR fusion protein, or STAR sequences are delivered into cells using in vitro transcribed mRNA.
- In vitro transcribed mRNA CAR, TCR fusion protein, or STAR can be delivered into different types of eukaryotic cells as well as into tissues and whole organisms using transfected cells as carriers or cell-free local or systemic delivery of encapsulated, bound or naked mRNA. The method used can be for any purpose where transient expression is required or sufficient.
- the desired CAR, TCR fusion protein, or STAR can be expressed in the cells by way of transposons.
- RNA transfection is essentially transient and a vector-free: an RNA transgene can be delivered to a lymphocyte and expressed therein following a brief in vitro cell activation, as a minimal expressing cassette without the need for any additional viral sequences. Under these conditions, integration of the transgene into the host cell genome is unlikely. Cloning of cells is not necessary because of the efficiency of transfection of the RNA and its ability to uniformly modify the entire lymphocyte population.
- IVT-RNA in vitro-transcribed RNA
- IVT-RNA in vitro-transcribed RNA by means of lipofection or electroporation.
- IVT vectors are known in the literature which are utilized in a standardized manner as template for in vitro transcription and which have been genetically modified in such a way that stabilized RNA transcripts are produced.
- RNA polymerase promoter enabling RNA transcription, followed by a gene of interest which is flanked either 3' and/or 5' by untranslated regions (UTR), and a 3' polyadenyl cassette containing 50-70 A nucleotides (SEQ ID NO:204).
- UTR untranslated regions
- SEQ ID NO:204 3' polyadenyl cassette containing 50-70 A nucleotides
- RNA has several advantages over more traditional plasmid or viral approaches. Gene expression from an RNA source does not require transcription and the protein product is produced rapidly after the transfection. Further, since the RNA has to only gain access to the cytoplasm, rather than the nucleus, and therefore typical transfection methods result in an extremely high rate of transfection. In addition, plasmid based approaches require that the promoter driving the expression of the gene of interest be active in the cells under study.
- the RNA construct can be delivered into the cells by electroporation. See, e.g., the formulations and methodology of electroporation of nucleic acid constructs into mammalian cells as taught in US 2004/0014645, US 2005/0052630A1, US 2005/0070841A1, US 2004/0059285A1, US 2004/0092907A1.
- the various parameters including electric field strength required for electroporation of any known cell type are generally known in the relevant research literature as well as numerous patents and applications in the field. See e.g., U.S. Pat. No.6,678,556, U.S. Pat. No.7,171,264, and U.S. Pat. No.7,173,116.
- Apparatus for therapeutic application of electroporation are available commercially, e.g., the MedPulserTM DNA Electroporation Therapy System (Inovio/Genetronics, San Diego, Calif.), and are described in patents such as U.S. Pat. No.6,567,694; U.S. Pat. No.6,516,223, U.S. Pat. No.5,993,434, U.S. Pat. No.6,181,964, U.S. Pat. No.6,241,701, and U.S. Pat. No.6,233,482; electroporation may also be used for transfection of cells in vitro as described e.g. in US20070128708A1.
- Electroporation may also be utilized to deliver nucleic acids into cells in vitro. Accordingly, electroporation-mediated administration into cells of nucleic acids including expression constructs utilizing any of the many available devices and electroporation systems known to those of skill in the art presents an exciting new means for delivering an RNA of interest to a target cell.
- 6.6.1.1 Sources of T Cells Prior to expansion and genetic modification, a source of T cells is obtained from a subject.
- the term “subject” is intended to include living organisms in which an immune response can be elicited (e.g., mammals). Examples of subjects include humans, dogs, cats, mice, rats, and transgenic species thereof. Preferably, subjects are human.
- T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present disclosure, any number of T cell lines available in the art, may be used. In certain embodiments of the present disclosure, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as FicollTM separation. In one preferred embodiment, cells from the circulating blood of an individual are obtained by apheresis.
- the apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.
- the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
- the cells are washed with phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. Again, surprisingly, initial activation steps in the absence of calcium lead to magnified activation.
- a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated “flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions.
- a semi-automated “flow-through” centrifuge for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5
- the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS, PlasmaLyte A, or other saline solution with or without buffer.
- the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.
- T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLLTM gradient or by counterflow centrifugal elutriation.
- a specific subpopulation of T cells such as CD3 + , CD28', CD4 + , CD8 + , CD45RA + and CD45RO + T cells, can be further isolated by positive or negative selection techniques.
- T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3 x 28)-conjugated beads, such as DYNABEADS® M-450 CD3/CD28 T, for a time period sufficient for positive selection of the desired T cells.
- the time period is about 30 minutes.
- the time period ranges from 30 minutes to 36 hours or longer and all integer values there between.
- the time period is at least 1, 2, 3, 4, 5, or 6 hours.
- the time period is 10 to 24 hours.
- the incubation time period is 24 hours.
- TIL tumor infiltrating lymphocytes
- subpopulations of T cells can be preferentially selected for or against at culture initiation or at other desired time points.
- multiple rounds of selection can also be used in the context of this disclosure.
- Unselected” cells can also be subjected to further rounds of selection.
- Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells.
- One method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected.
- a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11b, CD16, HLA- DR, and CD8.
- it may be desirable to enrich for or positively select for regulatory T cells which typically express CD4 + , CD25 + , CD62L hi , GITR + , and FoxP3 + .
- T regulatory cells are depleted by anti-C25 conjugated beads or other similar method of selection.
- the concentration of cells and surface can be varied. In certain embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one embodiment, a concentration of 2 billion cells/ml is used. In one embodiment, a concentration of 1 billion cells/ml is used. In a further embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
- a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used.
- concentrations can result in increased cell yield, cell activation, and cell expansion.
- use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc.). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8 + T cells that normally have weaker CD28 expression.
- the concentration of cells used is 5 x 10 6 /ml. In other embodiments, the concentration used can be from about 1 x 10 5 /ml to 1 x 10 6 /ml, and any integer value in between.
- the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10° C. or at room temperature.
- T cells for stimulation can also be frozen after a washing step.
- the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population.
- the cells may be suspended in a freezing solution.
- one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to -80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank.
- cryopreserved cells are thawed and washed as described herein and allowed to rest for one hour at room temperature prior to activation using the methods of the present disclosure.
- the collection of blood samples or apheresis product from a subject at a time period prior to when the expanded cells as described herein might be needed.
- the source of the cells to be expanded can be collected at any time point necessary, and desired cells, such as T cells, isolated and frozen for later use in T cell therapy for any number of diseases or conditions that would benefit from T cell therapy, such as those described herein.
- a blood sample or an apheresis is taken from a generally healthy subject.
- a blood sample or an apheresis is taken from a generally healthy subject who is at risk of developing a disease, but who has not yet developed a disease, and the cells of interest are isolated and frozen for later use.
- the T cells may be expanded, frozen, and used at a later time.
- samples are collected from a patient shortly after diagnosis of a particular disease as described herein but prior to any treatments.
- the cells are isolated from a blood sample or an apheresis from a subject prior to any number of relevant treatment modalities, including but not limited to treatment with agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3 antibodies, cytoxan, fludarabine, cyclosporin, FK506, rapamycin, mycophenolic acid, steroids, FR901228, and irradiation.
- agents such as natalizumab, efalizumab, antiviral agents, chemotherapy, radiation, immunosuppressive agents, such as cyclosporin, azathioprine, methotrexate, mycophenolate, and FK506, antibodies, or other immunoablative agents such as CAMPATH, anti-CD3
- the cells are isolated for a patient and frozen for later use in conjunction with (e.g., before, simultaneously or following) bone marrow or stem cell transplantation or T cell ablative therapy using either chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide.
- chemotherapy agents such as, fludarabine, external-beam radiation therapy (XRT), cyclophosphamide.
- XRT external-beam radiation therapy
- cyclophosphamide cyclophosphamide
- these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
- these cells may be in a preferred state for enhanced engraftment and in vivo expansion.
- blood cells including T cells, dendritic cells, or other cells of the hematopoietic lineage, during this recovery phase.
- mobilization for example, mobilization with GM-CSF
- conditioning regimens can be used to create a condition in a subject wherein repopulation, recirculation, regeneration, and/or expansion of particular cell types is favored, especially during a defined window of time following therapy.
- Illustrative cell types include T cells, B cells, dendritic cells, and other cells of the immune system.
- T cells are activated and expanded generally using methods as described, for example, in U.S. Pat. Nos.6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; 9,783,591; and U.S. Patent Application Publication No.20060121005.
- the T cells of the disclosure are expanded by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a co-stimulatory molecule on the surface of the T cells.
- T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody, or antigen-binding fragment thereof, or an anti-CD2 antibody immobilized on a surface, or by contact with a protein kinase C activator (e.g., bryostatin) in conjunction with a calcium ionophore.
- a ligand that binds the accessory molecule is used for co-stimulation of an accessory molecule on the surface of the T cells.
- a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells.
- an anti-CD3 antibody and an anti-CD28 antibody can be used as can other methods commonly known in the art (Berg et al., Transplant Proc.30(8):3975-3977, 1998; Haanen et al., J. Exp. Med.190(9):13191328, 1999; Garland et al., J.
- the primary stimulatory signal and the co-stimulatory signal for the T cell may be provided by different protocols.
- the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in "cis” formation) or to separate surfaces (i.e., in "trans” formation).
- one agent may be coupled to a surface and the other agent in solution.
- the agent providing the co-stimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain embodiments, both agents can be in solution.
- the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
- a surface such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents.
- the two agents are immobilized on beads, either on the same bead, i.e., “cis,” or to separate beads, i.e., “trans.”
- the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the co-stimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof; and both agents are co-immobilized to the same bead in equivalent molecular amounts.
- a 1:1 ratio of each antibody bound to the beads for CD4 + T cell expansion and T cell growth is used.
- a ratio of anti CD3:CD28 antibodies bound to the beads is used such that an increase in T cell expansion is observed as compared to the expansion observed using a ratio of 1:1. In one particular embodiment an increase of from about 1 to about 3 fold is observed as compared to the expansion observed using a ratio of 1:1. In one embodiment, the ratio of CD3:CD28 antibody bound to the beads ranges from 100:1 to 1:100 and all integer values there between. In one aspect of the present disclosure, more anti-CD28 antibody is bound to the particles than anti- CD3 antibody, i.e., the ratio of CD3:CD28 is less than one. In certain embodiments of the disclosure, the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2:1.
- a 1:100 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:75 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:50 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:30 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:10 CD3:CD28 ratio of antibody bound to beads is used.
- a 1:3 CD3:CD28 ratio of antibody bound to the beads is used.
- a 3:1 CD3:CD28 ratio of antibody bound to the beads is used.
- Ratios of particles to cells from 1:500 to 500:1 and any integer values in between may be used to stimulate T cells or other target cells.
- the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many.
- the ratio of cells to particles ranges from 1:100 to 100:1 and any integer values in-between and in further embodiments the ratio comprises 1:9 to 9:1 and any integer values in between, can also be used to stimulate T cells.
- the ratio of anti-CD3- and anti-CD28-coupled particles to T cells that result in T cell stimulation can vary as noted above, however certain preferred values include 1:100, 1:50, 1:40, 1:30, 1:20, 1:10, 1:9, 1:8, 1:7, 1:6, 1:5, 1:4, 1:3, 1:2, 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, and 15:1 with one preferred ratio being at least 1:1 particles per T cell.
- a ratio of particles to cells of 1:1 or less is used.
- a preferred particle: cell ratio is 1:5.
- the ratio of particles to cells can be varied depending on the day of stimulation.
- the ratio of particles to cells is from 1:1 to 10:1 on the first day and additional particles are added to the cells every day or every other day thereafter for up to 10 days, at final ratios of from 1:1 to 1:10 (based on cell counts on the day of addition).
- the ratio of particles to cells is 1:1 on the first day of stimulation and adjusted to 1:5 on the third and fifth days of stimulation.
- particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:5 on the third and fifth days of stimulation.
- the ratio of particles to cells is 2:1 on the first day of stimulation and adjusted to 1:10 on the third and fifth days of stimulation.
- particles are added on a daily or every other day basis to a final ratio of 1:1 on the first day, and 1:10 on the third and fifth days of stimulation.
- ratios will vary depending on particle size and on cell size and type.
- the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.
- a force such as a magnetic force
- cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached (3 x 28 beads) to contact the T cells.
- the cells for example, 10 4 to 10 9 T cells
- beads for example, DYNABEADS® M-450 CD3/CD28 T paramagnetic beads at a ratio of 1:1
- a buffer preferably PBS (without divalent cations such as, calcium and magnesium).
- the target cell may be very rare in the sample and comprise only 0.01% of the sample or the entire sample (i.e., 100%) may comprise the target cell of interest. Accordingly, any cell number is within the context of the present disclosure.
- a concentration of about 2 billion cells/ml is used.
- greater than 100 million cells/ml is used.
- a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used.
- a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells. Such populations of cells may have therapeutic value and would be desirable to obtain in certain embodiments. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression. [0345] In one embodiment of the present disclosure, the mixture may be cultured for several hours (about 3 hours) to about 14 days or any hourly integer value in between.
- the mixture may be cultured for 21 days.
- the beads and the T cells are cultured together for about eight days.
- the beads and T cells are cultured together for 2-3 days. Several cycles of stimulation may also be desired such that culture time of T cells can be 60 days or more.
- Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN- ⁇ , IL-4, IL- 7, GM-CSF, IL-10, IL-12, IL-15, TGF ⁇ , and TNF- ⁇ or any other additives for the growth of cells known to the skilled artisan.
- Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2- mercaptoethanol.
- Media can include RPMI 1640, AIM-V, DMEM, MEM, ⁇ -MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells.
- Antibiotics e.g., penicillin and streptomycin, are included only in experimental cultures, not in cultures of cells that are to be infused into a subject.
- T cells that have been exposed to varied stimulation times may exhibit different characteristics.
- typical blood or apheresed peripheral blood mononuclear cell products have a helper T cell population (T H , CD4 + ) that is greater than the cytotoxic or suppressor T cell population (T C , CD8 + ).
- T H , CD4 + helper T cell population
- T C , CD8 + cytotoxic or suppressor T cell population
- Ex vivo expansion of T cells by stimulating CD3 and CD28 receptors produces a population of T cells that prior to about days 8-9 consists predominately of T H cells, while after about days 8-9, the population of T cells comprises an increasingly greater population of TC cells.
- infusing a subject with a T cell population comprising predominately of T H cells may be advantageous.
- an antigen-specific subset of T C cells has been isolated it may be beneficial to expand this subset to a greater degree.
- other phenotypic markers vary significantly, but in large part, reproducibly during the course of the cell expansion process. Thus, such reproducibility enables the ability to tailor an activated T cell product for specific purposes.
- Neuraminidases Sialic acids are terminal sugars of glycans on either glycoproteins or glycolipids on the cell surface, and have been shown to be aberrantly expressed during tumor transformation and malignant progression.
- Host cells e.g., T cells, NK cells
- a CAR of the disclosure can be engineered to coexpress a cell surface or secreted neuraminidase (sialidase) along with the CAR.
- the cell surface neuraminidase anchored to the cell surface via a heterologous transmembrane, gives the host cell glycoediting activity.
- neuraminidase can be coexpressed in a host cell along with a CAR described herein. Exemplary host cells coexpressing a neuraminidase and a CAR are described in the specific embodiments.
- the neuraminidase can be included as a domain of a fusion protein described herein.
- Exemplary fusion proteins are described in the specific emdodiments and FIGS.7A-7E.
- Nucleotide sequences encoding 4C8 CAR-neuraminidase fusion proteins are shown in Table 6A.
- Amino acid sequences of the 4C8 CAR-neuraminidase fusion proteins are shown in Table 6B.
- compositions comprising the anti-glyco-CD44 antibody, fusion protein and/or ADC and one or more carriers, excipients and/or diluents.
- the compositions may be formulated for specific uses, such as for veterinary uses or pharmaceutical uses in humans.
- the form of the composition e.g., dry powder, liquid formulation, etc.
- the excipients, diluents and/or carriers used will depend upon the intended uses of the antibody, fusion protein and/or ADC and, for therapeutic uses, the mode of administration.
- the compositions may be supplied as part of a sterile, pharmaceutical composition that includes a pharmaceutically acceptable carrier.
- This composition can be in any suitable form (depending upon the desired method of administering it to a patient).
- the pharmaceutical composition can be administered to a patient by a variety of routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intratumorally, intrathecally, topically or locally.
- routes for administration in any given case will depend on the particular antibody and/or ADC, the subject, and the nature and severity of the disease and the physical condition of the subject.
- the pharmaceutical composition will be administered intravenously or subcutaneously.
- compositions can be conveniently presented in unit dosage forms containing a predetermined amount of an anti-glyco-CD44 antibody and/or anti-glyco-CD44 ADC of the disclosure per dose.
- the quantity of antibody and/or ADC included in a unit dose will depend on the disease being treated, as well as other factors as are well known in the art.
- Such unit dosages may be in the form of a lyophilized dry powder containing an amount of antibody and/or ADC suitable for a single administration, or in the form of a liquid.
- Dry powder unit dosage forms may be packaged in a kit with a syringe, a suitable quantity of diluent and/or other components useful for administration.
- Unit dosages in liquid form may be conveniently supplied in the form of a syringe pre-filled with a quantity of antibody and/or ADC suitable for a single administration.
- the pharmaceutical compositions may also be supplied in bulk form containing quantities of antibody and/or ADC suitable for multiple administrations.
- compositions may be prepared for storage as lyophilized formulations or aqueous solutions by mixing an antibody, fusion protein, and/or ADC having the desired degree of purity with optional pharmaceutically-acceptable carriers, excipients or stabilizers typically employed in the art (all of which are referred to herein as "carriers"), i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives. See, Remington's Pharmaceutical Sciences, 16th edition (Osol, ed. 1980). Such additives should be nontoxic to the recipients at the dosages and concentrations employed.
- Buffering agents help to maintain the pH in the range which approximates physiological conditions.
- Suitable buffering agents for use with the present disclosure include both organic and inorganic acids and salts thereof such as citrate buffers (e.g., monosodium citrate-disodium citrate mixture, citric acid-trisodium citrate mixture, citric acid-monosodium citrate mixture, etc.), succinate buffers (e.g., succinic acid- monosodium succinate mixture, succinic acid-sodium hydroxide mixture, succinic acid-disodium succinate mixture, etc.), tartrate buffers (e.g., tartaric acid-sodium tartrate mixture, tartaric acid- potassium tartrate mixture, tartaric acid-sodium hydroxide mixture, etc.), fumarate buffers (e.g., fumaric acid-monosodium fumarate mixture, fumaric acid-disodium fumarate mixture, mono
- Preservatives may be added to retard microbial growth, and can be added in amounts ranging from about 0.2%-1% (w/v).
- Suitable preservatives for use with the present disclosure include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalconium halides (e.g., chloride, bromide, and iodide), hexamethonium chloride, and alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
- Isotonicifiers sometimes known as “stabilizers” can be added to ensure isotonicity of liquid compositions of the present disclosure and include polyhydric sugar alcohols, for example trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol and mannitol.
- Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which solubilizes the therapeutic agent or helps to prevent denaturation or adherence to the container wall.
- Typical stabilizers can be polyhydric sugar alcohols (enumerated above); amino acids such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, threonine, etc., organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol and the like, including cyclitols such as inositol; polyethylene glycol; amino acid polymers; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, ⁇ - monothioglycerol and sodium thio sulfate; low mo
- Stabilizers may be present in amounts ranging from 0.5 to 10 wt % per wt of ADC.
- Non-ionic surfactants or detergents also known as "wetting agents” may be added to help solubilize the glycoprotein as well as to protect the glycoprotein against agitation-induced aggregation, which also permits the formulation to be exposed to shear surface stressed without causing denaturation of the protein.
- Suitable non-ionic surfactants include polysorbates (20, 80, etc.), polyoxamers (184, 188 etc.), and pluronic polyols.
- Non-ionic surfactants may be present in a range of about 0.05 mg/mL to about 1.0 mg/mL, for example about 0.07 mg/mL to about 0.2 mg/mL.
- Additional miscellaneous excipients include bulking agents (e.g., starch), chelating agents (e.g., EDTA), antioxidants (e.g., ascorbic acid, methionine, vitamin E), and cosolvents. 6.9 Methods of Use [0362]
- the anti-glyco-CD44 antibody or binding fragments described herein can be used in various diagnostic assays. and therapeutic methods.
- a patient can be diagnosed with a cancer using any method as described herein (e.g., as described in Section 6.9.1) and subsequently treated using any method as described herein (e.g., as described in Section 6.9.2).
- the diagnostic methods described herein e.g., as described in Section 6.9.1 can be utilized to monitor the patient’s cancer status during or following cancer therapy (including but not limited to cancer therapy as described in Section 6.9.2). 6.9.1. Diagnostic Methods [0363]
- the anti-glyco-CD44 antibody or binding fragments can be used in diagnostic assays.
- the antibodies and binding fragments can be employed in immunoassays, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays, including immunohistochemistry, enzyme-linked immunosorbent assay (ELISA), fluorescence-activated cell sorting (FACS), and Western blots.
- immunoassays such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays, including immunohistochemistry, enzyme-linked immunosorbent assay (ELISA), fluorescence-activated cell sorting (FACS), and Western blots.
- ELISA enzyme-linked immunosorbent assay
- FACS fluorescence-activated cell sorting
- the anti-glyco-CD44 antibody or binding fragments described herein can be used in a detection assay and/or a diagnostic assay to detect a biomarker in a sample, such as, e.g., a patient-derived biological sample.
- the biomarker may be a protein biomarker (e.g., a tumor- associated glycoform of CD44, for example a glycoform of CD44v6, GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text (the “CD44v6 glycopeptide”) present on the surface of or within, e.g., a cancer cell or a cancer-derived extracellular vesicle.
- a protein biomarker e.g., a tumor- associated glycoform of CD44, for example a glycoform of CD44v6, GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165), glycosylated with GalNAc on the serine and threonine residues shown in bold underlined text (the “CD44v6 glycopeptide”) present on the surface of or within, e.g., a cancer cell or a cancer-derived extracellular ve
- An anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure can be used in a method of detecting a biomarker in a sample comprising one or more EVs (e.g., a liquid biopsy).
- an EV surface biomarker is recognized by the anti-glyco-CD44 antibody or antigen-binding fragment of the disclosure.
- Exemplary methods of detecting the biomarker include, but are not limited to, capture assays, immunoassays, such as immunoprecipitation; Western blot; ELISA; immunohistochemistry; immunocytochemistry; flow cytometry; and immuno-PCR.
- an immunoassay can be a chemiluminescent immunoassay.
- an immunoassay can be a high- throughput and/or automated immunoassay platform.
- the anti-glyco-CD44 antibody or binding fragments described herein also are useful for radiographic in vivo imaging, wherein an antibody labeled with a detectable moiety such as a radio-opaque agent or radioisotope is administered to a subject, preferably into the bloodstream, and the presence and location of the labeled antibody in the host is assayed. This imaging technique is useful in the staging and treatment of malignancies. 6.9.2.
