WO2022139631A1 - Vaccin à base d'aav5 pour induction d'une immunité spécifique et/ou prévention d'une infection liée au sars-cov-2 - Google Patents

Vaccin à base d'aav5 pour induction d'une immunité spécifique et/ou prévention d'une infection liée au sars-cov-2 Download PDF

Info

Publication number
WO2022139631A1
WO2022139631A1 PCT/RU2021/050447 RU2021050447W WO2022139631A1 WO 2022139631 A1 WO2022139631 A1 WO 2022139631A1 RU 2021050447 W RU2021050447 W RU 2021050447W WO 2022139631 A1 WO2022139631 A1 WO 2022139631A1
Authority
WO
WIPO (PCT)
Prior art keywords
aav5
cov
sars
seq
rbd
Prior art date
Application number
PCT/RU2021/050447
Other languages
English (en)
Inventor
Pavel Mikhailovich GERSHOVICH
Alexander Vladimirovich PROKOFYEV
Anna Nikolaevna STRELKOVA
Natalia Aleksandrovna SPIRINA
Tatiana Evgenievna SHUGAEVA
Pavel Andreevich IAKOVLEV
Dmitry Valentinovich MOROZOV
Original Assignee
Joint Stock Company "Biocad"
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Joint Stock Company "Biocad" filed Critical Joint Stock Company "Biocad"
Publication of WO2022139631A1 publication Critical patent/WO2022139631A1/fr

Links

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/12—Viral antigens
    • A61K39/215—Coronaviridae, e.g. avian infectious bronchitis virus
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C07K14/08—RNA viruses
    • C07K14/165—Coronaviridae, e.g. avian infectious bronchitis virus
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011—Details
    • C12N2750/14011—Parvoviridae
    • C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141—Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/20011—Coronaviridae
    • C12N2770/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/20011—Coronaviridae
    • C12N2770/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • the present application relates to the fields of biotechnology, immunology, virology, genetics, and molecular biology. More specifically, the present invention relates to an isolated codon-optimized nucleic acid encoding an isolated recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2 (severe acute respiratory syndrome-related coronavirus 2), to an expression cassette and a vector based thereon, as well as to an AAV5 (adeno-associated virus serotype 5)-based recombinant virus for the induction of specific immunity to SARS-CoV- 2 and/or prevention of the SARS-CoV-2-related coronavirus infection, to an AAV5-based vaccine for the induction of specific immunity to SARS-CoV-2 and/or prevention of the SARS-CoV-2 - related coronavirus infection, and to their use for the induction of specific immunity to SARS- CoV-2 and/or prevention of the SARS-CoV-2-related coronavirus infection.
  • SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
  • SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
  • SARS-CoV-2 was identified in December 2019 as a result of the analysis of samples taken from patients with pneumonia. On December 31, 2019, the World Health Organization was informed of several cases of viral pneumonia caused by a previously unknown pathogen. The complete genome of the virus was first decoded in China.
  • Coronaviruses which include SARS-CoV-2, typically cause acute respiratory diseases. This family also includes SARS-CoV and MERS-CoV, which cause severe acute respiratory syndrome and Middle East respiratory syndrome, respectively.
  • SARS-CoV-2 is responsible for the ongoing COVID-19 pandemic.
  • the World Health Organization in January 2020 declared the SARS-CoV-2 outbreak a public health emergency of international concern, and on March 11, 2020, it characterized the worldwide spread of the disease as a pandemic.
  • GenBank database Wu F., Severe acute respiratory syndrome coronavirus 2 isolate Wuhan-Hu-1, complete genome, 2020, GenBank: MN908947.3
  • the patent document CN110974950B discloses a vaccine for preventing SARS-CoV-2 infection, wherein the vaccine comprises an Ad5 adenovirus vector comprising a nucleic acid sequence encoding a SARS-CoV-2 antigen peptide.
  • the patent document RU2720614 Cl discloses a vaccine based on recombinant adenovirus serotype 5 and/or 26 particles comprising the S protein gene of SARS-CoV-2.
  • Patent documents RU 2733831C1, RU 2733832C1, RU 2733834 Cl, (Federal Budgetary Institution of Science The State Research Center for Virology and Biotechnology "Vector") provide various variants of an artificial gene used to create a vaccine against the SARS-CoV-2, said gene encoding an artificial protein immunogen that includes sequences of the receptor-binding domain (RBD) of S glycoprotein of SARS-CoV-2.
  • RBD receptor-binding domain
  • the patent document RU 2738081 Cl (Federal Budgetary Institution of Science The State Research Center for Virology and Biotechnology "Vector") provides peptide immunogens and a vaccine composition against COVID-19 coronavirus infection using peptide immunogens.
  • the authors of the invention have developed a codon-optimized nucleic acid that encodes an isolated recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV- 2, which is used as an antigen for effective immunization of mammals with the induction of specific immunity to SARS-CoV-2, which fact will contribute to the prevention of SARS-CoV-2- related diseases.
  • the authors of the invention have also developed a cassette expressing the recombinant receptor-binding domain of S glycoprotein (RBD-S) of SARS-CoV-2, which includes the above codon-optimized nucleic acid.
  • the authors of the invention have also developed a means for delivery of the above antigen to a mammalian organism, in particular, an expression vector that includes a nucleic acid encoding the above antigen, or the above expression cassette, an AAV5 (adeno-associated virus serotype 5)-based recombinant virus comprising the above nucleic acid encoding the above antigen, or the above expression cassette, vaccines comprising the above objects and methods of their use for the induction of specific immunity to SARS-CoV- 2 and/or prevention of SARS-CoV-2-related coronavirus infection.
  • an expression vector that includes a nucleic acid encoding the above antigen, or the above expression cassette, an AAV5 (adeno-associated virus serotype 5)-based recombinant virus comprising the above nucleic acid encoding the above antigen, or the above expression cassette, vaccines comprising the above objects and methods of their use for the induction of specific immunity to SARS-CoV- 2 and/or prevention of SARS
  • the present invention relates to an isolated codon-optimized nucleic acid that encodes the isolated recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1, which is the nucleotide sequence of SEQ ID NO: 18.
  • the present invention relates to a cassette that expresses the recombinant receptor-binding domain of S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1, which includes the above nucleic acid.
  • RBD-S S glycoprotein
  • the cassette includes the following elements in the 5'-end to 3'-end direction: a left-hand (first) ITR (inverted terminal repeats); a CMV (cytomegalovirus) enhancer; a CMV (cytomegalovirus) promoter; an intron of the hBGl gene (hemoglobin subunit gamma 1 gene); the above codon-optimized nucleic acid; an hGHl polyadenylation signal (human growth hormone gene polyadenylation signal); a right-hand (second) ITR.
  • the cassette includes a nucleic acid with the nucleotide sequence of SEQ ID NO: 19.
  • the present invention relates to a vector that expresses the recombinant receptor-binding domain of S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1, which includes the above nucleic acid or any of the above cassettes.
  • RBD-S S glycoprotein
  • the present invention relates to an isolated AAV5 (adeno-associated virus serotype 5)-based recombinant virus for the induction of specific immunity to SARS-CoV-2 and/or prevention of the SARS-CoV-2-related coronavirus infection, which expresses the recombinant receptor-binding domain of S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO:1, which includes the above nucleic acid or any of the above cassettes.
  • AAV5 adeno-associated virus serotype 5
  • RBD-S S glycoprotein
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 4. In some embodiments, the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 4 with one or more point mutations.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 4 with mutations S2A and T711S.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 5.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 4 or the amino acid sequence of SEQ ID NO: 4 with one or more point mutations
  • the expression cassette includes the following elements in the 5'-end to 3'-end direction: a left-hand (first) ITR (inverted terminal repeats); a CMV (cytomegalovirus) enhancer; a CMV (cytomegalovirus) promoter; an intron of the hBGl gene (hemoglobin subunit gamma 1 gene); the above codon-optimized nucleic acid; an hGHl polyadenylation signal (human growth hormone gene polyadenylation signal); a right-hand (second) ITR.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 4 or the amino acid sequence of SEQ ID NO: 4 with one or more point mutations, and the expression cassette comprises a nucleic acid with SEQ ID NO: 19.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 4 with point mutations S2A and T71 IS, which is the amino acid sequence of SEQ ID NO: 5.
  • the present invention relates to a pharmaceutical composition for the induction of specific immunity to SARS-CoV-2 and/or prevention of SARS-CoV-2-related coronavirus infection, which comprises any of the above AAV5-based recombinant viruses in combination with one or more pharmaceutically acceptable excipients.
  • the present invention relates to the use of any of the above AAV5-based recombinant viruses or the above composition for the induction of specific immunity to SARS- CoV-2 and/or prevention of SARS-CoV-2-related coronavirus infection.