- the anti-glyco-CD44 antibody or binding fragments, fusion proteins, ADCs, CARs, TCR fusion proteins, and STARs described herein are useful for treatment of glyco-CD44 expressing cancers, including breast cancer, lung cancer, pancreatic cancer, colorectal cancer, ovarian cancer, gastric cancer, or head and neck cancer, skin cancer, malignant melanomas, liver cancer, gliomas, thyroid cancer, kidney cancer, prostate cancer and other urogenital cancers, cervical cancer, and endometrial cancer.
- the disclosure provides anti-glyco-CD44 antibodies, binding fragments, fusion proteins, ADCs, CARs, TCR fusion proteins, and STARs as described herein for use as a medicament, for example for use in the treatment of cancer, e.g., any of the cancers identified in the previous paragraph, for use in a diagnostic assay, and for use in radiographic in vivo imaging.
- the disclosure further provides for the use of the anti-glyco-CD44 antibodies, binding fragments, fusion proteins, ADCs, CARs, TCR fusion proteins, and STARs as described herein in the manufacture of a medicament, for example for the treatment of cancer, e.g., any of the cancers identified in the previous paragraph.
- the therapeutic methods of the disclosure comprise administering to a subject with a glyco-CD44- expressing tumor an effective amount of a genetically modified cell engineered to express a CAR, TCR fusion protein, or STAR of the disclosure, for example a CAR as described in Section 6.3 or in numbered embodiments 415 to 451 of Group I and 198 to 225 of Group II, a TCR fusion protein as described in Section 6.4 or in numbered embodiments 462 to 490 of Group I and 236 to 264 of Group II, or a STAR as described in Section 6.4.1 or in or in numbered embodiments 491 to 517 of Group I and 265 to 309 of Group II, or a MicAbody described in Section 6.5 or numbered embodiments 391 to 394 of Group I and 179 to 182 of Group II.
- a CAR as described in Section 6.3 or in numbered embodiments 415 to 451 of Group I and 198 to 225 of Group II
- a TCR fusion protein as described in Section 6.4 or in numbered
- the therapeutic methods of the disclosure comprise administering to a subject with a glyco-CD44-expressing tumor therapeutically effective amounts of a MicAbody of the disclosure, for example a MicAbody described in Section 6.5 or numbered embodiments 391 to 394 of Group I and 179 to 182 of Group II, and a genetically modified T-cell engineered to express a CAR comprising a NKG2D receptor capable of specifically binding the MicAbody.
- CD44v6 Peptides comprising the amino acid GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165), or a fragment thereof.
- the CD44v6 glycopeptide is glycosylated with GalNAc on the serine and threonine residues shown with bold and underlined text (i.e., threonine at amino acid position 5 of SEQ ID NO:165 and/or serine at amino acid position 12 of SEQ ID NO:165), or a fragment thereof.
- Exemplary isolated CD44v6 glycopeptides are described in numbered embodiments 628-633 of Group I.
- the present disclosure encompasses synthetic synthesis of the isolated CD44v6 glycoproteins and recombinant methods for producing the isolated CD44v6 glycoproteins.
- the isolated CD44v6 peptides are synthesized using a sold- phase peptide synthesis (SPPS) strategy. SPPS methods are known in the art. SPPS provides for the rapid assembly of a polypeptide through successive reactions of amino acid derivatives on a solid support. Through repeated cycles of alternating N-terminal deprotection and coupling reactions, successive amino acid derivatives are added to the polypeptide.
- SPPS sold- phase peptide synthesis
- SPPS sold- phase peptide synthesis
- SPPS provides for the rapid assembly of a polypeptide through successive reactions of amino acid derivatives on a solid support. Through repeated cycles of alternating N-terminal deprotection and coupling reactions, successive amino acid derivatives are added to the polypeptide.
- isolated CD44v6 peptides are synthesized using a solution-phase peptide synthesis strategy.
- the nucleic acid molecules encode, and the host cells are capable of expressing, the isolated CD44v6 glycopeptide as well as fusion proteins that include the isolated CD44v6 glycoproteins.
- An isolated CD44v6 glycopeptide of the disclosure can be prepared by recombinant expression in a host cell.
- a host cell is transfected with a recombinant expression vector carrying DNA encoding the glycopeptide such that the glycopeptide is expressed in the host cell and, optionally, secreted into the medium in which the host cells are cultured, from which medium the glycoproteins can be recovered.
- expression of antibodies is performed in eukaryotic cells, e.g., mammalian host cells, of optimal secretion of a properly folded and immunologically active antibody.
- eukaryotic cells e.g., mammalian host cells
- a host cell is selected based on its ability to glycosylate threonine at amino acid position 5 of SEQ ID NO:165 and serine at amino acid position 12 of SEQ ID NO:165.
- An exemplary host cell is the COSMC KO HEK293 cell. 6.10.1.
- the CD44v6 peptides of the disclosure may be in the form of compositions comprising the CD44v6 peptide and one or more carriers, excipients, diluents and/or adjuvants.
- the compositions may be formulated for specific uses, such as for veterinary uses or pharmaceutical uses in humans.
- the form of the composition e.g., dry powder, liquid formulation, etc.
- the excipients, diluents and/or carriers used will depend upon the intended uses of the antibody, fusion protein and/or ADC and, for therapeutic uses, the mode of administration.
- the compositions may be supplied as part of a sterile, pharmaceutical composition that includes a pharmaceutically acceptable carrier and/or a pharmaceutically acceptable adjuvant.
- This composition can be in any suitable form (depending upon the desired method of administering it to a patient).
- the pharmaceutical composition can be administered to a patient by a variety of routes such as orally, transdermally, subcutaneously, intranasally, intravenously, intramuscularly, intratumorally, intrathecally, topically or locally.
- routes for administration in any given case will depend on the particular CD44v6 peptide, the subject, and the nature and severity of the disease and the physical condition of the subject.
- the pharmaceutical composition will be administered intravenously or subcutaneously.
- compositions can be conveniently presented in unit dosage forms containing a predetermined amount of an CD44v6 peptide of the disclosure per dose.
- the quantity of CD44v6 peptide included in a unit dose will depend on the disease being treated, as well as other factors as are well known in the art.
- Such unit dosages may be in the form of a lyophilized dry powder containing an amount of CD44v6 peptide suitable for a single administration, or in the form of a liquid.
- Dry powder unit dosage forms may be packaged in a kit with a syringe, a suitable quantity of diluent and/or other components useful for administration.
- Unit dosages in liquid form may be conveniently supplied in the form of a syringe pre-filled with a quantity of CD44v6 peptide suitable for a single administration.
- the pharmaceutical compositions may also be supplied in bulk form containing quantities of CD44V6 peptide suitable for multiple administrations.
- compositions may be prepared for storage as lyophilized formulations or aqueous solutions by mixing an CD44v6 peptide having the desired degree of purity with optional pharmaceutically-acceptable carriers, excipients, adjuvants or stabilizers typically employed in the art (all of which are referred to herein as "carriers"), i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives.
- carriers i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives.
- carriers i.e., buffering agents, stabilizing agents, preservatives, isotonifiers, non-ionic detergents, antioxidants, and other miscellaneous additives.
- the composition includes one or more pharmaceutically adjuvants in addition to the fusion protein and/or nanoparticle.
- Adjuvants include, for example, aluminum salts (e.g., amorphous aluminum hydroxyphosphate sulfate (AAHS), aluminum hydroxide, aluminum phosphate, potassium aluminum sulfate (Alum)), dsRNA analogues, lipid A analogues, flagellin, imidazoquinolines, CpG ODN, saponins (e.g., QS21), C-type lectin ligands (e.g., TDB), CD1d ligand ( ⁇ -galactosylceramide), MF59, AS01, AS02, AS03, AS04, AS15, AF03, GLA-SE, IC31, CAF01, and virosomes.
- AAHS amorphous aluminum hydroxyphosphate sulfate
- Al hydroxide aluminum hydroxide
- aluminum phosphate aluminum phosphate
- Buffering agents help to maintain the pH in the range which approximates physiological conditions. They may be present at a wide variety of concentrations, but will typically be present in concentrations ranging from about 2 mM to about 50 mM.
- Suitable buffering agents for use with the present disclosure include both organic and inorganic acids and salts thereof such as citrate buffers (e.g., monosodium citrate-disodium citrate mixture, citric acid-trisodium citrate mixture, citric acid-monosodium citrate mixture, etc.), succinate buffers (e.g., succinic acid- monosodium succinate mixture, succinic acid-sodium hydroxide mixture, succinic acid-disodium succinate mixture, etc.), tartrate buffers (e.g., tartaric acid-sodium tartrate mixture, tartaric acid- potassium tartrate mixture, tartaric acid-sodium hydroxide mixture, etc.), fumarate buffers (e.g., fumaric acid-monosodium fumarate mixture, fumaric acid-disodium fumarate mixture, monosodium fumarate-disodium fumarate mixture, etc.), gluconate buffers (e.g., gluconic
- Preservatives may be added to retard microbial growth, and can be added in amounts ranging from about 0.2%-1% (w/v).
- Suitable preservatives for use with the present disclosure include phenol, benzyl alcohol, meta-cresol, methyl paraben, propyl paraben, octadecyldimethylbenzyl ammonium chloride, benzalconium halides (e.g., chloride, bromide, and iodide), hexamethonium chloride, and alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, and 3-pentanol.
- Isotonicifiers sometimes known as “stabilizers” can be added to ensure isotonicity of liquid compositions of the present disclosure and include polyhydric sugar alcohols, for example trihydric or higher sugar alcohols, such as glycerin, erythritol, arabitol, xylitol, sorbitol and mannitol.
- Stabilizers refer to a broad category of excipients which can range in function from a bulking agent to an additive which solubilizes the therapeutic agent or helps to prevent denaturation or adherence to the container wall.
- Typical stabilizers can be polyhydric sugar alcohols (enumerated above); amino acids such as arginine, lysine, glycine, glutamine, asparagine, histidine, alanine, ornithine, L-leucine, 2-phenylalanine, glutamic acid, threonine, etc., organic sugars or sugar alcohols, such as lactose, trehalose, stachyose, mannitol, sorbitol, xylitol, ribitol, myoinisitol, galactitol, glycerol and the like, including cyclitols such as inositol; polyethylene glycol; amino acid polymers; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, ⁇ - monothioglycerol and sodium thio sulfate; low mo
- Stabilizers may be present in amounts ranging from 0.5 to 10 wt % per wt of CD44 peptide.
- Non-ionic surfactants or detergents also known as "wetting agents" may be added to help solubilize the glycoprotein as well as to protect the glycoprotein against agitation-induced aggregation, which also permits the formulation to be exposed to shear surface stressed without causing denaturation of the protein.
- Suitable non-ionic surfactants include polysorbates (20, 80, etc.), polyoxamers (184, 188 etc.), and pluronic polyols.
- Non-ionic surfactants may be present in a range of about 0.05 mg/mL to about 1.0 mg/mL, for example about 0.07 mg/mL to about 0.2 mg/mL.
- Additional miscellaneous excipients include bulking agents (e.g., starch), chelating agents (e.g., EDTA), antioxidants (e.g., ascorbic acid, methionine, vitamin E), and cosolvents.
- Exemplary CD44v6 peptide compositions of the disclosure are described in numbered embodiments 634-635 of Group I. 6.10.2.
- the CD44v6 peptides described herein can be used in the production of antibodies against a tumor-associated form of CD44v6.
- the CD44v6 peptide can be administered to an animal.
- the amount of peptide administered can be effective to cause the animal to produce antibodies against the peptide
- “animal” refers to multicellular eukaryotic organism from the biological kingdom Animalia.
- the animal is a mammal.
- the animal is a mouse or a rabbit. Resulting antibodies can then be collected from the animal.
- the CD44v6 peptide can be administered as purified peptide or as part of a composition provided herein.
- the CD44v6 peptides described herein can be used to elicit an immune response against a tumor-associated form of CD44v6.
- the CD44v6 peptide can be administered to an animal in an amount effective to cause the animal to mount an immune response (e.g., produce antibodies) against the peptide.
- Exemplary methods for using the CD44v6 peptides of the disclosure are described in numbered embodiments 636-639 of Group I. 7.
- EXAMPLES 7.1 Example 1: Identification and Characterization Of Anti-Glyco-CD44 Antibodies 7.1.1. Overview
- Glycans are essential membrane components and neoplastic transformation of human cells is virtually always associated with aberrant glycosylation of proteins and lipids.
- O-glycosylation There are several types of protein glycosylation, including N-glycosylation and many types of O- glycosylation, but one of the most diverse types is the mucin type GalNAc type O-glycosylation (hereafter called O-glycosylation). Cancer associated changes in O-glycans are particularly interesting and the most frequently observed aberrant glycophenotype is expression of the most immature truncated O-glycan structures designated Tn (GalNAc ⁇ 1-O-Ser/Thr), STn (NeuAc ⁇ 2-6GalNAc ⁇ 1-O-Ser/Thr), and T (Gal ⁇ 1-3GalNAc ⁇ 1-O-Ser/Thr) antigens.
- Truncated O-glycans are observed on almost all epithelial cancer cells and strongly correlated with poor prognosis. In addition, it is becoming increasingly clear that glycans also have pivotal roles in cancer development, with truncated O-glycans affecting differentiation, cell-cell and cell-matrix interactions, directly inducing oncogenic features in predisposed cells. [0393] The inventors have identified CD44 glycopeptide epitopes in human cancer cells and used the defined glyco-peptides to develop cancer specific anti-glyco-CD44 monoclonal antibodies. 7.1.2.
- CD44v6 glycopeptide [0394] The CD44v6 glycopeptide, GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165), with O- linked GalNAc on the serine and threonine residues shown with bold and underlined text, was synthesized using a standard FMOC peptide synthesis strategy. Pre-synthesized glycosylated amino acids were coupled to the elongating peptide at specific locations using solid or solution phase peptide chemistry in a stepwise fashion.
- the cells were spun down and the his-tagged recombinant CD44 protein was purified from the supernatant using a 50% Ni-NTA agarose slurry column (Invitrogen), eluting with 250mM imidazole. To increase purity, this purification step was repeated.
- the recombinant SC-CD44 protein was concentrated in PBS using Amicon Ultra centrifugal filters.
- mice Female Balb/c mice were immunized subcutaneously with the Tn-glycosylated CD44v6 glycopeptide conjugated to KLH (keyhole limpet hemocyanin) through a glutaraldehyde linker or with recombinant Tn-glycosylated CD44. The mice were immunized on days 0, 14, and 35 with 50 ⁇ g, 45 ⁇ g, and 45 ⁇ g of KLH-glycopeptide, respectively. The first immunization used Freund’s complete adjuvant. All subsequent immunizations used Freund’s incomplete adjuvant. On Day 45, tail bleeds were evaluated for polyclonal response.
- KLH keyhole limpet hemocyanin
- mice to be fused were boosted with 15 ug of KLH-glycopeptide in Freund’s incomplete adjuvant 3 to 5 days before hybridoma fusion.
- Splenocytes from mice were fused with SP2/0-Ag14 (ATCC, cat# CRL-1581) myeloma cells using the Electro Cell Manipulator (ECM2001) from BTX Harvard Apparatus.
- ECM2001 Electro Cell Manipulator
- Hybridomas were seeded in 96-well plates, cultured, scaled, and evaluated and selected for specificity towards CD44-Tn using ELISA, FLOW cytometry, and immunofluorescence to obtain monoclonal antibodies having specificity for CD44-Tn.
- New Zealand white rabbits were immunized subcutaneously with the Tn-glycosylated CD44v6 glycopeptide conjugated to KLH (keyhole limpet hemocyanin) through a glutaraldehyde linker or with recombinant Tn-glycosylated CD44.
- the mice were immunized on days 0, 28, and 47 with 200 ⁇ g, 100 ⁇ g, and 100 ⁇ g of KLH-glycopeptide, respectively.
- the first immunization used Freund’s complete adjuvant. All subsequent immunizations used Freund’s incomplete adjuvant.
- test bleeds were evaluated for polyclonal response.
- mice to be fused were boosted with 50 ug of KLH-glycopeptide in Freund’s incomplete adjuvant 3 to 5 days before hybridoma fusion.
- Splenocytes from rabbits were fused with SP2/0-Ag14 (ATCC, cat# CRL-1581) myeloma cells using the Electro Cell Manipulator (ECM2001) from BTX Harvard Apparatus.
- ECM2001 Electro Cell Manipulator
- Hybridomas were seeded in 96-well plates, cultured, scaled, and evaluated and selected for specificity towards CD44-Tn using ELISA, FLOW cytometry, and immunofluorescence to obtain monoclonal antibodies having specificity for CD44-Tn.
- 96-well Corning high bind microplates (Fisher) were coated overnight at 4 °C with various concentrations of protein, peptide, or glycopeptide in 0.2 M bicarbonate-carbonate buffer (pH 9.4). The plates were then blocked for 1 hour at room temperature with Phosphate- buffered saline (PBS) (pH 7.4) containing 2.5% BSA. Contents of the plate were discarded and purified antibody, or hybridoma supernatants, or blood serum for polyclonal responses, were added at various concentrations and incubated for two hours at room temperature.
- PBS Phosphate- buffered saline
- Adherent cells were dissociated with TrypLE select (Gibco) and washed from flask surface with cell culture media (RPMI w/ L-glutamine, 1% PenStrep, & 10% FBS). Cells were washed several times by centrifugation at 300*g for 5 min at 4 °C followed by resuspension in PBS with 1% BSA (PBS/1%BSA). Cells were resuspended between 5x10 5 cells/ml to 2x10 6 cell/ml and then distributed into a 96 well U-bottom plate.
- TrypLE select Gibco
- cell culture media RPMI w/ L-glutamine, 1% PenStrep, & 10% FBS. Cells were washed several times by centrifugation at 300*g for 5 min at 4 °C followed by resuspension in PBS with 1% BSA (PBS/1%BSA). Cells were resuspended between 5x10 5 cells/ml to 2
- Diluted commercial antibody 0.25-2 ug/ml
- hybridoma supernatants or blood serum for polyclonal responses
- cells were incubated for 30 min on ice with a 1:1600 dilution of AlexaFluor647 conjugated F(ab) 2 goat anti- mouse IgG Fc ⁇ (JacksonImmunoResearch).
- Cells were washed again with PBS/1% BSA and then fixed in 1% formaldehyde in PBS/1% BSA.
- Cells were analysed on either a 2 or 4 laser Attune NXT flow cytometer. Data was processed in FlowJo Software.
- TMAs Paraffin embedded tissue micro arrays
- tissue sections were de-paraffinized with xylene and ethanol, following antigen retrieval with citrate buffer (pH 6.0) and heated in microwave for 18 min.
- TMAs were stained with Ultra Vison Quanto Detection System HRP DAB. Briefly, TMAs were washed in TBS, incubated with mAb supernatant for 2 hours. After wash in TBS x 2, the TMAs was incubated with Primary Antibody Amplifier Quanto for 10 min. After wash in TBS, TMAs were incubated with HRP polymer quanto (10 min) followed by DAB chromogen. Slides were counterstained with hematoxylin, were dehydrated, and mounted. 7.1.3.
- Results 7.1.3.1 Glycopeptide specific antibodies to Tn-CD44 [0402] Glycopeptide reactive antibodies were generated using both the Tn-glycosylated CD44v6 glycopeptide and recombinant Tn-glycosylated CD44, but antibodies generated using CD44v6 glycopeptide, including 4C8, 2B2, 18G9, 1D12, and 10H4, proved superior in selectivity. Antibody 4C8 was selected for further characterization. 7.1.3.2 Characterization of mAb 4C8 binding specificity [0403] To characterize the binding specificity of 4C8, ELISA against non-glycosylated and Tn- glycosylated CD44 was performed.
- ELISA was also performed against Tn-glycosylated MUC1. It was found that in the context of ELISA, 4C8 only reacted with Tn-glycosylated CD44 and not with its non-glycosylated counterpart nor with MUC1 (FIG.1A). The affinity of 4C8 against the CD44v6 glycopeptide was determined to be 128nM when measured on a Biacore. Using an Octet system, the apparent affinity (with avidity factored in) of 4C8 for the CD44v6 glycopeptide was measured to be 7.9nM (FIG.1B).
- Table 7 summarizes dissociation constants (K D ) for 4C8 against different glycoforms of CD44v6 peptide, as well as unglycosylated CD44v6 and MUC1-Tn.
- Immunohistochemistry of tissue microarrays additionally showed strong staining of 22/89 and weak staining of 38/89 colon carcinomas, strong staining of 4/24 and weak staining of 12/24 pancreatic carcinomas, strong staining of 6/22 and weak staining of 8/22 lung carcinomas, strong staining of 6/26 and weak staining of 7/26 breast carcinomas, and weak staining of 2/24 prostate carcinomas, using 4C8 (FIG.2A-2B).
- This staining pattern correlated with staining for normal CD44 expression, showing that CD44 expression in these carcinomas predicted reactivity to 4C8.
- no reactivity when using 4C8 to stain healthy adjacent tissues was observed (FIG.2A).
- the VH and VL are attached together with one long linker (GGGGS) 3 (SEQ ID NO:184), while other constructs comprise two scFvs in tandem with one short linker GGGGS (SEQ ID NO:183) between the VH and VL and one long linker (GGGGS) 3 (SEQ ID NO:184) between each scFv (see FIG.5A-5H).
- the VH and VL were attached in various orientations to three different hinges (CD8a, IgG4-short, IgG4-long) followed by a second generation CAR-T (CD28 intracellular signal domain, and a CD3-zeta intracellular chain).
- the N-terminus of the scFvs was attached to a CD8a signal sequence.
- the 4C8 CAR- Ts were subcloned into the Virapower lentivirus vector pLENTI6.3-V5-DEST (Invitrogen).
- Nucleotide sequences encoding the CARs are shown in Table 8A.
- Amino acid sequences of the CARs are shown in Table 8B. Constructs 1, 2, 3, 4, 5, 6, 7, and 8 did not include the fluorescent reporter mCherry, while constructs 1.1, 2.1, 3.1, 4.1, 5.1, 6.1, 7.1, and 8.1 include a C-terminal T2A sequence followed by mCherry.
- Lentivirus was produced in HEK293T cells transfected with pGO-4C8, pVSVG, and pPAX2 using PEI overnight. The lentiviral supernatant was harvested after 24 hours. Healthy donor PBMCs were isolated using Lymphoprep density centrifugation followed by plastic adherence to get rid of adherent cells. The non-adherent PBMCs were cultured in RPMI-1640 Dutch modification with 10% FBS, 50 ⁇ M 2-mercaptoethanol, and 20ng/ml rIL-2 and were activated using human T-activator CD3/CD28 Dynabeads. Following activation, the T cells were transduced twice with viral supernatant for 24 hours.
- Transduced CAR T cells were expanded in culture medium at densities between 0.5x10 6 cells/mL and 1x10 6 cells/mL until used for studies.
- 7.2.1.3 Cytotoxicity assay [0410] HaCaT WT and COSMC KO cells were seeded at a density of 20,000 cells per well in 96-well plates and allowed to adhere overnight. Two days later, CAR T cells were added at effector-target cell ratios of 5:1 or 3:1 and were incubated for 6 hours. Cytotoxicity of target cells co-cultureed with CAR T cells was evaluated by lactate dehydrogenase cytoxicity assay (abcam) following manufacturer’s instructions.
- the 10H4 CAR-Ts were subcloned into the Virapower lentivirus vector pLENTI6.3-V5-DEST (Invitrogen).
- the nucleotide sequence encoding the 10H4 CAR is shown in Table 9A.
- the amino acid sequence of the 10H4 CAR is shown in Table 9B.
- the murine antibody 4C8 was humanized using standard CDR-grafting technology.
- Consensus sequences of all three of the A, B and C sequences for each germline were also created that reflect the most common amino acid residue at each position.
- Table 10 provides details of the differences in sequence across the VH genes between the humanized versions and their corresponding human germlines for 4C8.
- Table 11 provides details of the differences in sequence across the VL genes between the humanized versions and their corresponding human germlines for 4C8.
- Murine 4C8 was used as a control (FIG.8I).
- the affinities of humanized 4C8 candidates 1-8 against the CD44v6 glycopeptide and a MUC1 glycopeptide were measured using by bio-layer interferometry (BLI) using an Octet system.
- the peptides were immobilized onto the biosensor by biotin (ligand) and antibodies were in solution (analyte).
- Candidate 8 (4C8-HV7-4-1-A/LV7-46-A) was most similar to the original humanized antibody and was selected for further testing.
- Table 13 summarizes the dissociation constants (K ) for the noted humanized 4C8 candidates against the glycopeptides.
- Group I An anti-glyco-CD44 antibody or antigen-binding fragment that specifically binds to a CD44v6 peptide GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165) that has been glycosylated with GalNAc on threonine at amino acid position 5 of SEQ ID NO:165 and serine at amino acid position 12 of SEQ ID NO:165 (“the CD44v6 glycopeptide”). 2.
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable sequence of SEQ ID NO:207 for binding to the CD44v6 glycopeptide.
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- VH heavy chain variable
- VL light chain variable
- the anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 13, wherein the amino acid designated X 1 in SEQ ID NO:89, SEQ ID NO:97, and SEQ ID NO:125 is Y. 15.
- the anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 13, wherein the amino acid designated X 1 in SEQ ID NO:89, SEQ ID NO:97, and SEQ ID NO:125 is F. 16.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 19, wherein the amino acid designated X 4 in SEQ ID NO:89, SEQ ID NO:93, and SEQ ID NO:125 is A. 22.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 26, wherein the amino acid designated X 7 in SEQ ID NO:94 is Y. 30.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 29, wherein the amino acid designated X 8 in SEQ ID NO:90, SEQ ID NO:94, and SEQ ID NO:98 is Y. 31.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 31, wherein the amino acid designated X 9 in SEQ ID NO:90, SEQ ID NO:94, and SEQ ID NO:98 is P. 33.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 31, wherein the amino acid designated X 9 in SEQ ID NO:90, SEQ ID NO:94, and SEQ ID NO:98 is S. 34.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 33, wherein the amino acid designated X 10 in SEQ ID NO:90, SEQ ID NO:94, and SEQ ID NO:98 is R. 35.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 33, wherein the amino acid designated X10 in SEQ ID NO:90, SEQ ID NO:94, and SEQ ID NO:98 is G. 36.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 35, wherein the amino acid designated X 11 in SEQ ID NO:90, SEQ ID NO:94, and SEQ ID NO:98 is S. 37.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 35, wherein the amino acid designated X 11 in SEQ ID NO:90, SEQ ID NO:94, and SEQ ID NO:98 is G. 38.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 37, wherein the amino acid designated X 12 in SEQ ID NO:90, SEQ ID NO:94, and SEQ ID NO:98 is G. 39.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 37, wherein the amino acid designated X 12 in SEQ ID NO:90, SEQ ID NO:94, and SEQ ID NO:98 is S. 40.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 39, wherein the amino acid designated X 13 in SEQ ID NO:90, SEQ ID NO:94, and SEQ ID NO:98 is Y. 42.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 41, wherein the amino acid designated X 14 in SEQ ID NO:90 and SEQ ID NO:94 is T. 43.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 41, wherein the amino acid designated X 14 in SEQ ID NO:90 and SEQ ID NO:94 is I. 44.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 45, wherein the amino acid designated X 16 in SEQ ID NO:94 is A.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 50, wherein the amino acid designated X 18 in SEQ ID NO:94 is Y. 52.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 56, wherein the amino acid designated X 21 in SEQ ID NO:94 is G. 59.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 58, wherein the amino acid designated X22 in SEQ ID NO:91 and SEQ ID NO:95 is G. 60.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 58, wherein the amino acid designated X 22 in SEQ ID NO:91 and SEQ ID NO:95 is S. 61.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 58, wherein the amino acid designated X 22 in SEQ ID NO:91 and SEQ ID NO:95 is L. 62.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 61, wherein the amino acid designated X 23 in SEQ ID NO:91 and SEQ ID NO:95 is T. 63.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 61, wherein the amino acid designated X 23 in SEQ ID NO:91 and SEQ ID NO:95 is I. 64.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 63, wherein the amino acid designated X 24 in SEQ ID NO:91 and SEQ ID NO:95 is N. 65.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 65, wherein the amino acid designated X 25 in SEQ ID NO:95 is R. 68.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 72, wherein the amino acid designated X 28 in SEQ ID NO:95 is P. 74.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 74, wherein the amino acid designated X 29 in SEQ ID NO:92 is Q. 77.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 77, wherein the amino acid designated X 30 in SEQ ID NO:92 is Q. 80.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 79, wherein the amino acid designated X 31 in SEQ ID NO:92 is W. 83.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 82, wherein the amino acid designated X 32 in SEQ ID NO:92 is T. 86.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 85, wherein the amino acid designated X 33 in SEQ ID NO:92 is H. 89.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 88, wherein the amino acid designated X 34 in SEQ ID NO:92 is Q. 92.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 95, wherein the amino acid designated X 37 in SEQ ID NO:92 is T. 98.
- the anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 13, wherein the amino acid designated X 41 in SEQ ID NO:228, SEQ ID NO:236, and SEQ ID NO:246 is Y. 99.
- the anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 13, wherein the amino acid designated X 41 in SEQ ID NO:228, SEQ ID NO:232, and SEQ ID NO:246 is F. 100.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13, 98, and 99, wherein the amino acid designated X 42 in SEQ ID NO:228, SEQ ID NO:236, and SEQ ID NO:246 is F. 101.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 and 98 to 104, wherein the amino acid designated X 44 in SEQ ID NO:228, SEQ ID NO:232, SEQ ID NO:236, SEQ ID NO:246, and SEQ ID NO:256 is T. 107.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 and 98 to 106, wherein the amino acid designated X 45 in SEQ ID NO:228, SEQ ID NO:232, SEQ ID NO:236, SEQ ID NO:246, and SEQ ID NO:256 is F. 109.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 and 98 to 108, wherein the amino acid designated X 46 in SEQ ID NO:228, SEQ ID NO:232, and SEQ ID NO:246 is A. 111.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 and 98 to 108, wherein the amino acid designated X 46 in SEQ ID NO:228, SEQ ID NO:232, and SEQ ID NO:246 is H. 113.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 and 98 to 125, wherein the amino acid designated X 52 in SEQ ID NO:229, SEQ ID NO:233, and SEQ ID NO:237 is H. 129.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 and 98 to 128, wherein the amino acid designated X 53 in SEQ ID NO:229, SEQ ID NO:233, and SEQ ID NO:237 is G. 131.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 and 98 to 142, wherein the amino acid designated X 59 in SEQ ID NO:233 is A. 146.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 and 98 to 145, wherein the amino acid designated X 60 in SEQ ID NO:233 is T. 149.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 and 98 to 148, wherein the amino acid designated X 61 in SEQ ID NO:233 is W. 152.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 and 98 to 151, wherein the amino acid designated X 62 in SEQ ID NO:233 is A. 155.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 208, wherein CDR-H1 comprises the amino acid sequence of SEQ ID NO:97. 212.
- CDR-L1 comprises the amino acid sequence of SEQ ID NO:104. 236.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 234, wherein CDR-L1 comprises the amino acid sequence of SEQ ID NO:110. 237.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 234, wherein CDR-L1 comprises the amino acid sequence of SEQ ID NO:116. 238.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 234, wherein CDR-L1 comprises the amino acid sequence of SEQ ID NO:122, 239.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 232, wherein CDR-L1 comprises the amino acid sequence of SEQ ID NO:253. 245.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 244, wherein CDR-L2 comprises the amino acid sequence of SEQ ID NO:91. 246.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 244, wherein CDR-L2 comprises the amino acid sequence of SEQ ID NO:95. 247.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 13 to 244, wherein CDR-L2 comprises the amino acid sequence of SEQ ID NO:230. 248.
- An anti-glyco-CD44 antibody or antigen-binding fragment that competes with a reference antibody or antigen-binding fragment comprising (i) a heavy chain variable (VH) sequence of SEQ ID NO:1 and a light chain variable (VL) sequence of SEQ ID NO:2 (ii) a heavy chain variable (VH) sequence of SEQ ID NO:23 and a light chain variable (VL) sequence of SEQ ID NO:24, (iii) a heavy chain variable (VH) sequence of SEQ ID NO:45 and a light chain variable (VL) sequence of SEQ ID NO:46, (iv) a heavy chain variable (VH) sequence of SEQ ID NO:67 and a light chain variable (VL) sequence of SEQ ID NO:68, or (v) a heavy chain variable (VH) sequence of SEQ ID NO:206 and a light chain variable (VL) sequence of SEQ ID NO:207 for binding to a CD44v6 peptide GYRQTPKEDSHSTTG
- the anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 297 wherein the anti-glyco-CD44 antibody or antigen-binding fragment competes with a reference antibody or antigen-binding fragment comprising a VH sequence of SEQ ID NO:23 and a VL sequence of SEQ ID NO:23. 300.
- the anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 297 wherein the anti-glyco-CD44 antibody or antigen-binding fragment competes with a reference antibody or antigen-binding fragment comprising a VH sequence of SEQ ID NO:67 and a VL sequence of SEQ ID NO:68. 302.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any one of embodiments 1 to 303 which binds to, but does not specifically bind to, a CD44v6 peptide GYRQTPKEDSHSTTGTAAA SEQ (ID NO:165) that has been glycosylated with STn on threonine at amino acid position 5 of SEQ ID NO:165 and serine at amino acid position 12 of SEQ ID NO:165. 306.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 1 nM to 200 nM as measured by surface plasmon resonance or bio-layer interferometry. 307.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 1 nM to 150 nM as measured by surface plasmon resonance or bio-layer interferometry. 308.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 1 nM to 100 nM as measured by surface plasmon resonance or bio-layer interferometry.
- K D binding affinity
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 1 nM to 50 nM as measured by surface plasmon resonance or bio-layer interferometry.
- K D binding affinity
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 1 nM to 25 nM as measured by surface plasmon resonance or bio-layer interferometry. 311.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 1 nM to 15 nM as measured by surface plasmon resonance or bio-layer interferometry 312.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 1 nM to 10 nM as measured by surface plasmon resonance or bio-layer interferometry. 313.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 5 nM to 200 nM as measured by surface plasmon resonance or bio-layer interferometry. 314.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 5 nM to 100 nM as measured by surface plasmon resonance or bio-layer interferometry. 315.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 5 nM to 50 nM as measured by surface plasmon resonance or bio-layer interferometry. 316.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 5 nM to 25 nM as measured by surface plasmon resonance or bio-layer interferometry. 317.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 5 nM to 10 nM as measured by surface plasmon resonance or bio-layer interferometry. 318.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 10 nM to 200 nM as measured by surface plasmon resonance or bio-layer interferometry. 319.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 10 nM to 100 nM as measured by surface plasmon resonance or bio-layer interferometry.
- K D binding affinity
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 10 nM to 150 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 10 nM to 100 nM as measured by surface plasmon resonance or bio-layer interferometry. 322.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 10 nM to 50 nM as measured by surface plasmon resonance or bio-layer interferometry. 323.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 10 nM to 25 nM as measured by surface plasmon resonance or bio-layer interferometry. 324.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 50 nM to 200 nM as measured by surface plasmon resonance or bio-layer interferometry. 325.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 50 nM to 150 nM as measured by surface plasmon resonance or bio-layer interferometry. 326.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 50 nM to 100 nM as measured by surface plasmon resonance or bio-layer interferometry. 327.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 100 nM to 200 nM as measured by surface plasmon resonance or bio-layer interferometry. 328.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 305 which binds to the CD44v6 glycopeptide with a binding affinity (K D ) of 100 nM to 150 nM as measured by surface plasmon resonance or bio-layer interferometry. 329.
- the anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 329 in which the measurement by surface plasmon resonance is carried out at a saturating concentration of the CD44v6 glycopeptide as an analyte, wherein the anti-glyco-CD44 antibody or antigen-binding fragment is an immobilized ligand.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 3 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 335.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 5 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 336.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 10 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 337.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 20 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 338.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 50 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 339.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 100 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide.
- anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which does not specifically bind to the MUC1 tandem repeat (VTSAPDTRPAPGSTAPPAHG) 3 (SEQ ID NO:205) that has been glycosylated in vitro using purified recombinant human glycosyltransferases GalNAc-T1, GalNAc-T2, and GalNAc-T4 ( “the first MUC1 glycopeptide”).
- MUC1 tandem repeat SEQ ID NO:205
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 3 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 342.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 5 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 343.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 10 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 344.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 20 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 345.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 50 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 346.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 100 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 347.
- anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which does not specifically bind to the MUC1 TAPPAHGVTSAPDTRPAPGSTAPPAHGVT (SEQ ID NO:262) that has been glycosylated in vitro with GalNAc on the serine and threonine residues shown with bold and underlined text ( “the second MUC1 glycopeptide”).
- SEQ ID NO:262 MUC1 TAPPAHGVTSAPDTRPAPGSTAPPAHGVT
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 3 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the second MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the second MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 349.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 5 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the second MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the second MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 350.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 10 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the second MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the second MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 351.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 20 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the second MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the second MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 352.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 50 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the second MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the second MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 353.
- the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 333 which has a binding affinity to the CD44v6 glycopeptide which is at least 100 times the binding affinity of the anti-glyco-CD44 antibody or antigen-binding fragment to the second MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the second MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 354.
- 356. The anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 355, wherein the antigen-binding fragment is in the form of a single-chain variable fragment (scFv).
- scFv single-chain variable fragment
- 360. The anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 332, which is in the form of a multispecific antibody. 361.
- the anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 362, wherein the bispecific antibody is a central-scFv format bispecific antibody.
- the anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 362, wherein the bispecific antibody is a one-armed central-scFv format bispecific antibody. 368.
- the bispecific antibody is a Fab-arm exchange antibody.
- the anti-glyco-CD44 antibody or antigen-binding fragment of embodiment 369, wherein the bispecific antibody is a dual-affinity retargeting molecule (DART). 376.
- the bispecific antibody is a bispecific T-cell engager (BiTE).
- a fusion protein comprising the amino acid sequence of the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 384 operably linked to at least a second amino acid sequence.
- the fusion protein of embodiment 387 wherein the fusion peptide is a CD28- CD3-zeta, a 4-1BB (CD137)-CD3-zeta fusion peptide, a CD2-CD3-zeta fusion peptide, a CD28-CD2-CD3-zeta fusion peptide, or a 4-1BB (CD137)-CD2-CD3-zeta fusion peptide.
- the fusion protein of embodiment 389, wherein the modulator of T cell activation is IL-15 or IL-15R ⁇ . 391.
- the fusion protein of embodiment 385, wherein the second amino acid sequence is that of a MIC protein domain. 392.
- the fusion protein of embodiment 391, wherein the MIC protein domain is an ⁇ 1- ⁇ 2 domain.
- the fusion protein of embodiment 392, wherein the ⁇ 1- ⁇ 2 domain is a MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, or OMCP ⁇ 1- ⁇ 2 domain.
- 394 The fusion protein of any one of embodiments 391 to 393, wherein the MIC protein domain is an engineered MIC protein domain. 395.
- neuraminidase comprises an amino acid sequence having at least 95% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 97% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 98% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 99% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises the amino acid sequence GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- the fusion protein of embodiment 402, wherein the signal sequence is an IFN signal sequence. 407.
- the fusion protein of embodiment 407, wherein the self-cleaving peptide sequence is a 2A peptide. 409.
- the fusion protein of any one of embodiments 395 to 409, wherein the fusion protein comprises an amino acid sequence at least 95%, at least 97%, at least 98%, at least 99%, or 100% identical to the fusion protein designated as 4C8-CART-T2A-HIS-GranzymeK- signal -Neuraminidase. 412.
- a chimeric antigen receptor (CAR) comprising one or more antigen-binding fragments according to any one of embodiments 355 to 359. 416.
- the CAR of embodiment 415 which comprises one or more scFvs according to any one of embodiments 356 to 359. 417.
- the CAR of embodiment 416 which comprises one scFv according to any one of embodiments 356 to 359. 418.
- the CAR of embodiment 417 which comprises two scFvs according to any one of embodiments 356 to 359. 419.
- the CAR of embodiment 418 wherein the two scFvs have the same amino acid sequence.
- 420 The CAR of embodiment 418 or 419, wherein the two scFvs are covalently bound by a linker sequence, which is optionally 4-15 amino acids.
- 421 The CAR of any one of embodiments 415 to 420, comprising in amino- to carboxy-terminal order: (i) the one or more antigen-binding fragments, (ii) a transmembrane domain, and (iii) an intracellular signaling domain. 422.
- the CAR of embodiment 424 wherein the co-stimulatory signaling region comprises the cytoplasmic domain of CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, DAP10, GITR, or a combination thereof. 426.
- the CAR of embodiment 425, wherein the co-stimulatory signaling domain comprises the cytoplasmic domain of CD2. 427.
- the CAR of embodiment 426, wherein the cytoplasmic domain of CD2 comprises the amino acid sequence TKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSH RPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN (SEQ ID NO:289). 428.
- the CAR of any one of embodiments 425 to 427, wherein the co-stimulatory signaling domain comprises the cytoplasmic domain of CD28. 429.
- the CAR of embodiment 428, wherein the cytoplasmic domain of CD28 comprises the amino acid sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO:179).
- 430. The CAR of any one of embodiments 421 to 429, wherein the intracellular signaling domain comprises a T cell signaling domain. 431.
- the CAR of embodiment 430, wherein the T cell signaling domain is C-terminal to the co-stimulatory signaling region. 432.
- the CAR of embodiment 430 or 431, wherein the T cell signaling domain comprises a CD3-zeta signaling domain. 433.
- the CAR of embodiment 432, wherein the CD3-zeta signaling domain comprises the amino acid sequence RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYN ELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO:180).
- 434 The CAR of any one of embodiments 421 to 433, which further comprises a signal peptide N-terminal to the one or more antibody fragments or one or more scFvs. 435.
- the CAR of embodiment 433, wherein the signal peptide is a human CD8 signal peptide. 436.
- the CAR of embodiment 435, wherein the human CD8 signal peptide comprises the amino acid sequence MALPVTALLLPLALLLHAARP (SEQ ID NO:175). 437.
- the CAR of embodiment 437, wherein the hinge comprises a human CD8a hinge. 439.
- the CAR of embodiment 438, wherein the human CD8a hinge comprises the amino acid sequence TTTPAPRPPTPAPTIASPLSLRPEACRPAAGGAVHTRGLDFAC (SEQ ID NO:203). 440.
- the CAR of embodiment 438, wherein the human CD8a hinge comprises the amino acid sequence TTTPAPRPPTPAPTIASPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO:176). 441.
- the CAR of embodiment 437, wherein the hinge comprises a human IgG4- short hinge comprising the amino acid sequence ESKYGPPCPSCP (SEQ ID NO:177). 442.
- a chimeric antigen receptor (CAR), whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:157. 444.
- a chimeric antigen receptor (CAR), whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:158. 445.
- a chimeric antigen receptor (CAR), whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:159. 446.
- a chimeric antigen receptor (CAR), whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:160. 447.
- a chimeric antigen receptor (CAR), whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:161. 448.
- a chimeric antigen receptor (CAR), whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:162. 449.
- a chimeric antigen receptor (CAR), whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:163.
- 450. A chimeric antigen receptor (CAR), whose amino acid sequence comprises the amino acid sequence of SEQ ID NO:164. 451.
- An antibody-drug conjugate comprising the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 384 or the fusion protein of any one of embodiments 385 to 394 conjugated to a cytotoxic agent. 453.
- the antibody-drug conjugate of embodiment 452 wherein the cytotoxic agent is an auristatin, a DNA minor groove binding agent, an alkylating agent, an enediyne, a lexitropsin, a duocarmycin, a taxane, a dolastatin, a maytansinoid, a vinca alkaloid, or an amanitin toxin. 454.
- the antibody-drug conjugate of embodiment 453, wherein the anti-glyco-CD44 antibody or antigen-binding fragment or bispecific antibody is conjugated to the cytotoxic agent via a linker. 455.
- a T cell receptor (TCR) fusion protein comprising one or more antigen-binding fragments according to any one of embodiments 355 to 359 and one or more domains of a TCR complex subunit. 463.
- the TCR fusion protein of embodiment 462, wherein the one or more antigen- binding fragments and the one or more domains of the TCR complex subunit are connected by a peptide linker. 464.
- the TCR fusion protein of embodiment 463, wherein the peptide linker comprises or consists of a glycine-serine linker. 465.
- the TCR fusion protein of embodiment 463 or 464, wherein the peptide linker comprises or consists of (G 4 S) n , wherein n 1 to 4 (SEQ ID NO:316). 466.
- the TCR fusion protein any one of embodiments 462 to 465, wherein the antigen-binding fragment is in the form of a single-chain variable fragment (scFv). 467.
- the TCR fusion protein of embodiment 466 which comprises one or more scFvs according to any one of embodiments 356 to 359. 468.
- the TCR fusion protein of embodiment 467 which comprises one scFv according to any one of embodiments 356 to 359. 469.
- the TCR fusion protein of embodiment 467 which comprises two scFv according to any one of embodiments 356 to 359. 470.
- the TCR fusion protein of embodiment 469 wherein the two scFvs have the same amino acid sequence. 471.
- the TCR fusion protein of embodiment 474 wherein the extracellular domain of the TCR complex subunit comprises a constant region of the TCR complex subunit, optionally further comprising a variable region of the TCR complex subunit.
- 476 The TCR fusion protein of embodiment 474, wherein the extracellular variable region of the TCR complex subunit comprises a variable region of the TCR complex subunit, optionally comprising a constant region of the TCR complex subunit. 477.
- the TCR fusion protein of any one of embodiments 462 to 476, wherein the TCR complex subunit is TCR ⁇ . 478.
- the TCR fusion protein of any one of embodiments 462 to 476, wherein the TCR complex subunit is TCR ⁇ . 479.
- the TCR fusion protein of any one of embodiments 462 to 476, wherein the TCR complex subunit is CD3 ⁇ . 483.
- the TCR fusion protein of any one of embodiments 462 to 476, wherein the TCR complex subunit is CD3 ⁇ . 484.
- AbTCR antibody-T-cell receptor
- TCR T cell receptor
- a T cell receptor (TCR) complex comprising one or more TCR fusion proteins of any one of embodiments 462 to 486. 488.
- the TCR complex of embodiment 487, wherein the TCR complex is a TCR ⁇ / ⁇ TCR complex. 489.