  • the present invention relates to a vaccine for the induction of specific immunity to SARS-CoV-2 and/or prevention of SARS-CoV-2-related coronavirus infection, which comprises any of the above AAV5-based recombinant viruses in an effective amount.
  • the present invention relates to a method for the induction of specific immunity to SARS-CoV-2 and/or prevention of SARS-CoV-2-related coronavirus infection, which comprises administration into a mammalian organism any of the above AAV5-based recombinant viruses or the above vaccine, in an effective amount.
  • Figure 1 is a schematic diagram of the plasmid pAAV-RBD-S C0 intended to produce an AAV vector with an expression cassette that comprises the codon-optimized sequence of the RBD- S gene (RBD-S C0 ) of the recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2, wherein
  • Leader peptide is a peptide that provides the secretion of the target protein
  • RBD-S co is a codon-optimized sequence of the gene of the recombinant receptor-binding domain of S glycoprotein of SARS-CoV-2;
  • AmpR is a beta-lactamase gene that provides resistance to ampicillin;
  • pUC origin is a pUC replication origin in bacteria;
  • ITR is inverted terminal repeats
  • CMV-Promoter is the promoter of cytomegalovirus early genes
  • Poly A is a polyadenylation signal sequence, for increasing mRNA stability
  • HBG Intron is human beta giobine intron.
  • Figure 2 is a graph showing the concentration of RBD-S protein in the culture fluid 7 days following transducing CHO-K1-S cells with the viral AAV5-RBD-S product carrying the wildtype RBD-S gene (AAV5 -RBD-S WT ) and AAV5-RBD-S product carrying the codon-optimized RBD-S gene (AAV5-RBD-S C0 ).
  • MOI Multiple of infection
  • Figure 4 is a graph which shows the content of antibodies to the RBD-S protein in the blood plasma of research animals following immunization with the purified recombinant RBD-S protein product. Intramuscular injection at 20 pg/mouse). Shows individual scores for each animal in the study.
  • Figure 6 is a graph showing the results of determination of the content of antibodies to the RBD-S protein in the blood plasma of research animals following immunization with the AAV5 product, the genome of which does not contain an expression cassette with the RBD-S gene (product with empty AAV5 capsids).
  • CP is viral capsids.
  • Figure 7 is a graph showing the results of determination of the content of antibodies to the RBD-S protein in the blood plasma of research animals following immunization with a control AAV-free product. The graph shows individual scores for each animal in the study.
  • Figure 8 is a graph that shows the results of determining the neutralizing activity of antibodies to native SARS-CoV-2 in serum samples of research animals.
  • AAV5-RBD-S WT refers to serum samples of animals immunized with the AAV5-RBD-S product carrying the wild-type RBD-S gene (AAV5-RBD-S WT ).
  • AAV5-RBD-S C0 refers to serum samples of animals immunized with the AAV5-RBD-S product carrying the codon-optimized RBD-S gene (AAV5-RBD-S C0 ).
  • Placebo refers to serum samples of animals immunized with an AAV-free product.
  • AAV5 empty refers to serum samples of animals immunized with the AAV5 product, which genome is free of an expression cassette with the RBD-S gene (product with empty AAV5 capsids).
  • RBD-S refers to serum samples of animals immunized with the purified recombinant RBD- S protein product.
  • RC refers to serum samples of COVID-19 convalescents. Definitions and General Methods
  • isolated means altered or removed from the natural state.
  • a nucleic acid or a peptide naturally present in an animal is not “isolated”, but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated”.
  • An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a genetically modified cell.
  • Naturally occurring is used to describe an object that can be found in nature as distinct from being artificially produced.
  • a protein or nucleotide sequence present in an organism which can be isolated from a source in nature and that has not been intentionally modified by a person in the laboratory, is naturally occurring.
  • genome refers to the complete genetic material of an organism.
  • peptide As used in the present description, the terms “peptide”, “polypeptide” and “protein” are used interchangeably, and they refer to a compound consisting of amino acid residues that are covalently linked by peptide bonds.
  • a protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence.
  • Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds.
  • Polypeptides include, inter alia, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins.
  • the polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
  • nucleic acid means a precise sequence of nucleotides, modified or not, determining a fragment or a region of a nucleic acid, containing unnatural nucleotides or not, and being either a double-strand DNA or RNA, a single-strand DNA or RNA, or transcription products of said DNAs.
  • nucleic acids are polynucleotides that can be hydrolyzed to monomeric "nucleotides". Monomeric nucleotides can be hydrolyzed into nucleosides.