- a synthetic T cell receptor (TCR) and antigen receptor (STAR) comprising: (a) an anti-glyco-CD44 variable heavy chain (VH); (b) a first TCR constant region domain; (c) a cleavable peptide linker; (d) an anti-glyco-CD44 variable light chain (VL); and (e) a second TCR constant region domain, optionally wherein the VH and VL are a VH and a VL of an anti-glyco CD44 antibody or binding fragment according to any one of embodiments 1 to 461. 492.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLQQPGSELVRPGASVKLSCKASGYTFTSYWMHWVKQRPGQGLEWIGNIYPRSGTTNY DGYFKSKATLTVDTSSSTAYMQLSSLTSEDSAVYFCTRSGYDYPFVYWGQGTLVTVSA (SEQ ID NO:1). 493.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPERRLEWVAEISSGGSYTYYP DTVTGRFTISRDNAKNTLYLEMSSLRSEDTAMYYCARTVGEDWYFDVWGAGTTVTVSS (SEQ ID NO:23). 494.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGMHWVRQAPEKGLEWVAYISSGSSTIYYA DTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARGSYRAMDYWGQGTSVTVSS (SEQ ID NO:45). 495.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of DVQLVESGGGLVQPGGSRKLSCAASGFTFSSFGIHWVRQAPEKGLEWVAYISSGSSTIYYAD TVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYYCARGSKVVAKSRGYWYFDVWGAGTTVTV SS (SEQ ID NO:67). 496.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QSLEESGGRLVTPGTPLTLTCTASGFTINTYHMGWFRQAPGKGLQYIGIVSHDVGTYYATWA KGRFTISKTSSTTVDLRMPSPTTEDTATYICARGPGYWTFNLWGQGTLVTVSS (SEQ ID NO:206). 497.
- the anti-glyco-CD44 variable heavy chain comprises: (a) a complementarity determining region (CDR) H1 comprising the amino acid sequence of a CDR-H1 of any one of Tables 1F-1K, 2F, 2G, 3F, or 3G (e.g., GX 1 TFX 2 SX 3 X 4 (SEQ ID NO:89), SX 3 X 4 X 5 X 6 (SEQ ID NO:93), GX 1 TFX 2 SX 3 (SEQ ID NO:97), GX 1 TFX 2 SX 3 X 4 X 5 X 6 (SEQ ID NO:125), SX 3 (SEQ ID NO:153), GX 41 TX 42 X 43 X 44 X 45 X 46 (SEQ ID NO:228), X 44 X 45 X 46 X 47 X 48 (SEQ ID NO:232), GX 41 TX 42 X 43 X 44 X 45 (SEQ ID NO:236), GX 41 TX 42 X 43
- variable light chain comprises an amino acid of QAVVTQESALTTSPGETVTLTCRTSTGAVSIRNYANWVQEKPDHLFTGLIGGTNNRAPGVPA RFSGSLIGDKAALTITGAQPEDEAIYFCALLYSNYWVFGGGTKLTVL (SEQ ID NO:2). 499.
- anti-glyco-CD44 variable light chain comprises an amino acid of DIQMTQTTSSLSASLGDRVTISCRASQDISHYLNWYQQKPDGAVKLLIYSTSRLHSGVPSRFS GSGSGTDYSLTISNLEQEDIATYFCQQGYTLPFTFGSGTKLEIK (SEQ ID NO:24).
- anti-glyco-CD44 variable light chain comprises an amino acid of QIVLTQSPALMSASPGEKVTMTCSASSSVNYMFWYQQKPRSSPKPWIYLTSNLASGVPARFS GSGSGTSYSLTISSMEAEDAATYYCQLWSSNPFTFGSGTKLEIK (SEQ ID NO:46).
- anti-glyco-CD44 variable light chain comprises an amino acid of DVVVTQTPLFLPVSFGDQVSISCRSSQSLANNYGITYLSWYLHRPGQSPQLLIYGISNRFSGV PDRFSGSGSGTDFTLKISTIKPEDLGMYYCLQGTHQPWTFGGGTKLEIK (SEQ ID NO:68). 502.
- variable light chain comprises an amino acid of AQVLTQTPASVSAAVGGTVTINCQASQSVYNNNQLSWYQQKPGQPLKQLIYKASTLASGVPS RFKGSGSGSQFTLTISDLECDDAATYFCAGGYKGDIHPFGGGTEVVVK (SEQ ID NO:207).
- the anti-glyco-CD44 variable light chain comprises: (a) a CDR-L1 comprising the amino acid sequence of a CDR-L1 of any one of any one of Tables 1A-1E or 3A-3E (e.g., TGAVSIRNY (SEQ ID NO:6), RTSTGAVSIRNYAN (SEQ ID NO:12), QDISHY (SEQ ID NO:28), RASQDISHYLN (SEQ ID NO:34), SSVNY (SEQ ID NO:50), SASSSVNYMF (SEQ ID NO:56), QSLANNYGITY (SEQ ID NO:72), RSSQSLANNYGITYLS (SEQ ID NO:78), QSVYNNNQ (SEQ ID NO:211), and QASQSVYNNNQLS (SEQ ID NO:217); (b) a CDR-L2 comprising the amino acid sequence of a CDR-L2 of any one of Tables 1F-1K
- the STAR of embodiment 506 wherein the TCR ⁇ constant region domain comprises a substitution at amino acid position 48 of wildtype TCR ⁇ constant region and the TCR ⁇ constant region domain comprises a substitution at amino acid position 57 of wildtype TCR ⁇ constant region. 508.
- the STAR of any one of embodiments 491 to 503 wherein the first TCR constant region domain is a TCR ⁇ constant region domain and the second TCR constant region domain is a TCR ⁇ constant region domain. 510.
- the STAR of any one of embodiments 491 to 512, wherein the peptide linker comprises the sequence ATNFSLLKQAGDVEENPGP (SEQ ID NO:303). 514.
- the STAR of any one of embodiments 491 to 513 having the order, from N- to C-terminus, of (i) the anti-glyco-CD44 variable heavy chain, (ii) the first TCR constant region domain, (iii) the cleavable peptide linker, (iv) the anti-glyco-CD44 variable light chain, and (v) the second TCR constant region domain. 515.
- the STAR of any one of embodiments 491 to 513 having the order, from N- to C-terminus, of (i) the anti-glyco-CD44 variable heavy chain, (ii) the second TCR constant region domain, (iii) the cleavable peptide linker, (iv) the anti-glyco-CD44 variable light chain, and (v) the first TCR constant region domain. 516.
- the STAR of any one of embodiments 491 to 513 having the order, from N- to C-terminus, of (i) the anti-glyco-CD44 variable light chain, (ii) the first TCR constant region domain, (iii) the cleavable peptide linker, (iv) the anti-glyco-CD44 variable heavy chain, and (v) the second TCR constant region domain. 517.
- the STAR of any one of embodiments 491 to 513 having the order, from N- to C-terminus, of (i) the anti-glyco-CD44 variable light chain, (ii) the second TCR constant region domain, (iii) the cleavable peptide linker, (iv) the anti-glyco-CD44 variable heavy chain, and (v) the first TCR constant region domain. 518.
- a nucleic acid comprising a coding region for an anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 384, the fusion protein of any one of embodiments 385 to 414, the CAR of any one of embodiments 415 to 451, the TCR fusion protein of any one of embodiments 462 to 486, the TCR complex of any one of claims 487 to 490, or the STAR of any one of embodiments 491 to 517. 519.
- a vector comprising the nucleic acid of embodiment 518 or embodiment 519. 521.
- the vector of embodiment 520 which is a viral vector. 522.
- the vector of embodiment 521 wherein the viral vector is a lentiviral vector. 523.
- the host cell of embodiment 523 which is engineered to express a neuraminidase (EC 3.2.1.18 of EC 3.2.1.129).
- the host cell of embodiment 524, wherein the neuraminidase is derived from Micromonospora viridifaciens. 526.
- neuraminidase comprises an amino acid sequence having at least 95% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 95% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 97% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 98% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises the amino acid sequence GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- the host cell of any one of embodiments 523 to 534 which is a human NK cell engineered to express the CAR of any one of embodiments 395 to 451. 536.
- the host cell of any one of embodiments 523 to 534 which is a human T-cell engineered to express the TCR fusion protein of any one of embodiments 462 to 486. 537.
- the host cell of any one of embodiments 523 to 534 which is a human T-cell engineered to express the TCR complex of any one of claims 487 to 489. 538.
- a host cell comprising the vector of any one of embodiments 520 to 522. 540.
- a pharmaceutical composition comprising (a) the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 384, the fusion protein of any one of embodiments 385 to 414, the CAR of any one of embodiments 415 to 451, the antibody-drug conjugate of any one of embodiments 452 to 461, the TCR fusion protein of any one of embodiments 462 to 486, the TCR complex of any one of claims 487 to 490, the STAR of any one of embodiments 491 to 517, the nucleic acid of embodiment 518 or embodiment 519, the vector of any one of embodiments 520 to 522, or the host cell of any one of embodiments 523 to 540, and (b) a physiologically suitable buffer, adjuvant, diluent, or combination thereof.
- a method of treating cancer comprising administering to a subject in need thereof an effective amount of the anti-glyco-CD44 antibody or antigen-binding fragment of any of embodiments 1 to 384, the fusion protein of any one of embodiments 385 to 414, the CAR of any one of embodiments 415 to 451, the antibody-drug conjugate of any one of embodiments 452 to 461, the TCR fusion protein of any one of embodiments 462 to 486, the TCR complex of any one of claims 487 to 490, the STAR of any one of embodiments 491 to 517, the nucleic acid of embodiment 518 or embodiment 519, the vector of any one of embodiments 520 to 522, the host cell of any one of embodiments 523 to 542, or the pharmaceutical composition of embodiment 543.
- the method of embodiment 549, wherein the urogenital cancer is prostate cancer. 551.
- the method of embodiment 549, wherein the urogenital cancer is kidney cancer. 552.
- the method of embodiment 545, wherein the subject is suffering from pancreatic cancer. 553.
- the method of embodiment 545, wherein the subject is suffering from colorectal cancer. 554.
- the method of embodiment 545, wherein the subject is suffering from ovarian cancer.
- the method of embodiment 545, wherein the subject is suffering from gastric cancer.
- the method of embodiment 545, wherein the subject is suffering from head and neck cancer. 557.
- the method of embodiment 556, wherein the head and neck cancer is head and neck squamous cell carcinoma (HNSCC). 558.
- HNSCC head and neck squamous cell carcinoma
- the method of embodiment 545, wherein the subject is suffering from skin cancer. 559.
- the method of embodiment 545, wherein the subject is suffering from malignant melanoma. 560.
- the method of embodiment 545, wherein the subject is suffering from liver cancer. 561.
- the method of embodiment 545, wherein the subject is suffering from a glioma. 562.
- the method of embodiment 545, wherein the subject is suffering from thyroid cancer. 563.
- the method of embodiment 545, wherein the subject is suffering from cervical cancer. 564.
- the method of embodiment 545, wherein the subject is suffering from endometrial cancer. 565.
- a method of detecting cancer in a biological sample comprising contacting a sample with an anti-glyco-CD44 antibody or antigen-binding fragment according to any one of embodiments 1 to 384 and detecting binding of the anti-glyco-CD44 antibody or antigen- binding fragment.
- the method of embodiment 565 further comprising quantitating the binding of the anti-glyco-CD44 antibody or antigen-binding fragment.
- 567 The method of embodiment 565 or embodiment 566, wherein the binding is compared to a normal tissue control as a negative/baseline control and/or to a cancerous tissue control as a positive control. 568.
- any one of embodiments 565 to 567 wherein the cancer is breast cancer, lung cancer, a urogenital cancer, pancreatic cancer, colorectal cancer, ovarian cancer, gastric cancer, head and neck cancer, skin cancer, malignant melanoma, liver cancer, a glioma, thyroid cancer, cervical cancer, or endometrial cancer.
- the method of embodiment 568, wherein the cancer is breast cancer.
- 570. The method of embodiment 568, wherein the cancer is lung cancer. 571.
- the method of embodiment 570, wherein the lung cancer is non-small cell lung cancer.
- the method of embodiment 568, wherein the cancer is a urogenital cancer. 573.
- the method of embodiment 572, wherein the cancer is prostate cancer. 574.
- the method of embodiment 572, wherein the cancer is kidney cancer. 575.
- the method of embodiment 568, wherein the cancer is pancreatic cancer. 576.
- the method of embodiment 568, wherein the cancer is colorectal cancer. 577.
- the method of embodiment 568, wherein the cancer is ovarian cancer. 578.
- the method of embodiment 568, wherein the cancer is gastric cancer. 579.
- the method of embodiment 568, wherein the cancer is head and neck cancer. 580.
- the method of embodiment 579, wherein the head and neck cancer is HNSCC. 581.
- the method of embodiment 568, wherein the cancer is skin cancer. 582.
- the method of embodiment 568, wherein the cancer is malignant melanoma. 583.
- the method of embodiment 568, wherein the cancer is liver cancer. 584.
- the method of embodiment 568, wherein the cancer is a glioma. 585.
- the method of embodiment 568, wherein the cancer is thyroid cancer. 586.
- the method of embodiment 568, wherein the cancer is cervical cancer. 587.
- the method of embodiment 568, wherein the cancer is endometrial cancer. 588.
- the method of any one of embodiments 544 to 587, when depending from any one of embodiments 391 to 394 which further comprises administering to the subject genetically modified T-cells engineered to express a CAR comprising a NKG2D receptor capable of specifically binding the MIC protein domain.
- the use according to embodiment 608, wherein the cancer is breast cancer. 610.
- the use according to embodiment 608, wherein the cancer is lung cancer. 611.
- the use according to embodiment 610, wherein the cancer is non-small cell lung cancer. 612.
- the use according to embodiment 608, wherein the cancer is a urogenital cancer. 613.
- the use according to embodiment 612, wherein the cancer is prostate cancer. 614.
- the use according to embodiment 612, wherein the cancer is kidney cancer. 615.
- the use according to embodiment 608, wherein the cancer is pancreatic cancer. 616.
- the use according to embodiment 608, wherein the cancer is colorectal cancer. 617.
- the use according to embodiment 608, wherein the cancer is ovarian cancer. 618.
- the use according to embodiment 608, wherein the cancer is gastric cancer. 619.
- the use according to embodiment 608, wherein the cancer is head and neck cancer. 620.
- the use according to embodiment 619, wherein the head and neck cancer is HNSCC. 621.
- the use according to embodiment 608, wherein the cancer is skin cancer. 622.
- the use according to embodiment 608, wherein the cancer is malignant melanoma. 623.
- the use according to embodiment 608, wherein the cancer is liver cancer. 624.
- the use according to embodiment 608, wherein the cancer is a glioma. 625.
- the use according to embodiment 608, wherein the cancer is thyroid cancer. 626.
- the use according to embodiment 608, wherein the cancer is cervical cancer. 627.
- a peptide of 12-30 amino acids in length comprising amino acids 4-13 of SEQ ID NO:165. 629.
- the peptide of embodiment 628 which is 15-25 amino acids in length 630.
- the peptide of embodiment 628 which is 18-20 amino acids in length 631.
- the peptide of embodiment 628 which consists of SEQ ID NO:165. 632.
- the peptide of any one of embodiments 628 to 631 which is O-glycosylated at the threonine corresponding to position 5 of SEQ ID NO:165 and/or the serine corresponding to position 12 of SEQ ID NO:165. 633.
- the peptide of embodiment 632, wherein the O-glycosylation comprises or consists of GalNAc. 634.
- a composition comprising the peptide of embodiment 632 or embodiment 633 and an adjuvant. 635.
- the composition of embodiment 634, wherein the adjuvant comprises a Freund’s adjuvant and/or an aluminum salt (e.g., aluminum hydroxide).
- 636. A method of generating antibodies against a tumor-associated form of CD44v6, comprising administering to an animal the peptide of embodiment 632 or embodiment 633 or the composition of embodiment 634 or embodiment 635. 637.
- the method of embodiment 636 further comprises collecting antibodies from the animal. 638.
- a method of eliciting an immune response against a tumor-associated form of CD44v6, comprising administering to a subject the peptide of embodiment 538 or embodiment 539 or the composition of embodiment 634 or embodiment 635. 639.
- An antibody or antigen-binding fragment thereof comprising: (a) a heavy chain variable region (VH) comprising any combination of CDR- H1, CDR-H2 and CDR-H3 set forth in Tables 4A-4D, optionally wherein: (i) CDR-H1 has the amino acid sequence of: HV1-18 Consensus CDR-H1 or HV1-69 Consensus CDR-H1; (ii) CDR-H2 has the amino acid sequence of: HV1-18 Consensus CDR-H2 or HV7-4-1 Consensus CDR-H2; and (iii) CDR-H3 has the amino acid sequence of: HV1-18 Consensus CDR-H3, HV1-46 Consensus CDR-H3, or HV7-4-1 Consensus CDR-H3; and (b) a light chain variable region (VL) comprising any combination of CDR-L1, CDR-L2 and CDR-L3 set forth in Tables 4E-4G
- the antibody or antigen-binding fragment of embodiment 1 which binds to a CD44v6 glycopeptide GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165) that has been glycosylated with GalNAc on threonine at amino acid position 5 of SEQ ID NO:165 and serine at amino acid position 12 of SEQ ID NO:165.
- CDR-H1 comprises the amino acid sequence of HV1-18 Consensus CDR-H1.
- CDR-H1 comprises the amino acid sequence of HV1-69 Consensus CDR-H1.
- CDR-H2 comprises the amino acid sequence of HV1-18 Consensus CDR-H2.
- CDR-H2 comprises the amino acid sequence of HV7-4-1 Consensus CDR-H2.
- CDR-H3 comprises the amino acid sequence of HV1-18 Consensus CDR-H3.
- CDR-H3 comprises the amino acid sequence of HV1-46 Consensus CDR-H3.
- CDR-H3 comprises the amino acid sequence of HV7-4-1 Consensus CDR-H3.
- CDR-L1 comprises the amino acid sequence of LV7-43 Consensus CDR-L1. 12.
- CDR-L1 comprises the amino acid sequence of LV7-43C CDR-L1.
- CDR-L1 comprises the amino acid sequence of LV7-46C CDR-L1.
- CDR-L1 comprises the amino acid sequence of LV8-61C CDR-L1.
- An antibody or antigen-binding fragment which is optionally an antibody or antigen-binding fragment according to any one of embodiments 1 to 14, which is humanized and comprises: (a) a VH having a first sequence identity at least 95% identical to: (i) the VH designated as HV1-18A, HV1-18B, HV1-18C or HV1-18 Consensus; (ii) the VH designated as HV1-46A, HV1-46B, HV1-46C or HV1-46 Consensus; (iii) the VH designated as HV1-69A, HV1-69B, HV1-69C or HV1-69 Consensus; or (iv) the VH designated as HV7-4-1A, HV7-4-1B, HV7-4-1C or HV7-4- 1 Consensus; and (b) a VL having a second sequence identity at least 95% identical to: (i) the VL designated as LV7-43A, LV7-43B, LV
- the antibody or antigen-binding fragment of any one of embodiments 15 to 79, wherein the second sequence identity is at least 97%.
- the antibody or antigen-binding fragment of any one of embodiments 15 to 79, wherein the second sequence identity is at least 99%.
- a humanized antibody or antigen-binding fragment thereof comprising: (a) a heavy chain variable region (VH) comprising any combination of CDR- H1, CDR-H2 and CDR-H3 set forth in Tables 4A-4D, optionally wherein: (i) CDR-H1 has the amino acid sequence of: HV1-18 Consensus CDR-H1 (SEQ ID NO:3) or HV1-69 Consensus CDR-H1 (SEQ ID NO:273); (ii) CDR-H2 has the amino acid sequence of: HV1-18 Consensus CDR-H2 (SEQ ID NO:4) or HV7-4-1 Consensus CDR-H2 (SEQ ID NO:275); and (iii) CDR-H3 has the amino acid sequence of: HV1-18 Consensus CDR-H3 (SEQ ID NO:264), HV1-4
- the antibody or antigen-binding fragment of embodiment 86 which comprises (a) a VH comprising: (i) CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs:3, 4, and 264, respectively; (ii) CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs:3, 4, and 268, respectively; (iii) CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs:273, 4, and 268, respectively; (iv) CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs: 3, 275, and 5, respectively; or (v) CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID Nos: 273, 275, and 5, respectively; and (b) a VL comprising: (i) CDR-L1, CDR
- the antibody or antigen-binding fragment of embodiment 87 which comprises (a) a VH comprising CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs:3, 4, and 264, respectively, and a VL comprising CDR-L1, CDR-L2, and CDR-L3 having the amino acid sequences of SEQ ID NOs:6, 7, and 8, respectively; or (b) a VH comprising CDR-H1, CDR-H2, and CDR-H3 having the amino acid sequences of SEQ ID NOs: 3, 275, and 5, respectively, and a VL comprising CDR-L1, CDR-L2, and CDR-L3 having the amino acid sequences of SEQ ID NOs:6, 7, and 8, respectively.
- An antibody or antigen-binding fragment which is optionally an antibody or antigen-binding fragment according to any one of embodiments 86 to 88, which is humanized and comprises: (a) a VH having a first sequence at least 95% identical to: (i) the VH designated as HV1-18A (SEQ ID NO:263), HV1-18B (SEQ ID NO:265), HV1-18C (SEQ ID NO:266) or HV1-18 Consensus (SEQ ID NO:265); (ii) the VH designated as HV1-46A (SEQ ID NO:267), HV1-46B (SEQ ID NO:269), HV1-46C (SEQ ID NO:270) or HV1-46 Consensus (SEQ ID NO:269); (iii) the VH designated as HV1-69A (SEQ ID NO:271), HV1-69B (SEQ ID NO:272), HV1-69C (SEQ ID NO:274) or HV1-6
- the antibody or antigen-binding fragment of embodiment 89 which comprises: (a) a VH having a first sequence at least 95% identical to the VH designated as HV1-18A (SEQ ID NO:263) and a VL having a second sequence at least 95% identical to the VL designated as LV7-43A (SEQ ID NO:277); (b) a VH having a first sequence at least 95% identical to the VH designated as HV7-4-1A (SEQ ID NO:271) and a VL having a second sequence at least 95% identical to the VL designated as LV7-43A (SEQ ID NO:277); (c) a VH having a first sequence at least 95% identical to the VH designated as HV1-18A (SEQ ID NO:263) and a VL having a second sequence at least 95% identical to the VL designated as LV7-46A (SEQ ID NO:281); or (d) a VH having a first sequence at least 95% identical to
- the antibody or antigen-binding fragment of embodiment 89 which comprises a VH having a first sequence at least 95% identical (e.g., at least 95%, at least 97%, at least 99%, or 100%) to the VH designated as HV1-18A (SEQ ID NO:263) and a VL having a second sequence at least 95% identical to the VL designated as LV7-43A (SEQ ID NO:277).
- a VH having a first sequence at least 95% identical e.g., at least 95%, at least 97%, at least 99%, or 100%
- VL having a second sequence at least 95% identical to the VL designated as LV7-43A (SEQ ID NO:277).
- the antibody or antigen-binding fragment of embodiment 89 which comprises a VH having a first sequence at least 95% identical (e.g., at least 95%, at least 97%, at least 99%, or 100%) to the VH designated as HV7-4-1A (SEQ ID NO:271) and a VL having a second sequence at least 95% identical to the VL designated as LV7-43A (SEQ ID NO:277).
- VH having a first sequence at least 95% identical (e.g., at least 95%, at least 97%, at least 99%, or 100%) to the VH designated as HV7-4-1A (SEQ ID NO:271) and a VL having a second sequence at least 95% identical to the VL designated as LV7-43A (SEQ ID NO:277).
- the antibody or antigen-binding fragment of embodiment 89 which comprises a VH having a first sequence at least 95% identical (e.g., at least 95%, at least 97%, at least 99%, or 100%) to the VH designated as HV1-18A (SEQ ID NO:263) and a VL having a second sequence at least 95% identical to the VL designated as LV7-46A (SEQ ID NO:281). 94.
- the antibody or antigen-binding fragment of embodiment 89 which comprises a VH having a first sequence at least 95% identical (e.g., at least 95%, at least 97%, at least 99%, or 100%) to the VH designated as HV7-4-1A (SEQ ID NO:271) and a VL having a second sequence at least 95% identical to the VL designated as LV7-46A (SEQ ID NO:281). 95.
- the antibody or antigen-binding fragment of any one of embodiments 86 to 94 which binds to a CD44v6 glycopeptide GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165) that has been glycosylated with GalNAc on threonine at amino acid position 5 of SEQ ID NO:165 and serine at amino acid position 12 of SEQ ID NO:165.
- the antibody or antigen-binding fragment of any one of embodiments 86 to 95 which (i) specifically binds to COSMC knock-out HaCaT cells and/or (ii) specifically binds to COSMC knock-out HEK293 cells recombinantly expressing CD44. 97.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 1 nM to 200 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 1 nM to 150 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 1 nM to 100 nM as measured by surface plasmon resonance or bio-layer interferometry.
- KD binding affinity
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 1 nM to 25 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 1 nM to 15 nM as measured by surface plasmon resonance or bio-layer interferometry.
- KD binding affinity
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 1 nM to 10 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 5 nM to 200 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 5 nM to 100 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 5 nM to 50 nM as measured by surface plasmon resonance or bio-layer interferometry. 107.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 5 nM to 25 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 5 nM to 10 nM as measured by surface plasmon resonance or bio-layer interferometry.
- KD binding affinity
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 10 nM to 200 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 10 nM to 100 nM as measured by surface plasmon resonance or bio-layer interferometry.
- KD binding affinity
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 10 nM to 50 nM as measured by surface plasmon resonance or bio-layer interferometry. 112.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 10 nM to 25 nM as measured by surface plasmon resonance or bio-layer interferometry. 113.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 50 nM to 200 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 50 nM to 100 nM as measured by surface plasmon resonance or bio-layer interferometry.
- KD binding affinity
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 100 nM to 200 nM as measured by surface plasmon resonance or bio-layer interferometry.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 85 and 95 to 96 which binds to the CD44v6 glycopeptide with a binding affinity (KD) of 100 nM to 150 nM as measured by surface plasmon resonance or bio-layer interferometry.
- KD binding affinity
- the antibody or antigen-binding fragment of embodiment 119 in which the measurement by bio-layer interferometry is carried out with the antibody or antigen-binding fragment as an analyte and the CD44v6 glycopeptide as an immobilized ligand.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 120 which does not specifically bind to an unglycosylated CD44v6 peptide GYRQTPKEDSHSTTGTAAA (SEQ ID NO:333) (the “unglycosylated CD44v6 peptide”). 122.
- the antibody or antigen-binding fragment of embodiment 121 which has a binding affinity to the CD44v6 glycopeptide which is at least 3 times the binding affinity of the antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide.
- the antibody or antigen-binding fragment of embodiment 121 which has a binding affinity to the CD44v6 glycopeptide which is at least 5 times the binding affinity of the antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- the antibody or antigen-binding fragment of embodiment 121 which has a binding affinity to the CD44v6 glycopeptide which is at least 10 times the binding affinity of antibody or antigen-binding fragment to the first unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide.
- the antibody or antigen-binding fragment of embodiment 121 which has a binding affinity to the CD44v6 glycopeptide which is at least 20 times the binding affinity of the antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- the antibody or antigen-binding fragment of embodiment 121 which has a binding affinity to the CD44v6 glycopeptide which is at least 50 times the binding affinity of the antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- the antibody or antigen-binding fragment of embodiment 121 which has a binding affinity to the CD44v6 glycopeptide which is at least 100 times the binding affinity of the antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 128.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 120 which does not specifically bind to the MUC1 tandem repeat (VTSAPDTRPAPGSTAPPAHG) 3 (SEQ ID NO:205) that has been glycosylated in vitro using purified recombinant human glycosyltransferases GalNAc-T1, GalNAc-T2, and GalNAc-T4 (“the first MUC1 glycopeptide”). 129.
- the antibody or antigen-binding fragment of embodiment 128, which has a binding affinity to the CD44v6 glycopeptide which is at least 3 times the binding affinity of the antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 130.
- the antibody or antigen-binding fragment of embodiment 128, which has a binding affinity to the CD44v6 glycopeptide which is at least 5 times the binding affinity of the antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- the antibody or antigen-binding fragment of embodiment 128, which has a binding affinity to the CD44v6 glycopeptide which is at least 10 times the binding affinity of antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- the antibody or antigen-binding fragment of embodiment 128, which has a binding affinity to the CD44v6 glycopeptide which is at least 20 times the binding affinity of the antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- the antibody or antigen-binding fragment of embodiment 128, which has a binding affinity to the CD44v6 glycopeptide which is at least 50 times the binding affinity of the antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide.
- the antibody or antigen-binding fragment of embodiment 128, which has a binding affinity to the CD44v6 glycopeptide which is at least 100 times the binding affinity of the antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 135.
- the antibody or antigen-binding fragment of any one of embodiments 2 to 120 which does not specifically bind to the MUC1 TAPPAHGVTSAPDTRPAPGSTAPPAHGVT (SEQ ID NO:262) that has been glycosylated in vitro with GalNAc on the serine and threonine residues shown with bold and underlined text (“the second MUC1 glycopeptide”). 136.
- saturating amounts of either the glyco-CD44v6 peptide or second first MUC1 glycopeptide e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide.
- scFv single-chain variable fragment
- the antibody or antigen-binding fragment of embodiment 144, wherein the scFv comprises the heavy chain variable fragment N-terminal to the light chain variable fragment.
- the scFv comprises the heavy chain variable fragment C-terminal to the light chain variable fragment.
- 148. The antibody or antigen-binding fragment of any one of embodiments 1 to 141, which is in the form of a multispecific antibody.
- 149. The antibody or antigen-binding fragment of embodiment 148 wherein the multispecific antibody is a bispecific antibody that binds to a second epitope that is different from the first epitope.
- the antibody or antigen-binding fragment of embodiment 150, wherein the bispecific antibody is a mAb-Fv format bispecific antibody.
- the antibody or antigen-binding fragment of embodiment 150, wherein the bispecific antibody is a mAb-scFv format bispecific antibody.
- the antibody or antigen-binding fragment of embodiment 150, wherein the bispecific antibody is a central-scFv format bispecific antibody.
- the antibody or antigen-binding fragment of embodiment 150, wherein the bispecific antibody is a one-armed central-scFv format bispecific antibody.
- the antibody or antigen-binding fragment of embodiment 150, wherein the bispecific antibody is a dual scFv format bispecific antibody.
- the bispecific antibody is a bispecific domain-exchanged antibody (e.g., a CrossMab).
- the antibody or antigen-binding fragment of embodiment 158, wherein the bispecific antibody is a bispecific IgG comprising a Fab-arm having a domain crossover between constant heavy and constant light chains (e.g., a CrossMabCH1-CL). 162.
- the antibody or antigen-binding fragment of embodiment 158, wherein the bispecific antibody is a Fab-arm exchange antibody. 163.
- the antibody or antigen-binding fragment of embodiment 158, wherein the bispecific antibody is a dual-affinity retargeting molecule (DART).
- DART dual-affinity retargeting molecule
- 164. The antibody or antigen-binding fragment of embodiment 158, wherein the bispecific antibody is a bispecific T-cell engager (BiTE). 165.
- the antibody or antigen-binding fragment of any one of embodiment 149 to 164, wherein the second epitope is a T-cell epitope. 168.
- a fusion protein comprising the amino acid sequence of the antibody or antigen- binding fragment of any one of embodiments 1 to 172 operably linked to at least a second amino acid sequence. 174.
- the fusion protein of embodiment 173, wherein the second amino acid sequence comprises that of 4-1BB, CD2, CD3-zeta, or a fragment thereof. 175.
- the fusion protein of embodiment 173, wherein the second amino acid sequence is that of a fusion peptide.
- the fusion protein of embodiment 173, wherein the second amino acid sequence is that of a modulator of T cell activation or a fragment thereof. 178.
- the fusion protein of embodiment 177, wherein the modulator of T cell activation is IL-15 or IL-15R ⁇ .
- the fusion protein of embodiment 173, wherein the second amino acid sequence is that of a MIC protein domain.
- the fusion protein of embodiment 179, wherein the MIC protein domain is an ⁇ 1- ⁇ 2 domain.
- the fusion protein of embodiment 180, wherein the ⁇ 1- ⁇ 2 domain is a MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, or OMCP ⁇ 1- ⁇ 2 domain. 182.
- the neuraminidase amino acid sequence is derived from Micromonospora viridifaciens. 185.
- neuraminidase comprises an amino acid sequence having at least 95% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 97% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 98% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 99% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises the amino acid sequence GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- the fusion protein of embodiment 190, wherein the signal sequence is a granulysin signal sequence.
- the fusion protein of embodiment 190, wherein the signal sequence is an NPY signal sequence. 194.
- the fusion protein of embodiment 190, wherein the signal sequence is an IFN signal sequence.
- the fusion protein of embodiment 195 wherein the self-cleaving peptide sequence is a 2A peptide. 197.
- a chimeric antigen receptor (CAR) comprising one or more antigen-binding fragments according to any one of embodiment 143 to 147.
- the CAR of embodiment 198 which comprises one or more scFvs according to any one of embodiments 142 to 145.
- the CAR of embodiment 199 which comprises one scFv according to any one of embodiments 142 to 145.
- the CAR of embodiment 205 wherein the CD28 transmembrane domain comprises the amino acid sequence FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO:186).
- the CAR of embodiment 207 wherein the co-stimulatory signaling region comprises the cytoplasmic domain of CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, DAP10, GITR, or a combination thereof.
- LFA-1 lymphocyte function-associated antigen-1
- CD2 CD7
- LIGHT NKG2C
- B7-H3 a ligand that specifically binds with CD83, DAP10, GITR, or a combination thereof.
- the CAR of embodiment 209, wherein the cytoplasmic domain of CD2 comprises the amino acid sequence TKRKKQRSRRNDEELETRAHRVATEERGRKPHQIPASTPQNPATSQHPPPPPGHRSQAPSH RPPPPGHRVQHQPQKRPPAPSGTQVHQQKGPPLPRPRVQPKPPHGAAENSLSPSSN (SEQ ID NO:289).
- the CAR of any one of embodiments 208 to 210, wherein the co-stimulatory signaling domain comprises the cytoplasmic domain of CD28. 212.
- the CAR of embodiment 211, wherein the cytoplasmic domain of CD28 comprises the amino acid sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO:179). 213.
- the CAR of any one of embodiments 204 to 212, wherein the intracellular signaling domain comprises a T cell signaling domain.
- the T cell signaling domain is C-terminal to the co-stimulatory signaling region.
- 215. The CAR of embodiment 211 or 214, wherein the T cell signaling domain comprises a CD3-zetTa signaling domain. 216.
- the CAR of embodiment 215, wherein the CD3-zeta signaling domain comprises the amino acid sequence RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYN ELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO:180). 217.
- the CAR of embodiment 217, wherein the signal peptide is a human CD8 signal peptide. 219.
- the CAR of embodiment 218, wherein the human CD8 signal peptide comprises the amino acid sequence MALPVTALLLPLALLLHAARP (SEQ ID NO:175). 220.
- the CAR of embodiment 220, wherein the hinge comprises a human CD8a hinge.
- the CAR of embodiment 221, wherein the human CD8a hinge comprises the amino acid sequence TTTPAPRPPTPAPTIASPLSLRPEACRPAAGGAVHTRGLDFAC (SEQ ID NO:203). 223.
- the CAR of embodiment 221, wherein the human CD8a hinge comprises the amino acid sequence TTTPAPRPPTPAPTIASPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO:176).
- the hinge comprises a human IgG4- short hinge comprising the amino acid sequence ESKYGPPCPSCP (SEQ ID NO:177).
- An antibody-drug conjugate comprising the antibody or antigen-binding fragment of one of embodiments 1 to 172 or the fusion protein of any one of embodiments 173 to 197 conjugated to a cytotoxic agent.
- a cytotoxic agent is an auristatin, a DNA minor groove binding agent, an alkylating agent, an enediyne, a lexitropsin, a duocarmycin, a taxane, a dolastatin, a maytansinoid, a vinca alkaloid or an amanitin toxin. 228.
- the antibody-drug conjugate of embodiment 230, wherein the linker comprises a dipeptide.
- a T cell receptor (TCR) fusion protein comprising one or more antigen-binding fragments according to any one of embodiments 143 to 147 and one or more domains of a TCR complex subunit. 237.
- the TCR fusion protein of embodiment 237 or 238, wherein the peptide linker comprises or consists of (G 4S)n, wherein n 1 to 4 (SEQ ID NO:316).
- the TCR fusion protein any one of embodiments 236 to 239, wherein the antigen-binding fragment is in the form of a single-chain variable fragment (scFv). 241.
- the TCR fusion protein of embodiment 240 which comprises one or more scFvs according to any one of embodiments 144 to 147. 242.
- the TCR fusion protein of embodiment 243, wherein the two scFvs have the same amino acid sequence. 245.
- the TCR fusion protein of embodiment 243 or 244, wherein the two scFvs are covalently bound by a linker sequence, which is optionally 4-15 amino acids. 246.
- the TCR fusion protein of any one of embodiments 236 to 473 comprising in amino- to carboxy-terminal order: (i) the one or more antigen binding fragments; (ii) an extracellular domain of the TCR complex subunit; (iii) a transmembrane domain of the TCR complex subunit; and (iii) an intracellular signaling domain of the TCR complex subunit. 249.
- the TCR fusion protein of any one of embodiments 236 to 250, wherein the TCR complex subunit is TCR ⁇ . 254.
- the TCR fusion protein of any one of embodiments 236 to 250, wherein the TCR complex subunit is TCR ⁇ . 255.
- the TCR fusion protein of any one of embodiments 236 to 257, wherein the TCR fusion protein is a T cell receptor fusion construct (TRuC). 259.
- TRuC T cell receptor fusion construct
- TCR fusion protein of any one of embodiments 236 to 257 wherein the TCR fusion protein is a synthetic T cell receptor (TCR) and antigen receptor (STAR).
- TCR T cell receptor
- STAR antigen receptor
- a T cell receptor (TCR) complex comprising one or more TCR fusion proteins of any one of embodiments 236 to 260.
- the TCR complex of embodiment 261, wherein the TCR complex is a TCR ⁇ / ⁇ TCR complex.
- TCR complex of embodiment 261, wherein the TCR complex is a TCR ⁇ / ⁇ TCR complex. 264.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWIGNIYPRSGTTNY DGYFKSRATLTVDTSTSTAYMELRSLRSDDTAVYFCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO: 263).
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGNIYPRSGTTN YDGYFKGRVTLTTDTSTSTAYMELRSLRSDDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:265).
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWIHWVRQAPGQGLEWMGNIYPRSGTTNY AGYFQGRVTLTTDTSTSTAYMELRSLRSDDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:266).
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGNIYPRSGTTN YDGYFKGRVTLTTDTSTSTAYMELRSLRSDDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:265).
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWIGNIYPRSGTTNY DGYFKSRATLTVDTSTSTAYMELSSLRSEDTAVYFCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:267).
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGNIYPRSGTTN YDGYFKSRVTLTVDTSTSTVYMELSSLRSEDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:269).
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGNIYPRSGTTN YAGYFQGRVTLTVDTSTSTVYMELSSLRSEDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:270).
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGNIYPRSGTTN YDGYFKSRVTLTVDTSTSTVYMELSSLRSEDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:269).
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAPGQGLEWIGNIYPRSGTTNY DGYFKSRATLTVDTSTSTAYMELSSLRSEDTAVYFCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:271). 275.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSYWMHWVRQAPGQGLEWMGNIYPRSGTTN YDGYFKGRVTLTADTSTSTAYMELSSLRSEDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:272). 276.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSYWIHWVRQAPGQGLEWMGNIYPRSGTTNY AGYFQGRVTLTADESTSTAYMELSSLRSEDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:274). 277.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSYWMHWVRQAPGQGLEWMGNIYPRSGTTN YDGYFKGRVTLTADTSTSTAYMELSSLRSEDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:272). 278.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYWMHWVRQAPGQGLEWIGNIYPRSGTTNY DGYFKSRATLTVDTSTSTAYMELSSLRSEDTAVYFCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:271). 279.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSYWMHWVRQAPGQGLEWMGNIYPRSGTTN YDGYFKGRVTLTADTSTSTAYMELSSLRSEDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:272). 280.
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGAEVKKPGSSVKVSCKASGYTFSSYWIHWVRQAPGQGLEWMGNIYPRSGTTNY AGYFQGRVTLTADESTSTAYMELSSLRSEDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:274).
- anti-glyco-CD44 variable heavy chain comprises an amino acid of QVQLVQSGSELKKPGASVKVSCKASGYTFTSYWMHWVRQAPGQGLEWMGNIYPRSGTTNY DGYFKGRAVLSVDTSVSTAYLQISSLKAEDTAVYYCTRSGYDYPFVYWGQGTLVTVSS (SEQ ID NO:276).
- the anti-glyco-CD44 variable heavy chain comprises: (a) a complementarity determining region (CDR) H1 comprising the amino acid sequence of GYTFTSYW (SEQ ID NO:3) or GYTFSSYW (SEQ ID NO:273); (b) a CDR-H2 comprising the amino acid sequence of IYPRSGTT (SEQ ID NO:4) or IYPRSGTTN (SEQ ID NO:275); and (c) a CDR-H3 comprising the amino acid sequence of TRSGYDYPF (SEQ ID NO:264), TRSGYDYPFV (SEQ ID NO:268), or TRSGYDYPFVY (SEQ ID NO:5). 283.
- CDR complementarity determining region
- variable light chain comprises an amino acid of QAVVTQEPSLTVSPGGTVTLTCRTSTGAVSIRNYANWVQEKPGQAFRGLIGGTNNRAPWTP ARFSGSLLGDKAALTLSGVQPEDEAEYFCALLYSNYWVFGGGTKLTVL (SEQ ID NO:277).
- variable light chain comprises an amino acid of QTVVTQEPSLTVSPGGTVTLTCATSTGAVSIRNYANWVQQKPGQAPRGLIGGTNNRAPWTP ARFSGSLLGGKAALTLSGVQPEDEAEYYCALLYSNYWVFGGGTKLTVL (SEQ ID NO:278).
- variable light chain comprises an amino acid of QTVVTQEPSLTVSPGGTVTLTCASSTGAVTIRNYANWVQQKPGQAPRGLIGGTNNRAPWTP ARFSGSLLGGKAALTLSGVQPEDEAEYYCALLYSNYWVFGGGTKLTVL (SEQ ID NO:279).
- variable light chain comprises an amino acid of QTVVTQEPSLTVSPGGTVTLTCATSTGAVSIRNYANWVQQKPGQAPRGLIGGTNNRAPWTP ARFSGSLLGGKAALTLSGVQPEDEAEYYCALLYSNYWVFGGGTKLTVL (SEQ ID NO:278). 287.
- variable light chain comprises an amino acid of QAVVTQEPSLTVSPGGTVTLTCRTSTGAVSIRNYANWVQEKPGQAFRGLIGGTNNRAPWTP ARFSGSLLGDKAALTLSGAQPEDEAEYFCALLYSNYWVFGGGTKLTVL (SEQ ID NO:281). 288.
- variable light chain comprises an amino acid of QAVVTQEPSLTVSPGGTVTLTCGTSTGAVSIRNYANWVQQKPGQAPRGLIGGTNNRAPWTP ARFSGSLLGGKAALTLSGAQPEDEAEYYCALLYSNYWVFGGGTKLTVL (SEQ ID NO:282).
- variable light chain comprises an amino acid of QAVVTQEPSLTVSPGGTVTLTCGSSTGAVTIRHYANWVQQKPGQAPRGLIGGTNNRAPWTP ARFSGSLLGGKAALTLSGAQPEDEAEYYCALLYSNYWVFGGGTKLTVL (SEQ ID NO:283).
- variable light chain comprises an amino acid of QAVVTQEPSLTVSPGGTVTLTCGTSTGAVSIRNYANWVQQKPGQAPRGLIGGTNNRAPWTP ARFSGSLLGGKAALTLSGAQPEDEAEYYCALLYSNYWVFGGGTKLTVL (SEQ ID NO:282). 291.
- variable light chain comprises an amino acid of QAVVTQEPSFSVSPGGTVTLTCRTSTGAVSIRNYANWVQETPGQAFRGLIGGTNNRAPGVP DRFSGSLLGDKAALTITGAQADDESDYFCALLYSNYWVFGGGTKLTVL (SEQ ID NO:285).
- variable light chain comprises an amino acid of QTVVTQEPSFSVSPGGTVTLTCGTSTGAVSIRNYANWVQQTPGQAPRGLIGGTNNRAPGVP DRFSGSLLGNKAALTITGAQADDESDYYCALLYSNYWVFGGGTKLTVL (SEQ ID NO:286).
- variable light chain comprises an amino acid of QTVVTQEPSFSVSPGGTVTLTCGTSSGAVSTRYYANWVQQTPGQAPRGLIGGTNNRSSGVP DRFSGSLLGNKAALTITGAQADDESDYYCALLYSNYWVFGGGTKLTVL (SEQ ID NO: 287).
- variable light chain comprises an amino acid of QTVVTQEPSFSVSPGGTVTLTCGTSTGAVSIRNYANWVQQTPGQAPRGLIGGTNNRAPGVP DRFSGSLLGNKAALTITGAQADDESDYYCALLYSNYWVFGGGTKLTVL (SEQ ID NO:286).
- the anti-glyco-CD44 variable light chain comprises: (a) a CDR-L1 comprising the amino acid sequence of TGAVSIRNY (SEQ ID NO:6), TGAVTIRHY (SEQ ID NO:284), or SGAVSTRYY (SEQ ID NO:288); (b) a CDR-L2 comprising the amino acid sequence of GTN (SEQ ID NO:7); and (c) a CDR-L3 comprising the amino acid sequence of ALLYSNYWV (SEQ ID NO:8). 296.
- the STAR of embodiment 296 or 297, wherein the first TCR constant region domain and the second TCR constant region domain each comprise at least one mutation relative to the wildtype TCR constant region domain. 299.
- 305. The STAR of any one of embodiments 265 to 304, wherein the peptide linker comprises the sequence ATNFSLLKQAGDVEENPGP (SEQ ID NO:303). 306.
- a nucleic acid comprising a coding region for an antibody or antigen-binding fragment of any one of embodiments 1 to 172, the fusion protein of any one of embodiments 173 to 197, the CAR of any one of embodiment 198 to 225, the TCR fusion protein of any one of embodiments 236 to 260, the TCR complex of any one of claims 261 to 264, or the STAR of any one of embodiments 265 to 309. 311.
- a vector comprising the nucleic acid of embodiment 310 or embodiment 311. 313.
- the vector of embodiment 312 which is a viral vector. 314.
- the vector of embodiment 313 wherein the viral vector is a lentiviral vector. 315.
- the host cell of embodiment 315 which is engineered to express a neuraminidase (EC 3.2.1.18 or EC 3.2.1.129).
- the host cell of embodiment 316, wherein the neuraminidase is derived from Micromonospora viridifaciens. 318.
- neuraminidase comprises an amino acid sequence having at least 95% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 97% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 98% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises an amino acid sequence having at least 99% sequence identity to GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- neuraminidase comprises the amino acid sequence GGSPVPPGGEPLYTEQDLAVNGREGFPNYRIPALTVTPDGDLLASYDGRPTGIDAPGPNSILQ RRSTDGGRTWGEQQVVSAGQTTAPIKGFSDPSYLVDRETGTIFNFHVYSQRQGFAGSRPGT DPADPNVLHANVATSTDGGLTWSHRTITADITPDPGWRSRFAASGEGIQLRYGPHAGRLIQQ YTIINAAGAFQAVSVYSDDHGRTWRAGEAVGVGMDENKTVELSDGRVLLNSRDSARSGYRK VAVSTDGGHSYGPVTIDRDLPDPTNNASIIRAFPDAPAGSARAKVLLFSNAASQTSRSQGTIR MSCDDGQTWPVSKVFQPGSMSYSTLTALPDGTYGLLYEPGTGIRYANFNLAWLGG (SEQ ID NO:314).
- the host cell of any one of embodiments 315 to 324 which is a human T-cell engineered to express the TCR fusion protein of any one of embodiments 236 to 260. 328.
- the host cell of any one of embodiments 315 to 324 which is a human T-cell engineered to express the TCR complex of any one of claims 261 to 264. 329.
- the host cell of any one of embodiments 315 to 324 which is a human T-cell engineered to express the STAR of any one of embodiments 265 to 309. 330.
- a host cell comprising the vector of any one of embodiments 312 to 313. 331.
- a host cell of any one of embodiments 316 to 327 which comprises a vector encoding the neuraminidase. 332.
- the host cell of embodiment 327 or embodiment 331 which is a T-cell and wherein the vector encodes the CAR of any one of embodiments 198 to 225. 333.
- the host cell of embodiment 327 or embodiment 331 which is an NK cell and wherein the vector encodes the CAR of any one of embodiments 198 to 225. 334.
- the host cell of embodiment 327 or embodiment 331 which is a T-cell and wherein the vector encodes the TCR fusion protein of any one of embodiments 236 to 260. 335.
- the host cell of embodiment 327 or embodiment 331 which is a T-cell and wherein the vector encodes the STAR of any one of embodiments 265 to 309. 336.
- a pharmaceutical composition comprising (a) the antibody or antigen-binding fragment of any of embodiments 1 to 172, the fusion protein of any one of embodiments 173 to 197, the CAR of any one of embodiments 198 to 225, the antibody-drug conjugate of any one of embodiments 226 to 235, the TCR fusion protein of any one of embodiments 236 to 260, the TCR complex of any one of claims 261 to 264, or the STAR of any one of embodiments 265 to 309, the nucleic acid of embodiment 310 or embodiment 311, the vector of any one of embodiments 312 to 314, or the host cell of any one of embodiments 315 to 335, and (b) a physiologically suitable buffer, adjuvant, diluent, or combination thereof.
- a method of treating cancer comprising administering to a subject in need thereof an effective amount of the antibody or antigen-binding fragment of any of embodiments 1 to 172, the fusion protein of any one of embodiments 173 to 197, the CAR of any one of embodiments 198 to 225, the antibody-drug conjugate of any one of embodiments 226 to 235, the TCR fusion protein of any one of embodiments 236 to 260, the TCR complex of any one of claims 261 to 264, or the STAR of any one of embodiments 265 to 309, the nucleic acid of embodiment 310 or embodiment 311, the vector of any one of embodiments 312 to 314, the host cell of any one of embodiments 315 to 335, or the pharmaceutical composition of embodiment 336.
- the method of embodiment 342, wherein the urogenital cancer is prostate cancer. 344. The method of embodiment 342, wherein the urogenital cancer is kidney cancer. 345. The method of embodiment 338, wherein the subject is suffering from pancreatic cancer. 346. The method of embodiment 338, wherein the subject is suffering from colorectal cancer. 347. The method of embodiment 338, wherein the subject is suffering from ovarian cancer. 348. The method of embodiment 338, wherein the subject is suffering from gastric cancer. 349. The method of embodiment 338, wherein the subject is suffering from head and neck cancer. 350. The method of embodiment 349, wherein the head and neck cancer is head and neck squamous cell carcinoma (HNSCC). 351.
- HNSCC head and neck squamous cell carcinoma
- the method of embodiment 338, wherein the subject is suffering from skin cancer. 352.
- the method of embodiment 338, wherein the subject is suffering from malignant melanoma. 353.
- the method of embodiment 338, wherein the subject is suffering from liver cancer. 354.
- the method of embodiment 338, wherein the subject is suffering from a glioma. 355.
- the method of embodiment 338, wherein the subject is suffering from thyroid cancer. 356.
- the method of embodiment 338, wherein the subject is suffering from cervical cancer. 357.
- the method of embodiment 338, wherein the subject is suffering from endometrial cancer. 358.
- a method of detecting cancer in a biological sample comprising contacting a sample (e.g., a sample comprising or suspected of comprising cancer cells and/or cancer- derived extracellular vesicles) with an antibody or antigen-binding fragment according to any one of embodiments 1 to 172 and detecting binding of the antibody or antigen-binding fragment. 359.
- the method of embodiment 358 further comprising quantitating the binding of the antibody or antigen-binding fragment.
- 360. The method of embodiment 358 or embodiment 359, wherein the binding is compared to a normal tissue control as a negative/baseline control and/or to a cancerous tissue control as a positive control. 361.
- any one of embodiments 358 to 360, wherein the cancer is breast cancer, lung cancer, a urogenital cancer, pancreatic cancer, colorectal cancer, ovarian cancer, gastric cancer, head and neck cancer, skin cancer, malignant melanoma, liver cancer, a glioma, thyroid cancer, cervical cancer, or endometrial cancer.
- the method of embodiment 361, wherein the cancer is breast cancer. 363.
- the method of embodiment 361, wherein the cancer is lung cancer. 364.
- the method of embodiment 363, wherein the lung cancer is non-small cell lung cancer.
- 365 The method of embodiment 361, wherein the cancer is a urogenital cancer.
- 366 The method of embodiment 365, wherein the cancer is prostate cancer. 367.
- the method of embodiment 365 wherein the cancer is kidney cancer. 368.
- the method of embodiment 361, wherein the cancer is pancreatic cancer. 369.
- the method of embodiment 361, wherein the cancer is colorectal cancer.
- 370. The method of embodiment 361, wherein the cancer is ovarian cancer. 371.
- the method of embodiment 361, wherein the cancer is gastric cancer. 372.
- the method of embodiment 361, wherein the cancer is head and neck cancer. 373.
- the method of embodiment 372, wherein the head and neck cancer is HNSCC. 374.
- the method of embodiment 361, wherein the cancer is skin cancer. 375.
- the method of embodiment 361, wherein the cancer is malignant melanoma. 376.
- the method of embodiment 361, wherein the cancer is liver cancer. 377.
- the method of embodiment 361, wherein the cancer is a glioma. 378.
- the method of embodiment 361, wherein the cancer is thyroid cancer. 379.
- the method of embodiment 361, wherein the cancer is cervical cancer.
- the method of embodiment 361, wherein the cancer is endometrial cancer. 381.
- the cancer is breast cancer, lung cancer,
- the use according to embodiment 401, wherein the cancer is breast cancer 403.
- the use according to embodiment 401, wherein the cancer is lung cancer. 404.
- the use according to embodiment 403, wherein the lung cancer is non-small cell lung cancer.
- the use according to embodiment 401, wherein the cancer is a urogenital cancer. 406.
- the use according to embodiment 405, wherein the urogenital cancer is prostate cancer. 407.
- the use according to embodiment 405, wherein the urogenital cancer is kidney cancer. 408.
- the use according to embodiment 401, wherein the cancer is pancreatic cancer. 409.
- the use according to embodiment 401, wherein the cancer is colorectal cancer. 410.
- the use according to embodiment 401, wherein the cancer is ovarian cancer. 411.
- the use according to embodiment 401, wherein the cancer is gastric cancer. 412.
- the use according to embodiment 401, wherein the cancer is head and neck cancer. 413.
- the use according to embodiment 401, wherein the head and neck cancer is HNSCC. 414.
- the use according to embodiment 401, wherein the cancer is skin cancer. 415.
- the use according to embodiment 401, wherein the cancer is malignant melanoma. 416.
- the use according to embodiment 401, wherein the cancer is liver cancer. 417.
- the use according to embodiment 401, wherein the cancer is a glioma. 418.
- the use according to embodiment 401, wherein the cancer is thyroid cancer. 419.
- the use according to embodiment 401, wherein the cancer is cervical cancer. 420.
- an antibody or antigen-binding fragment thereof comprising: (a) a means for specifically binding to a CD44v6 glycopeptide GYRQTPKEDSHSTTGTAAA (SEQ ID NO:165) that has been glycosylated with GalNAc on threonine at amino acid position 5 of SEQ ID NO:165 and serine at amino acid position 12 of SEQ ID NO:165; and (b) a linker. 422.
- the antibody or antigen-binding fragment of embodiment 442 in which the measurement by surface plasmon resonance is carried out at a saturating concentration of the CD44v6 glycopeptide as an analyte, wherein the antibody or antigen-binding fragment is an immobilized ligand.
- the antibody or antigen-binding fragment of any one of embodiments 421 to 445 which does not specifically bind to an unglycosylated CD44v6 peptide GYRQTPKEDSHSTTGTAAA (SEQ ID NO:333) (the “unglycosylated CD44v6 peptide”). 447.
- the antibody or antigen-binding fragment of embodiment 446 which has a binding affinity to the CD44v6 glycopeptide which is at least 3 times the binding affinity of the antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 448.
- the antibody or antigen-binding fragment of embodiment 446 which has a binding affinity to the CD44v6 glycopeptide which is at least 5 times the binding affinity of the antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 449.
- the antibody or antigen-binding fragment of embodiment 446 which has a binding affinity to the CD44v6 glycopeptide which is at least 10 times the binding affinity of antibody or antigen-binding fragment to the first unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- the antibody or antigen-binding fragment of embodiment 446 which has a binding affinity to the CD44v6 glycopeptide which is at least 20 times the binding affinity of the antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 451.
- the antibody or antigen-binding fragment of embodiment 446 which has a binding affinity to the CD44v6 glycopeptide which is at least 50 times the binding affinity of the antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 452.
- the antibody or antigen-binding fragment of embodiment 446 which has a binding affinity to the CD44v6 glycopeptide which is at least 100 times the binding affinity of the antibody or antigen-binding fragment to the unglycosylated CD44v6 peptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the unglycosylated CD44v6 peptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 453.
- the antibody or antigen-binding fragment of embodiment 453, which has a binding affinity to the CD44v6 glycopeptide which is at least 3 times the binding affinity of the antibody or antigen-binding fragment to the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide). 455.
- the antibody or antigen-binding fragment of any one of embodiments 421 to 459 which does not specifically bind to the MUC1 TAPPAHGVTSAPDTRPAPGSTAPPAHGVT (SEQ ID NO:262) that has been glycosylated in vitro with GalNAc on the serine and threonine residues shown with bold and underlined text (“the second MUC1 glycopeptide”). 461.
- the antibody or antigen-binding fragment of embodiment 460 which has a binding affinity to the CD44v6 glycopeptide which is at least 3 times the binding affinity of the antibody or antigen-binding fragment to the second MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the second MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- the antibody or antigen-binding fragment of embodiment 461, which has a binding affinity to the CD44v6 glycopeptide which is at least 5 times the binding affinity of the antibody or antigen-binding fragment to the second MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the first MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the second MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- the antibody or antigen-binding fragment of embodiment 461 which has a binding affinity to the CD44v6 glycopeptide which is at least 100 times the binding affinity of the antibody or antigen-binding fragment to the second MUC1 glycopeptide, optionally wherein the binding affinity is measured by surface plasmon resonance, and further optionally where in the surface plasmon resonance is measured in the presence of saturating amounts of either the glyco-CD44v6 peptide or the second MUC1 glycopeptide (e.g., about 1 ⁇ M, about 1.5 ⁇ M, or about 2 ⁇ M of each peptide).
- the antibody or antigen-binding fragment of any one of embodiments 421 to 466 which is multivalent. 468.
- the antibody or antigen-binding fragment of any one of embodiments 421 to 466 which is an antigen-binding fragment.
- 469. The antibody or antigen-binding fragment of any one of embodiments 421 to 468, wherein the means for binding to the CD44v6 glycopeptide is a single chain variable fragment (scFv) comprising a heavy chain variable fragment (V H ) and a light chain variable fragment (V L ), and the linker is a polypeptide linker linking the V H domain and the V L domain.
- scFv single chain variable fragment
- V H heavy chain variable fragment
- V L light chain variable fragment
- the linker is a polypeptide linker linking the V H domain and the V L domain.
- 470. The antibody or antigen-binding fragment of embodiment 469, wherein the V H is N-terminal to the V L . 471.
- Fab fragment antigen- binding
- the linker comprises or consists of a glycine-serine linker.
- the antibody or antigen-binding fragment of any one of embodiments 421 to 473, wherein the linker comprises or consists of (G 4 S) n , wherein n 1 to 4 (SEQ ID NO:316). 475.
- the antibody or antigen-binding fragment of any one of embodiments 421 to 475 which is in the form of a multispecific antibody.
- the antibody or antigen-binding fragment of embodiment 476, wherein the multispecific antibody is a bispecific antibody that binds to a second epitope that is different from the first epitope. 478.
- the antibody or antigen-binding fragment of embodiment 478, wherein the bispecific antibody is a mAb-Fv format bispecific antibody.
- the antibody or antigen-binding fragment of embodiment 478, wherein the bispecific antibody is a mAb-scFv format bispecific antibody. 482.
- the antibody or antigen-binding fragment of embodiment 478, wherein the bispecific antibody is a central-scFv format bispecific antibody. 483.
- the antibody or antigen-binding fragment of embodiment 478, wherein the bispecific antibody is a one-armed central-scFv format bispecific antibody.
- the antibody or antigen-binding fragment of embodiment 478, wherein the bispecific antibody is a dual scFv format bispecific antibody. 485.
- a bispecific domain-exchanged antibody e.g., a CrossMab
- Fab-arm exchange antibody e.g., a bispecific T-cell engager
- BiTE bispecific T-cell engager
- DART dual-affinity retargeting molecule
- the antibody or antigen-binding fragment of embodiment 485, wherein the bispecific antibody is a dual-affinity retargeting molecule (DART). 492.
- the antibody or antigen-binding fragment of embodiment 485, wherein the bispecific antibody is a bispecific T-cell engager (BiTE). 493.
- the antibody or antigen-binding fragment of embodiment 499 in which the detectable moiety is an enzyme, a radioisotope, or a fluorescent label.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Zoology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US18/548,772 US20250326855A1 (en) | 2021-03-05 | 2022-03-04 | Anti-glyco-cd44 antibodies and their uses |
| JP2023553521A JP2024512324A (ja) | 2021-03-05 | 2022-03-04 | 抗グリコcd44抗体およびその使用 |
| EP22712699.2A EP4301782A1 (en) | 2021-03-05 | 2022-03-04 | Anti-glyco-cd44 antibodies and their uses |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202163157601P | 2021-03-05 | 2021-03-05 | |
| US63/157,601 | 2021-03-05 | ||
| US202163223698P | 2021-07-20 | 2021-07-20 | |
| US63/223,698 | 2021-07-20 | ||
| US202163270641P | 2021-10-22 | 2021-10-22 | |
| US63/270,641 | 2021-10-22 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022187591A1 true WO2022187591A1 (en) | 2022-09-09 |
Family
ID=80937187
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2022/018863 Ceased WO2022187591A1 (en) | 2021-03-05 | 2022-03-04 | Anti-glyco-cd44 antibodies and their uses |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US20250326855A1 (https=) |
| EP (1) | EP4301782A1 (https=) |
| JP (1) | JP2024512324A (https=) |
| WO (1) | WO2022187591A1 (https=) |
Citations (149)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| US4510245A (en) | 1982-11-18 | 1985-04-09 | Chiron Corporation | Adenovirus promoter system |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| EP0239400A2 (en) | 1986-03-27 | 1987-09-30 | Medical Research Council | Recombinant antibodies and methods for their production |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4816397A (en) | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
| WO1989012624A2 (en) | 1988-06-14 | 1989-12-28 | Cetus Corporation | Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom |
| US4968615A (en) | 1985-12-18 | 1990-11-06 | Ciba-Geigy Corporation | Deoxyribonucleic acid segment from a virus |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| EP0592106A1 (en) | 1992-09-09 | 1994-04-13 | Immunogen Inc | Resurfacing of rodent antibodies |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5658570A (en) | 1991-07-25 | 1997-08-19 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| US5834597A (en) | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US5858358A (en) | 1992-04-07 | 1999-01-12 | The United States Of America As Represented By The Secretary Of The Navy | Methods for selectively stimulating proliferation of T cells |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US5993434A (en) | 1993-04-01 | 1999-11-30 | Genetronics, Inc. | Method of treatment using electroporation mediated delivery of drugs and genes |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US6181964B1 (en) | 1997-08-01 | 2001-01-30 | Genetronics, Inc. | Minimally invasive apparatus and method to electroporate drugs and genes into tissue |
| US6241701B1 (en) | 1997-08-01 | 2001-06-05 | Genetronics, Inc. | Apparatus for electroporation mediated delivery of drugs and genes |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| CA2443437A1 (en) * | 2001-05-18 | 2002-11-28 | Boehringer Ingelheim International Gmbh | Antibodies specific for cd44v6 |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6678556B1 (en) | 1998-07-13 | 2004-01-13 | Genetronics, Inc. | Electrical field therapy with reduced histopathological change in muscle |
| US20040014645A1 (en) | 2002-05-28 | 2004-01-22 | Advisys, Inc. | Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US20040059285A1 (en) | 2002-07-04 | 2004-03-25 | Inovio As | Electroporation device and injection apparatus |
| US20040092907A1 (en) | 1997-04-03 | 2004-05-13 | Inovio As | Method for muscle delivery of drugs, nucleic acids and other compounds |
| US20040101519A1 (en) | 2002-01-03 | 2004-05-27 | The Trustees Of The University Of Pennsylvania | Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool |
| WO2004065540A2 (en) | 2003-01-22 | 2004-08-05 | Glycart Biotechnology Ag | Fusion constructs and use of same to produce antibodies with increased fc receptor binding affinity and effector function |
| US6797514B2 (en) | 2000-02-24 | 2004-09-28 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US20050052630A1 (en) | 2002-03-07 | 2005-03-10 | Advisys, Inc. | Constant current electroporation device and methods of use |
| US6867041B2 (en) | 2000-02-24 | 2005-03-15 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US20050070841A1 (en) | 2002-07-04 | 2005-03-31 | Inovio As | Electroporation device and injection apparatus |
| US6905680B2 (en) | 1988-11-23 | 2005-06-14 | Genetics Institute, Inc. | Methods of treating HIV infected subjects |
| US6905874B2 (en) | 2000-02-24 | 2005-06-14 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| WO2005061547A2 (en) | 2003-12-22 | 2005-07-07 | Micromet Ag | Bispecific antibodies |
| US20050271615A1 (en) | 2002-08-30 | 2005-12-08 | Doron Shabat | Self-immolative dendrimers releasing many active moieties upon a single activating event |
| WO2005123780A2 (en) | 2004-04-09 | 2005-12-29 | Protein Design Labs, Inc. | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20060034810A1 (en) | 2004-05-27 | 2006-02-16 | The Trustees Of The University Of Pennsylvania | Novel artificial antigen presenting cells and uses therefor |
| US20060116422A1 (en) | 2002-11-14 | 2006-06-01 | De Groot Franciscus Marinus H | Prodrugs built as multiple self-elimination-release spacers |
| US20060121005A1 (en) | 2000-02-24 | 2006-06-08 | Xcyte Therapies, Inc. | Activation and expansion of cells |
| US20060134709A1 (en) | 2004-11-10 | 2006-06-22 | Jeffery Stavenhagen | Engineering Fc antibody regions to confer effector function |
| US7067318B2 (en) | 1995-06-07 | 2006-06-27 | The Regents Of The University Of Michigan | Methods for transfecting T cells |
| WO2006113665A2 (en) | 2005-04-15 | 2006-10-26 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| US7171264B1 (en) | 1999-05-10 | 2007-01-30 | Genetronics, Inc. | Intradermal delivery of active agents by needle-free injection and electroporation |
| US7173116B2 (en) | 2000-03-03 | 2007-02-06 | Genetronics Biomedical Corporation | Nucleic acid formulations for gene delivery and methods of use |
| US7175843B2 (en) | 1994-06-03 | 2007-02-13 | Genetics Institute, Llc | Methods for selectively stimulating proliferation of T cells |
| US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US7223837B2 (en) | 2001-03-23 | 2007-05-29 | Syntarga B.V. | Elongated and multiple spacers in activatible prodrugs |
| US20070128708A1 (en) | 2005-12-07 | 2007-06-07 | Genetronics, Inc. | Variable volume electroporation chamber and methods therefore |
| WO2007089149A2 (en) | 2006-02-02 | 2007-08-09 | Syntarga B.V. | Water-soluble cc-1065 analogs and their conjugates |
| US20070280931A1 (en) | 1998-11-18 | 2007-12-06 | Chen Yvonne M | Antibody variants |
| WO2008119567A2 (en) | 2007-04-03 | 2008-10-09 | Micromet Ag | Cross-species-specific cd3-epsilon binding domain |
| WO2008157379A2 (en) | 2007-06-21 | 2008-12-24 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| WO2009073445A2 (en) | 2007-11-28 | 2009-06-11 | Mersana Therapeutics, Inc. | Biocompatible biodegradable fumagillin analog conjugates |
| WO2009080252A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080251A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080253A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080254A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2010068795A2 (en) | 2008-12-12 | 2010-06-17 | Pearson Robert M | Method and system for tissue treatment utilizing irreversible electroporation and thermal track coagulation |
| WO2010080538A1 (en) | 2008-12-19 | 2010-07-15 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2010138719A1 (en) | 2009-05-28 | 2010-12-02 | Mersana Therapeutics, Inc. | Polyal drug conjugates comprising variable rate-releasing linkers |
| US20110183893A1 (en) | 2009-12-31 | 2011-07-28 | Avidbiotics Corporation | Non-natural mic proteins |
| US7989434B2 (en) | 2004-02-23 | 2011-08-02 | Seattle Genetics, Inc. | Heterocyclic self-immolative linkers and conjugates |
| WO2011120053A1 (en) | 2010-03-26 | 2011-09-29 | Mersana Therapeutics, Inc. | Modified polymers for delivery of polynucleotides, method of manufacture, and methods of use thereof |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| US20110311561A1 (en) | 2009-12-31 | 2011-12-22 | Avidbiotics Corp. | Non-natural mic proteins |
| WO2012130831A1 (en) | 2011-03-29 | 2012-10-04 | Roche Glycart Ag | Antibody fc variants |
| WO2012153193A2 (en) | 2011-05-08 | 2012-11-15 | Legochem Biosciences, Inc. | Protein-active agent conjugates and method for preparing the same |
| WO2013026833A1 (en) | 2011-08-23 | 2013-02-28 | Roche Glycart Ag | Bispecific t cell activating antigen binding molecules |
| US8455622B2 (en) | 2006-12-01 | 2013-06-04 | Seattle Genetics, Inc. | Variant target binding agents and uses thereof |
| WO2013085925A1 (en) | 2011-12-05 | 2013-06-13 | Igenica, Inc. | Antibody-drug conjugates and related compounds, compositions, and methods |
| WO2013096901A1 (en) | 2011-12-23 | 2013-06-27 | Mersana Therapeutics, Inc. | Pharmaceutical formulations for fumagillin derivative-phf conjugates |
| US8535678B2 (en) | 2003-02-20 | 2013-09-17 | Seattle Genetics, Inc. | Anti-CD70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders |
| US8568728B2 (en) | 2005-07-18 | 2013-10-29 | Seattle Genetics, Inc. | Beta-glucuronide-linker drug conjugates |
| US20130309256A1 (en) | 2012-05-15 | 2013-11-21 | Seattle Genetics, Inc. | Self-stabilizing linker conjugates |
| WO2014008375A1 (en) | 2012-07-05 | 2014-01-09 | Mersana Therapeutics, Inc. | Terminally modified polymers and conjugates thereof |
| WO2014093394A1 (en) | 2012-12-10 | 2014-06-19 | Mersana Therapeutics, Inc. | Protein-polymer-drug conjugates |
| WO2014093640A1 (en) | 2012-12-12 | 2014-06-19 | Mersana Therapeutics,Inc. | Hydroxy-polmer-drug-protein conjugates |
| WO2014093379A1 (en) | 2012-12-10 | 2014-06-19 | Mersana Therapeutics, Inc. | Auristatin compounds and conjugates thereof |
| WO2015057065A1 (en) | 2013-10-14 | 2015-04-23 | Synaffix B.V. | Glycoengineered antibody, antibody-conjugate and methods for their preparation |
| WO2015057064A1 (en) | 2013-10-14 | 2015-04-23 | Synaffix B.V. | Modified glycoprotein, protein-conjugate and process for the preparation thereof |
| WO2015057063A1 (en) | 2013-10-14 | 2015-04-23 | Synaffix B.V. | Modified glycoprotein, protein-conjugate and process for the preparation thereof |
| WO2015057066A1 (en) | 2013-10-14 | 2015-04-23 | Synaffix B.V. | Glycoengineered antibody, antibody-conjugate and methods for their preparation |
| US20150165065A1 (en) | 2009-12-31 | 2015-06-18 | Avidbiotics Corp. | Non-natural mic proteins |
| WO2015112013A1 (en) | 2014-01-24 | 2015-07-30 | Synaffix B.V. | Process for the attachment of a galnac moiety comprising a (hetero)aryl group to a glcnac moiety, and product obtained thereby |
| WO2015182984A1 (ko) | 2014-05-28 | 2015-12-03 | 주식회사 레고켐 바이오사이언스 | 자가-희생 기를 포함하는 화합물 |
| US20150374848A1 (en) * | 2010-02-04 | 2015-12-31 | Vigilant Biosciences, Inc. | Methods for the Treatment of Head and Neck Squamous Cell Carcinoma |
| WO2016022027A1 (en) | 2014-08-04 | 2016-02-11 | Synaffix B.V. | Process for the modification of a glycoprotein using a βeta-(1,4)-n-acetylgalactosaminyltransferase or a mutant thereof |
| WO2016020309A1 (en) | 2014-08-04 | 2016-02-11 | F. Hoffmann-La Roche Ag | Bispecific t cell activating antigen binding molecules |
| WO2016053107A1 (en) | 2014-10-03 | 2016-04-07 | Synaffix B.V. | Sulfamide linker, conjugates thereof, and methods of preparation |
| WO2016090278A2 (en) | 2014-12-05 | 2016-06-09 | Avidbiotics Corp. | Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands |
| US20160304578A1 (en) | 2014-12-05 | 2016-10-20 | Avidbiotics Corp. | Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands |
| WO2016170186A1 (en) | 2015-04-23 | 2016-10-27 | Synaffix B.V. | PROCESS FOR THE MODIFICATION OF A GLYCOPROTEIN USING A GLYCOSYLTRANSFERASE THAT IS OR IS DERIVED FROM A β(1,4)-N-ACETYLGALACTOSAMINYLTRANSFERASE |
| WO2016182751A1 (en) | 2015-05-08 | 2016-11-17 | Xencor, Inc. | Heterodimeric antibodies that bind cd3 and tumor antigens |
| WO2016187349A1 (en) | 2015-05-18 | 2016-11-24 | Tcr2, Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| WO2017024131A1 (en) | 2015-08-04 | 2017-02-09 | Avidbiotics Corp. | Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands, and non-natural nkg2d ligands that bind non-natural nkg2d receptors |
| WO2017051254A1 (en) | 2015-09-25 | 2017-03-30 | Legochem Biosciences, Inc. | Compositions and methods related to anti-egfr antibody drug conjugates |
| WO2017051249A1 (en) | 2015-09-25 | 2017-03-30 | Legochem Biosciences, Inc. | Compositions and methods related to anti-cd19 antibody drug conjugates |
| WO2017070608A1 (en) | 2015-10-23 | 2017-04-27 | Eureka Therapeutics, Inc. | Antibody/t-cell receptor chimeric constructs and uses thereof |
| WO2017089894A1 (en) | 2015-11-25 | 2017-06-01 | Legochem Biosciences, Inc. | Conjugates comprising peptide groups and methods related thereto |
| WO2017089890A1 (en) | 2015-11-25 | 2017-06-01 | Legochem Biosciences, Inc. | Conjugates comprising self-immolative groups and methods related thereto |
| WO2017089895A1 (en) | 2015-11-25 | 2017-06-01 | Legochem Biosciences, Inc. | Antibody-drug conjugates comprising branched linkers and methods related thereto |
| WO2017137423A1 (en) | 2016-02-08 | 2017-08-17 | Synaffix B.V. | Improved sulfamide linkers for use in bioconjugates |
| WO2017137456A1 (en) | 2016-02-08 | 2017-08-17 | Synaffix B.V. | Bioconjugates containing sulfamide linkers for use in treatment |
| WO2017137457A1 (en) | 2016-02-08 | 2017-08-17 | Synaffix B.V. | Antibody-conjugates with improved therapeutic index for targeting cd30 tumours and method for improving therapeutic index of antibody-conjugates |
| US9783591B2 (en) | 2012-02-22 | 2017-10-10 | The Trustees Of The University Of Pennsylvania | Use of the CD2 signaling domain in second-generation chimeric antigen receptors |
| WO2017222556A2 (en) | 2016-06-24 | 2017-12-28 | Avidbiotics Corp. | Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands |
| WO2018026953A1 (en) | 2016-08-02 | 2018-02-08 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| WO2018182341A1 (ko) | 2017-03-29 | 2018-10-04 | 주식회사 레고켐 바이오사이언스 | 피롤로벤조디아제핀 이량체 전구체 및 이의 리간드-링커 접합체 화합물 |
| WO2019191243A1 (en) | 2018-03-27 | 2019-10-03 | Xyphos Biosciences Inc. | Modified a1-a2 domains of non-natural nkg2d ligands that bind non-natural nkg2d receptors |
| US20190328899A1 (en) | 2016-12-23 | 2019-10-31 | Heidelberg Pharma Research Gmbh | Amanitin antibody conjugates |
| WO2019222275A2 (en) | 2018-05-14 | 2019-11-21 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using inducible fusion proteins |
| WO2020029774A1 (zh) | 2018-08-08 | 2020-02-13 | 华夏英泰(北京)生物技术有限公司 | 一种嵌合t细胞受体star及其应用 |
| WO2020141923A2 (ko) | 2019-01-03 | 2020-07-09 | 주식회사 레고켐 바이오사이언스 | 안전성이 향상된 피롤로벤조디아제핀 이량체 화합물 및 이의 용도 |
| WO2020222573A1 (ko) | 2019-05-02 | 2020-11-05 | 주식회사 레고켐 바이오사이언스 | 트리스 구조를 가지는 링커를 포함하는 리간드-약물 접합체 |
| WO2020236964A1 (en) | 2019-05-20 | 2020-11-26 | The Trustees Of The University Of Pennsylvania | Engineered expression of cell surface and secreted sialidase by car t cells for increased efficacy in solid tumors |
| US20210077571A1 (en) | 2018-04-13 | 2021-03-18 | Heidelberg Pharma Research Gmbh | Targeted amatoxin conjugate for the treatment of solid tumors |
| WO2021137646A1 (ko) | 2019-12-31 | 2021-07-08 | 주식회사 레고켐바이오사이언스 | 피롤로벤조디아제핀 유도체 및 이의 리간드-링커 접합체 |
| US20210214806A1 (en) | 2019-03-01 | 2021-07-15 | Mercy Bioanalytics, Inc. | Systems, compositions, and methods for target entity detection |
| WO2021178896A1 (en) * | 2020-03-06 | 2021-09-10 | Go Therapeutics, Inc. | Anti-glyco-cd44 antibodies and their uses |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN105169402B (zh) * | 2015-05-28 | 2018-03-16 | 中山大学孙逸仙纪念医院 | 靶向免疫治疗胰腺癌的载药纳米微粒及其应用 |
| CN107441505A (zh) * | 2017-09-11 | 2017-12-08 | 东南大学 | 一种靶向磁性纳米脂质体及其制备方法 |
-
2022
- 2022-03-04 EP EP22712699.2A patent/EP4301782A1/en active Pending
- 2022-03-04 JP JP2023553521A patent/JP2024512324A/ja active Pending
- 2022-03-04 WO PCT/US2022/018863 patent/WO2022187591A1/en not_active Ceased
- 2022-03-04 US US18/548,772 patent/US20250326855A1/en active Pending
Patent Citations (168)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| US4634665A (en) | 1980-02-25 | 1987-01-06 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4399216A (en) | 1980-02-25 | 1983-08-16 | The Trustees Of Columbia University | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US5179017A (en) | 1980-02-25 | 1993-01-12 | The Trustees Of Columbia University In The City Of New York | Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4510245A (en) | 1982-11-18 | 1985-04-09 | Chiron Corporation | Adenovirus promoter system |
| US4816397A (en) | 1983-03-25 | 1989-03-28 | Celltech, Limited | Multichain polypeptides or proteins and processes for their production |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| US4968615A (en) | 1985-12-18 | 1990-11-06 | Ciba-Geigy Corporation | Deoxyribonucleic acid segment from a virus |
| EP0239400A2 (en) | 1986-03-27 | 1987-09-30 | Medical Research Council | Recombinant antibodies and methods for their production |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| WO1989012624A2 (en) | 1988-06-14 | 1989-12-28 | Cetus Corporation | Coupling agents and sterically hindered disulfide linked conjugates prepared therefrom |
| US5883223A (en) | 1988-11-23 | 1999-03-16 | Gray; Gary S. | CD9 antigen peptides and antibodies thereto |
| US6887466B2 (en) | 1988-11-23 | 2005-05-03 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US6905680B2 (en) | 1988-11-23 | 2005-06-14 | Genetics Institute, Inc. | Methods of treating HIV infected subjects |
| US6534055B1 (en) | 1988-11-23 | 2003-03-18 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US7144575B2 (en) | 1988-11-23 | 2006-12-05 | The Regents Of The University Of Michigan | Methods for selectively stimulating proliferation of T cells |
| US7232566B2 (en) | 1988-11-23 | 2007-06-19 | The United States As Represented By The Secretary Of The Navy | Methods for treating HIV infected subjects |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| WO1991009967A1 (en) | 1989-12-21 | 1991-07-11 | Celltech Limited | Humanised antibodies |
| US5939598A (en) | 1990-01-12 | 1999-08-17 | Abgenix, Inc. | Method of making transgenic mice lacking endogenous heavy chains |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| WO1992001047A1 (en) | 1990-07-10 | 1992-01-23 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| EP0519596A1 (en) | 1991-05-17 | 1992-12-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| US6054297A (en) | 1991-06-14 | 2000-04-25 | Genentech, Inc. | Humanized antibodies and methods for making them |
| US5658570A (en) | 1991-07-25 | 1997-08-19 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| US5681722A (en) | 1991-07-25 | 1997-10-28 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| US5693780A (en) | 1991-07-25 | 1997-12-02 | Idec Pharmaceuticals Corporation | Recombinant antibodies for human therapy |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5858358A (en) | 1992-04-07 | 1999-01-12 | The United States Of America As Represented By The Secretary Of The Navy | Methods for selectively stimulating proliferation of T cells |
| EP0592106A1 (en) | 1992-09-09 | 1994-04-13 | Immunogen Inc | Resurfacing of rodent antibodies |
| US5993434A (en) | 1993-04-01 | 1999-11-30 | Genetronics, Inc. | Method of treatment using electroporation mediated delivery of drugs and genes |
| US6567694B2 (en) | 1993-04-01 | 2003-05-20 | Genetronics, Inc. | Needle electrodes for mediated delivery of drugs and genes |
| US6905681B1 (en) | 1994-06-03 | 2005-06-14 | Genetics Institute, Inc. | Methods for selectively stimulating proliferation of T cells |
| US7175843B2 (en) | 1994-06-03 | 2007-02-13 | Genetics Institute, Llc | Methods for selectively stimulating proliferation of T cells |
| US6352694B1 (en) | 1994-06-03 | 2002-03-05 | Genetics Institute, Inc. | Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells |
| US7695936B2 (en) | 1995-03-01 | 2010-04-13 | Genentech, Inc. | Knobs and holes heteromeric polypeptides |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US7172869B2 (en) | 1995-05-04 | 2007-02-06 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US6692964B1 (en) | 1995-05-04 | 2004-02-17 | The United States Of America As Represented By The Secretary Of The Navy | Methods for transfecting T cells |
| US7067318B2 (en) | 1995-06-07 | 2006-06-27 | The Regents Of The University Of Michigan | Methods for transfecting T cells |
| US5834597A (en) | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US20040092907A1 (en) | 1997-04-03 | 2004-05-13 | Inovio As | Method for muscle delivery of drugs, nucleic acids and other compounds |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US6241701B1 (en) | 1997-08-01 | 2001-06-05 | Genetronics, Inc. | Apparatus for electroporation mediated delivery of drugs and genes |
| US6233482B1 (en) | 1997-08-01 | 2001-05-15 | Genetronics, Inc. | Method of electroporation mediated delivery of drugs and genes |
| US6516223B2 (en) | 1997-08-01 | 2003-02-04 | Genetronics, Inc. | Apparatus for electroporation mediated delivery for drugs and genes |
| US6181964B1 (en) | 1997-08-01 | 2001-01-30 | Genetronics, Inc. | Minimally invasive apparatus and method to electroporate drugs and genes into tissue |
| WO1999054342A1 (en) | 1998-04-20 | 1999-10-28 | Pablo Umana | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| US6678556B1 (en) | 1998-07-13 | 2004-01-13 | Genetronics, Inc. | Electrical field therapy with reduced histopathological change in muscle |
| US20070280931A1 (en) | 1998-11-18 | 2007-12-06 | Chen Yvonne M | Antibody variants |
| US7171264B1 (en) | 1999-05-10 | 2007-01-30 | Genetronics, Inc. | Intradermal delivery of active agents by needle-free injection and electroporation |
| US20060121005A1 (en) | 2000-02-24 | 2006-06-08 | Xcyte Therapies, Inc. | Activation and expansion of cells |
| US6867041B2 (en) | 2000-02-24 | 2005-03-15 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6905874B2 (en) | 2000-02-24 | 2005-06-14 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US6797514B2 (en) | 2000-02-24 | 2004-09-28 | Xcyte Therapies, Inc. | Simultaneous stimulation and concentration of cells |
| US7173116B2 (en) | 2000-03-03 | 2007-02-06 | Genetronics Biomedical Corporation | Nucleic acid formulations for gene delivery and methods of use |
| US7223837B2 (en) | 2001-03-23 | 2007-05-29 | Syntarga B.V. | Elongated and multiple spacers in activatible prodrugs |
| CA2443437A1 (en) * | 2001-05-18 | 2002-11-28 | Boehringer Ingelheim International Gmbh | Antibodies specific for cd44v6 |
| WO2003011878A2 (en) | 2001-08-03 | 2003-02-13 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| US20040101519A1 (en) | 2002-01-03 | 2004-05-27 | The Trustees Of The University Of Pennsylvania | Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool |
| US20050052630A1 (en) | 2002-03-07 | 2005-03-10 | Advisys, Inc. | Constant current electroporation device and methods of use |
| US20040014645A1 (en) | 2002-05-28 | 2004-01-22 | Advisys, Inc. | Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system |
| US20050070841A1 (en) | 2002-07-04 | 2005-03-31 | Inovio As | Electroporation device and injection apparatus |
| US20040059285A1 (en) | 2002-07-04 | 2004-03-25 | Inovio As | Electroporation device and injection apparatus |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US20050271615A1 (en) | 2002-08-30 | 2005-12-08 | Doron Shabat | Self-immolative dendrimers releasing many active moieties upon a single activating event |
| US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20060116422A1 (en) | 2002-11-14 | 2006-06-01 | De Groot Franciscus Marinus H | Prodrugs built as multiple self-elimination-release spacers |
| WO2004065540A2 (en) | 2003-01-22 | 2004-08-05 | Glycart Biotechnology Ag | Fusion constructs and use of same to produce antibodies with increased fc receptor binding affinity and effector function |
| US8535678B2 (en) | 2003-02-20 | 2013-09-17 | Seattle Genetics, Inc. | Anti-CD70 antibody-drug conjugates and their use for the treatment of cancer and immune disorders |
| WO2005061547A2 (en) | 2003-12-22 | 2005-07-07 | Micromet Ag | Bispecific antibodies |
| US7989434B2 (en) | 2004-02-23 | 2011-08-02 | Seattle Genetics, Inc. | Heterocyclic self-immolative linkers and conjugates |
| WO2005123780A2 (en) | 2004-04-09 | 2005-12-29 | Protein Design Labs, Inc. | Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis |
| US20060034810A1 (en) | 2004-05-27 | 2006-02-16 | The Trustees Of The University Of Pennsylvania | Novel artificial antigen presenting cells and uses therefor |
| US7521541B2 (en) | 2004-09-23 | 2009-04-21 | Genetech Inc. | Cysteine engineered antibodies and conjugates |
| US7855275B2 (en) | 2004-09-23 | 2010-12-21 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| US20060134709A1 (en) | 2004-11-10 | 2006-06-22 | Jeffery Stavenhagen | Engineering Fc antibody regions to confer effector function |
| WO2006113665A2 (en) | 2005-04-15 | 2006-10-26 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| US8568728B2 (en) | 2005-07-18 | 2013-10-29 | Seattle Genetics, Inc. | Beta-glucuronide-linker drug conjugates |
| US20070128708A1 (en) | 2005-12-07 | 2007-06-07 | Genetronics, Inc. | Variable volume electroporation chamber and methods therefore |
| WO2007089149A2 (en) | 2006-02-02 | 2007-08-09 | Syntarga B.V. | Water-soluble cc-1065 analogs and their conjugates |
| US8455622B2 (en) | 2006-12-01 | 2013-06-04 | Seattle Genetics, Inc. | Variant target binding agents and uses thereof |
| WO2008119567A2 (en) | 2007-04-03 | 2008-10-09 | Micromet Ag | Cross-species-specific cd3-epsilon binding domain |
| WO2008157379A2 (en) | 2007-06-21 | 2008-12-24 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2009073445A2 (en) | 2007-11-28 | 2009-06-11 | Mersana Therapeutics, Inc. | Biocompatible biodegradable fumagillin analog conjugates |
| WO2009080252A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080253A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080251A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009080254A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2010068795A2 (en) | 2008-12-12 | 2010-06-17 | Pearson Robert M | Method and system for tissue treatment utilizing irreversible electroporation and thermal track coagulation |
| WO2010080538A1 (en) | 2008-12-19 | 2010-07-15 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2010138719A1 (en) | 2009-05-28 | 2010-12-02 | Mersana Therapeutics, Inc. | Polyal drug conjugates comprising variable rate-releasing linkers |
| US20110183893A1 (en) | 2009-12-31 | 2011-07-28 | Avidbiotics Corporation | Non-natural mic proteins |
| US20110311561A1 (en) | 2009-12-31 | 2011-12-22 | Avidbiotics Corp. | Non-natural mic proteins |
| US20150165065A1 (en) | 2009-12-31 | 2015-06-18 | Avidbiotics Corp. | Non-natural mic proteins |
| US20150374848A1 (en) * | 2010-02-04 | 2015-12-31 | Vigilant Biosciences, Inc. | Methods for the Treatment of Head and Neck Squamous Cell Carcinoma |
| WO2011120053A1 (en) | 2010-03-26 | 2011-09-29 | Mersana Therapeutics, Inc. | Modified polymers for delivery of polynucleotides, method of manufacture, and methods of use thereof |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2012130831A1 (en) | 2011-03-29 | 2012-10-04 | Roche Glycart Ag | Antibody fc variants |
| WO2012153193A2 (en) | 2011-05-08 | 2012-11-15 | Legochem Biosciences, Inc. | Protein-active agent conjugates and method for preparing the same |
| WO2013026833A1 (en) | 2011-08-23 | 2013-02-28 | Roche Glycart Ag | Bispecific t cell activating antigen binding molecules |
| WO2013085925A1 (en) | 2011-12-05 | 2013-06-13 | Igenica, Inc. | Antibody-drug conjugates and related compounds, compositions, and methods |
| WO2013096901A1 (en) | 2011-12-23 | 2013-06-27 | Mersana Therapeutics, Inc. | Pharmaceutical formulations for fumagillin derivative-phf conjugates |
| US9783591B2 (en) | 2012-02-22 | 2017-10-10 | The Trustees Of The University Of Pennsylvania | Use of the CD2 signaling domain in second-generation chimeric antigen receptors |
| US20130309256A1 (en) | 2012-05-15 | 2013-11-21 | Seattle Genetics, Inc. | Self-stabilizing linker conjugates |
| WO2014008375A1 (en) | 2012-07-05 | 2014-01-09 | Mersana Therapeutics, Inc. | Terminally modified polymers and conjugates thereof |
| WO2014093394A1 (en) | 2012-12-10 | 2014-06-19 | Mersana Therapeutics, Inc. | Protein-polymer-drug conjugates |
| WO2014093379A1 (en) | 2012-12-10 | 2014-06-19 | Mersana Therapeutics, Inc. | Auristatin compounds and conjugates thereof |
| WO2014093640A1 (en) | 2012-12-12 | 2014-06-19 | Mersana Therapeutics,Inc. | Hydroxy-polmer-drug-protein conjugates |
| WO2015057066A1 (en) | 2013-10-14 | 2015-04-23 | Synaffix B.V. | Glycoengineered antibody, antibody-conjugate and methods for their preparation |
| WO2015057063A1 (en) | 2013-10-14 | 2015-04-23 | Synaffix B.V. | Modified glycoprotein, protein-conjugate and process for the preparation thereof |
| WO2015057064A1 (en) | 2013-10-14 | 2015-04-23 | Synaffix B.V. | Modified glycoprotein, protein-conjugate and process for the preparation thereof |
| WO2015057065A1 (en) | 2013-10-14 | 2015-04-23 | Synaffix B.V. | Glycoengineered antibody, antibody-conjugate and methods for their preparation |
| WO2015112013A1 (en) | 2014-01-24 | 2015-07-30 | Synaffix B.V. | Process for the attachment of a galnac moiety comprising a (hetero)aryl group to a glcnac moiety, and product obtained thereby |
| WO2015182984A1 (ko) | 2014-05-28 | 2015-12-03 | 주식회사 레고켐 바이오사이언스 | 자가-희생 기를 포함하는 화합물 |
| WO2016022027A1 (en) | 2014-08-04 | 2016-02-11 | Synaffix B.V. | Process for the modification of a glycoprotein using a βeta-(1,4)-n-acetylgalactosaminyltransferase or a mutant thereof |
| WO2016020309A1 (en) | 2014-08-04 | 2016-02-11 | F. Hoffmann-La Roche Ag | Bispecific t cell activating antigen binding molecules |
| WO2016053107A1 (en) | 2014-10-03 | 2016-04-07 | Synaffix B.V. | Sulfamide linker, conjugates thereof, and methods of preparation |
| WO2016090278A2 (en) | 2014-12-05 | 2016-06-09 | Avidbiotics Corp. | Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands |
| US20160304578A1 (en) | 2014-12-05 | 2016-10-20 | Avidbiotics Corp. | Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands |
| WO2016170186A1 (en) | 2015-04-23 | 2016-10-27 | Synaffix B.V. | PROCESS FOR THE MODIFICATION OF A GLYCOPROTEIN USING A GLYCOSYLTRANSFERASE THAT IS OR IS DERIVED FROM A β(1,4)-N-ACETYLGALACTOSAMINYLTRANSFERASE |
| WO2016182751A1 (en) | 2015-05-08 | 2016-11-17 | Xencor, Inc. | Heterodimeric antibodies that bind cd3 and tumor antigens |
| WO2016187349A1 (en) | 2015-05-18 | 2016-11-24 | Tcr2, Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| WO2017024131A1 (en) | 2015-08-04 | 2017-02-09 | Avidbiotics Corp. | Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands, and non-natural nkg2d ligands that bind non-natural nkg2d receptors |
| WO2017051249A1 (en) | 2015-09-25 | 2017-03-30 | Legochem Biosciences, Inc. | Compositions and methods related to anti-cd19 antibody drug conjugates |
| WO2017051254A1 (en) | 2015-09-25 | 2017-03-30 | Legochem Biosciences, Inc. | Compositions and methods related to anti-egfr antibody drug conjugates |
| WO2017070608A1 (en) | 2015-10-23 | 2017-04-27 | Eureka Therapeutics, Inc. | Antibody/t-cell receptor chimeric constructs and uses thereof |
| WO2017089894A1 (en) | 2015-11-25 | 2017-06-01 | Legochem Biosciences, Inc. | Conjugates comprising peptide groups and methods related thereto |
| WO2017089895A1 (en) | 2015-11-25 | 2017-06-01 | Legochem Biosciences, Inc. | Antibody-drug conjugates comprising branched linkers and methods related thereto |
| WO2017089890A1 (en) | 2015-11-25 | 2017-06-01 | Legochem Biosciences, Inc. | Conjugates comprising self-immolative groups and methods related thereto |
| WO2017137423A1 (en) | 2016-02-08 | 2017-08-17 | Synaffix B.V. | Improved sulfamide linkers for use in bioconjugates |
| WO2017137456A1 (en) | 2016-02-08 | 2017-08-17 | Synaffix B.V. | Bioconjugates containing sulfamide linkers for use in treatment |
| WO2017137457A1 (en) | 2016-02-08 | 2017-08-17 | Synaffix B.V. | Antibody-conjugates with improved therapeutic index for targeting cd30 tumours and method for improving therapeutic index of antibody-conjugates |
| WO2017222556A2 (en) | 2016-06-24 | 2017-12-28 | Avidbiotics Corp. | Insertable variable fragments of antibodies and modified a1-a2 domains of nkg2d ligands |
| WO2018026953A1 (en) | 2016-08-02 | 2018-02-08 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
| US20190328899A1 (en) | 2016-12-23 | 2019-10-31 | Heidelberg Pharma Research Gmbh | Amanitin antibody conjugates |
| WO2018182341A1 (ko) | 2017-03-29 | 2018-10-04 | 주식회사 레고켐 바이오사이언스 | 피롤로벤조디아제핀 이량체 전구체 및 이의 리간드-링커 접합체 화합물 |
| WO2019191243A1 (en) | 2018-03-27 | 2019-10-03 | Xyphos Biosciences Inc. | Modified a1-a2 domains of non-natural nkg2d ligands that bind non-natural nkg2d receptors |
| US20210077571A1 (en) | 2018-04-13 | 2021-03-18 | Heidelberg Pharma Research Gmbh | Targeted amatoxin conjugate for the treatment of solid tumors |
| WO2019222275A2 (en) | 2018-05-14 | 2019-11-21 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using inducible fusion proteins |
| WO2020029774A1 (zh) | 2018-08-08 | 2020-02-13 | 华夏英泰(北京)生物技术有限公司 | 一种嵌合t细胞受体star及其应用 |
| WO2020141923A2 (ko) | 2019-01-03 | 2020-07-09 | 주식회사 레고켐 바이오사이언스 | 안전성이 향상된 피롤로벤조디아제핀 이량체 화합물 및 이의 용도 |
| US20210214806A1 (en) | 2019-03-01 | 2021-07-15 | Mercy Bioanalytics, Inc. | Systems, compositions, and methods for target entity detection |
| WO2020222573A1 (ko) | 2019-05-02 | 2020-11-05 | 주식회사 레고켐 바이오사이언스 | 트리스 구조를 가지는 링커를 포함하는 리간드-약물 접합체 |
| WO2020236964A1 (en) | 2019-05-20 | 2020-11-26 | The Trustees Of The University Of Pennsylvania | Engineered expression of cell surface and secreted sialidase by car t cells for increased efficacy in solid tumors |
| WO2021137646A1 (ko) | 2019-12-31 | 2021-07-08 | 주식회사 레고켐바이오사이언스 | 피롤로벤조디아제핀 유도체 및 이의 리간드-링커 접합체 |
| WO2021178896A1 (en) * | 2020-03-06 | 2021-09-10 | Go Therapeutics, Inc. | Anti-glyco-cd44 antibodies and their uses |
Non-Patent Citations (136)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1989, GREENE PUBLISHING ASSOCIATES |
| "Monoclonal Antibodies For Cancer Detection And Therapy", 1985, ACADEMIC PRESS, article "Analysis, Results, and Future Prospective of the Therapeutic Use of Radiolabeled Antibody In Cancer Therapy" |
| "Solid Phase Peptide Synthesis", 1984, THE PIERCE CHEMICAL CO. |
| AI-LAZIKANI ET AL., J. MOL. BIOL, vol. 273, 1997, pages 927 - 948 |
| AMON ET AL.: "Monoclonal Antibodies And Cancer Therapy", 1985, ALAN R. LISS, INC., article "Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy" |
| AXUP ET AL., PROC NATL ACAD SCI USA., vol. 109, no. 40, 2012, pages 16101 - 16106 |
| BADESCU ET AL., BIOCONJUGATE CHEM, vol. 25, 2014, pages 1124 - 1136 |
| BAEUERLE ET AL., DRUGS OF THE FUTURE, vol. 33, 2008, pages 137 - 147 |
| BARGOU ET AL., SCIENCE, vol. 321, 2008, pages 974 - 977 |
| BERG ET AL., TRANSPLANT PROC, vol. 30, no. 8, 1998, pages 3975 - 3977 |
| BIERER ET AL., CURR. OPIN. IMMUN., vol. 5, 1993, pages 763 - 773 |
| BIN HOU ET AL., DIS MARKERS, ARTICLE ID 3425291, 2019 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BORJESSON ET AL., CLIN CANCER RES, vol. 9, no. 10, 2003, pages 3961S - 72S |
| BRENTJENS ET AL., SCI TRANSL MED, vol. 5, no. 177, 2013, pages 177ra38 - 177ra38 |
| BURKE ET AL., BIOCONJUGATE CHEM, vol. 20, 2009, pages 1242 - 1250 |
| CANFIELDMORRISON, J. EXP. MED., vol. 173, 1991, pages 1483 - 1491 |
| CARTER, J, IMMUNOL METH, vol. 248, 2001, pages 7 - 15 |
| CAS , no. 110417-88-4 |
| CAS , no. 125317397 |
| CAS, no. 745017-94-1 |
| CAS, no. 914382608 |
| CHARI, ACC CHEM RES, vol. 41, 2008, pages 98 - 107 |
| CHEN CHEN ET AL: "The biology and role of CD44 in cancer progression: therapeutic implications", JOURNAL OF HEMATOLOGY & ONCOLOGY, vol. 11, no. 1, 1 December 2018 (2018-12-01), XP055822049, Retrieved from the Internet <URL:https://jhoonline.biomedcentral.com/track/pdf/10.1186/s13045-018-0605-5.pdf> DOI: 10.1186/s13045-018-0605-5 * |
| CHEN ET AL., J HEMATOL ONCOL, vol. 11, no. 1, 2018, pages 64 |
| CHU ET AL., BIOCHEMIA, no. 2, 2001 |
| COX ET AL., EUR. J. IMMUNOL., vol. 24, 1994, pages 827 - 836 |
| DAVIS ET AL., PROTEIN ENG DES SEL, vol. 23, 2010, pages 195 - 202 |
| DUBOWCHIK ET AL., BIOORG. MED. CHEM. LETT., vol. 8, no. 21, 1998, pages 3341 - 3346 |
| DUBOWCHIK ET AL., J. ORG. CHEM., vol. 67, 1998, pages 1866 - 1872 |
| DUCRY ET AL., BIOCONJUGATE CHEM, vol. 21, 2010, pages 5 - 13 |
| FERRARA ET AL., BIOTECHN BIOENG, vol. 93, 2006, pages 851 - 861 |
| FISCHER ET AL., NATURE COMMUN, vol. 6, 2015, pages 6113 |
| FISHER: "Laboratory Techniques In Biochemistry And Molecular Biology", 1980, ELSEVIER |
| FRANCISCO ET AL., BLOOD, vol. 102, 2003, pages 1458 - 1465 |
| GARLAND ET AL., J. IMMUNOL METH., vol. 227, no. 1-2, 1999, pages 53 - 63 |
| GILLIES ET AL., J. IMMUNOL. METHODS, vol. 125, 1985, pages 191 - 202 |
| GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS, pages: 185 |
| GOODISON ET AL., MOL PATHOL, vol. 52, no. 4, 1999, pages 189 - 196 |
| GROOT ET AL., ANGEW. CHEM. INT. ED., vol. 42, 2003, pages 4494 - 4499 |
| GRUPP ET AL., N ENGL J MED, vol. 368, no. 16, 2013, pages 1509 - 1518 |
| GU ET AL., PLOS ONE, vol. 10, no. 5, 2015, pages e0124135 |
| GUNASEKARAN ET AL., J BIOL CHEM, vol. 285, no. 25, 2010, pages 19637 - 46 |
| HAANEN ET AL., J. EXP. MED., vol. 190, no. 9, 1999, pages 13191328 |
| HELLSTROM ET AL.: "Controlled Drug Delivery", 1987, MARCEL DEKKER, INC., article "Antibodies For Drug Delivery" |
| HENDERSON ET AL., IMMUN, vol. 73, 1991, pages 316 - 321 |
| HOLLANDER ET AL., BIOCONJUGATE CHEM, vol. 19, 2008, pages 358 - 361 |
| HOLLIGER ET AL., PROC NATL ACAD SCI USA, vol. 90, 1993, pages 6444 - 8 |
| HOU ET AL., DIS MARKERS, vol. 2019, 2019, pages 1 - 11 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| JEFFREY ET AL., BIOCONJUG. CHEM., vol. 17, 2006, pages 831 - 840 |
| JEFFREY ET AL., BIOORG. MED. CHEM. LETT., vol. 17, 2007, pages 2278 - 2280 |
| JESPERS ET AL., BIOTECHNOLOGY, vol. 12, 1988, pages 899 - 903 |
| JIANG ET AL., J. AM. CHEM. SOC., vol. 127, 2005, pages 11254 - 11255 |
| JOHNSON ET AL., MOL BIOL, vol. 399, 2010, pages 436 - 49 |
| JULIEN ET AL., BIOMOLECULES, vol. 2, no. 4, 2012, pages 435 - 466 |
| JUNGPLUCKTHUN, PROTEIN ENGINEERING, vol. 10, no. 9, 1997, pages 959 - 966 |
| KALOS ET AL., SCI TRANSL MED, vol. 3, no. 95, 2011, pages 95ra73 - 95ra73 |
| KAUFMANSHARP, MOL. BIOL., vol. 159, 1982, pages 601 - 621 |
| KING ET AL., BLOOD ADV, vol. 1, no. 7, 2017, pages 429 - 442 |
| KING ET AL., J MED CHEM, vol. 45, 2002, pages 4336 - 4343 |
| KING ET AL., TETRAHEDRON LETTERS, vol. 43, 2002, pages 1987 - 1990 |
| KIPRIYANOV ET AL., MOL BIOL, vol. 293, 1999, pages 41 - 56 |
| KITSON ET AL., CROS/CMOS--CHEMICA OGGI--CHEMISTRY TODAY, vol. 31, no. 4, 2013, pages 30 - 38 |
| KLEIN ET AL., MABS, vol. 8, no. 6, 2016, pages 1010 - 1020 |
| KOCHENDERFER ET AL., BLOOD, vol. 116, no. 20, 2010, pages 4099 - 4102 |
| KOHLERMILSTEIN, NATURE, vol. 256, 1975, pages 495 - 497 |
| LABRIJN ET AL., NAT PROTOC, vol. 9, no. 10, 2014, pages 2450 - 63 |
| LABRIJN ET AL., PROC NATL ACAD SCI USA, vol. 110, 2013, pages 5145 - 50 |
| LEFRANC ET AL., DEV COMPARAT IMMUNOL, vol. 27, 2003, pages 55 - 77 |
| LI ET AL., CELL RES, vol. 25, 2015, pages 981 - 984 |
| LIU ET AL., CELL, vol. 66, 1991, pages 807 - 815 |
| LIU ET AL., FRONT. IMMUNOL., vol. 8, 2017, pages 38 |
| LIU ET AL., SCI TRANSL MED, vol. 13, 2021, pages eabb5191 |
| LOFFLER ET AL., BLOOD, vol. 95, 2000, pages 2098 - 103 |
| LUND ET AL., J. IMMUNOL., vol. 147, 1991, pages 2657 - 2662 |
| LYON ET AL., NATURE BIOTECH |
| MAZOR ET AL., MABS, vol. 7, 2015, pages 377 - 89 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554 |
| METZ ET AL., PROTEIN ENG DES SEL, vol. 25, 2012, pages 571 - 80 |
| MILSTEINCUELLO, NATURE, vol. 305, 1983, pages 537 - 40 |
| MORRISON, SCIENCE, vol. 229, no. 4719, 1985, pages 1202 - 7 |
| MURRAY ET AL., CURRENT OPINION IN CHEMICAL BIOLOGY, vol. 17, 2013, pages 420 - 426 |
| NOLTING, ANTIBODY-DRUG CONJUGATES, METHODS IN MOLECULAR BIOLOGY, vol. 1045, 2013, pages 71 - 100 |
| NOLTING: "Antibody-Drug Conjugates: Methods in Molecular Biology", vol. 1045, 2013, SPRINGER SCIENCE & BUSINESS MEDICA, LLC, article "Linker Technology in Antibody-Drug Conjugates", pages: 71 - 100 |
| NOOIJ ET AL., EUR J IMMUNOL, vol. 19, 1986, pages 981 - 984 |
| OI ET AL., BIOTECHNIQUES, vol. 4, 1986, pages 214 - 221 |
| PADLAN, MOL. IMMUNOL., vol. 28, 1991, pages 489 - 498 |
| PENG YING ET AL: "Targeting aggressive prostate cancer-associated CD44v6 using phage display selected peptides", ONCOTARGET, vol. 8, no. 49, 17 October 2017 (2017-10-17), pages 86747 - 86768, XP055826688, DOI: 10.18632/oncotarget.21421 * |
| PESSANO ET AL., EMBO J, vol. 4, 1985, pages 337 - 340 |
| PORTER ET AL., N ENGL J MED, vol. 365, no. 8, 2011, pages 725 - 733 |
| POSEY ET AL., IMMUNITY, vol. 44, no. 6, 2016, pages 1444 - 1454 |
| PROCHAZKA ET AL., CELL SIGNAL, vol. 26, no. 10, 2014, pages 2234 - 2239 |
| RADHAKRISHNAN ET AL., PROC NATL ACAD SCI, vol. 111, no. 39, 2014, pages E4066 - E4075 |
| RIDGWAY ET AL., PROT ENG, vol. 9, 1996, pages 617 - 621 |
| RIDGWAY ET AL., PROTEIN ENG, vol. 9, 1996, pages 617 - 621 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 7 |
| RIECHMANN, JOURNAL OF IMMUNOLOGICAL METHODS, vol. 231, 1999, pages 25 - 38 |
| RODRIGUES ET AL., INT J CANCER SUPPL, vol. 7, 1992, pages 45 - 50 |
| ROGUSKA ET AL., PROC. NATL. ACAD. SCI., vol. 91, 1994, pages 969 - 973 |
| SCHAEFER ET AL., PROC NATL ACAD SCI USA, vol. 108, 2011, pages 11187 - 92 |
| SCHANZER ET AL., J BIOL CHEM, vol. 289, 2014, pages 18693 - 706 |
| SHAMIS ET AL., J. AM. CHEM. SOC., vol. 126, 2004, pages 1726 - 1731 |
| SHIELDS ET AL., J. BIOL. CHEM., vol. 277, 2002, pages 26733 - 26740 |
| SHINKAWA ET AL., J. BIOL. CHEM., vol. 278, 2003, pages 3466 - 73 |
| SNEATH ET AL., MOL PATHOL, vol. 51, no. 4, 1998, pages 191 - 200 |
| SORENSEN ET AL., GLYCOBIOLOGY, vol. 16, no. 2, 2006, pages 96 - 107 |
| STANLEY, COLD SPRING HARB PERSPECT BIOL, vol. 3, no. 4, 2011 |
| STEENTOFT ET AL., EMBO J., vol. 32, no. 10, pages 1478 - 1488 |
| STEENTOFT ET AL., NAT METHODS, vol. 8, no. 11, 2011, pages 977 - 982 |
| STEINMETZ ET AL., MABS, vol. 8, no. 5, 2016, pages 867 - 78 |
| STROOMER ET AL., CLIN CANCER RES, vol. 6, no. 8, 2000, pages 3046 - 3055 |
| STUBENRAUCH ET AL., DRUG METABOLISM AND DISPOSITION, vol. 38, 2010, pages 84 - 91 |
| STUDNICKA ET AL., PROT. ENG., vol. 7, 1994, pages 805 - 814 |
| SUN ET AL., BIOORGANIC & MEDICINAL CHEMISTRY LETTERS, vol. 12, 2002, pages 2213 - 2215 |
| SUN ET AL., BIOORGANIC & MEDICINAL CHEMISTRY, vol. 11, 2003, pages 1761 - 1768 |
| SUTHERLAND ET AL., BLOOD, vol. 122, 2013, pages 1455 - 1463 |
| THAPA ET AL., STEM CELLS INT, vol. 2016, 2016, pages 1 - 15 |
| THORPE ET AL., IMMUNOL. REV, vol. 62, 1982, pages 119 - 58 |
| THORPE ET AL.: "Monoclonal Antibodies '84: Biological And Clinical Applications", 1985, article "Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review" |
| TIJINK ET AL., CLIN CANCER RES, vol. 12, no. 20, 2006, pages 6064 - 6072 |
| TOMLINSON ET AL., J. MOL. BIOL., vol. 22T, 1992, pages 116 - 198 |
| UMANA ET AL., NAT BIOTECHNOL, vol. 17, 1999, pages 176 - 180 |
| URLAUBCHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220 |
| VAN GEEL ET AL., BIOCONJUGATE CHEM, vol. 26, no. 11, 2015, pages 2233 - 2242 |
| WAHL ET AL., J. NUCL. MED., vol. 24, 1983, pages 316 |
| WALKER ET AL., BIOORG. MED. CHEM. LETT., vol. 12, 2002, pages 217 - 219 |
| WALKER, BIOORG. MED. CHEM. LETT., vol. 14, 2004, pages 4323 - 4327 |
| WANDALL ET AL., CANCER RES, vol. 70, no. 4, 2010, pages 1306 - 1313 |
| WIERNIK ET AL., CLIN CANCER RES, vol. 19, 2013, pages 3844 - 55 |
| WOLFSON, CHEM. BIOL., vol. 13, no. 10, 2006, pages 1011 - 2 |
| WRANIK ET AL., J BIOL CHEM, vol. 287, 2012, pages 43331 - 9 |
| YANEZ-MO ET AL., J EXTRACELL VESICLES, vol. 4, 2015, pages 27066 |
| YANG ET AL., INT. J. MOL. SCI., vol. 18, 2017, pages 48 |
| YAZAKI ET AL., PROTEIN ENG. DES SEL., vol. 17, no. 5, 17 August 2004 (2004-08-17), pages 481 - 9 |
| ZHAO ET AL., J. MED. CHEM., vol. 54, 2011, pages 3606 - 3623 |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4301782A1 (en) | 2024-01-10 |
| US20250326855A1 (en) | 2025-10-23 |
| JP2024512324A (ja) | 2024-03-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230126689A1 (en) | Anti-glyco-cd44 antibodies and their uses | |
| US20250304716A1 (en) | Anti-glyco-muc1 antibodies and their uses | |
| KR102608763B1 (ko) | 항-글리코-muc1 항체 및 이의 용도 | |
| US20250066498A1 (en) | Anti-glyco-lamp1 antibodies and their uses | |
| US20250136701A1 (en) | Anti-glyco-cmet antibodies and their uses | |
| US20250101126A1 (en) | Anti-glyco-muc4 antibodies and their uses | |
| US20250326855A1 (en) | Anti-glyco-cd44 antibodies and their uses | |
| HK40114974A (zh) | 抗糖-muc4抗体及其用途 | |
| CN118354788A (zh) | 抗糖-muc4抗体及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22712699 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2023553521 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022712699 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2022712699 Country of ref document: EP Effective date: 20231005 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWP | Wipo information: published in national office |
Ref document number: 18548772 Country of ref document: US |