  • polynucleotides include, as non-limiting examples, all nucleic acid sequences which are obtained by any means available in the art, including, as nonlimiting examples, recombinant means, i.e. the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCR and the like, and by synthetic means.
  • the present invention does not relate to nucleotide sequences in their natural chromosomal environment, i.e. in a natural state.
  • the sequences of the present invention have been isolated and/or purified, i.e., they were sampled directly or indirectly, for example by copying, their environment having been at least partially modified.
  • isolated nucleic acids obtained by recombinant genetics, by means, for example, of host cells, or obtained by chemical synthesis should also be mentioned here.
  • nucleotide sequence encompasses its complement.
  • a nucleic acid having a particular sequence should be understood as one which encompasses the complementary strand thereof with the complementary sequence thereof.
  • AAV Adeno-associated virus
  • Viruses of the Parvoviridae family are small DNA-containing animal viruses.
  • the Parvoviridae family may be divided into two subfamilies: the Parvovirinae, which members infect vertebrates, and the Densovirinae, which members infect insects.
  • the Parvovirinae which members infect vertebrates
  • the Densovirinae which members infect insects.
  • serotypes of adeno-associated virus described (Mori, S. ET AL., 2004, "Two novel adeno- associated viruses from cynomolgus monkey: pseudotyping characterization of capsid protein", Virology, T. 330 (2): 375-83). All of the known serotypes can infect cells from multiple tissue types.
  • Tissue specificity is determined by the capsid protein serotype; therefore, the adeno- associated virus-based vectors are constructed by assigning the desired serotype. Further information on parvoviruses and other members of the Parvoviridae is described in the literature (Kenneth I. Berns, "Parvoviridae: The Viruses and Their Replication", Chapter 69 in Fields Virology (3d Ed. 1996)).
  • the genomic organization of all known AAV serotypes is very similar.
  • the genome of AAV is a linear, single-stranded DNA molecule that is less than about 5000 nucleotides (nt) in length.
  • Inverted terminal repeats (ITRs) flank the unique coding nucleotide sequences of replication of non- structural proteins (Rep) and structural proteins (Cap).
  • the Cap gene encodes the VP proteins (VP1, VP2, and VP3) which form the capsid.
  • the terminal 145 nucleotides are self-complementary and are organized such that an energetically stable intramolecular duplex forming a T-shaped hairpin may be formed.
  • Such hairpin structures function as an origin for virus DNA replication, serving as primers for the cellular DNA polymerase complex.
  • Rep genes e.g. Rep78 and Rep52
  • the Rep genes are expressed using the P5 promoter and the P19 promoter, respectively, and the both Rep proteins have a certain function in the replication of the viral genome.
  • a splicing event in the Rep open reading frame results in the expression of actually four Rep proteins (e.g. Rep78, Rep68, Rep52, and Rep40).
  • Rep78, Rep68, Rep52, and Rep40 the unspliced mRNA encoding Rep78 and Rep52 proteins is sufficient for AAV vector production in mammalian cells.
  • vector means a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Furthermore, the term “vector” herein refers to a viral particle capable of transporting a nucleic acid.
  • expression is defined as the transcription and/or translation of a particular nucleotide sequence driven by its promoter.
  • prophylaxis or “prevention” and the like means slowing down or preventing the onset of symptoms of a disease, disorder or infection.
  • induction of an immune response refers to the specific control of or effect on the activity of the immune response and includes activation of an immune response, stimulation of an immune response, enhancement of an immune response.
  • telomere shortening means any condition that would benefit from treatment with the compound of the present invention. This includes chronic and acute disorders or diseases including those pathological conditions that predispose the mammal to the disorder in question.
  • Disease is a state of health of an animal where the animal cannot maintain homeostasis, and where if the disease is not ameliorated then the animal's health continues to deteriorate.
  • subject refers to any animal amenable to the methods described in the present description.
  • patient refers to any animal amenable to the methods described in the present description.
  • patient or individual is a human.
  • Said subject may be either male or female, of any age.
  • “Therapeutically effective amount” or “effective amount” refers to that amount of the therapeutic agent being administered which will relieve to some extent one or more of the symptoms of the disease being prevented.
  • the present invention relates to an isolated recombinant receptor -binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2 (severe acute respiratory syndrome- related coronavirus 2), which is represented by the amino acid sequence
  • Said RBD-S of SARS-CoV-2 was obtained from a full length S glycoprotein of SARS- CoV-2, which have been described in the GenBank database, Wu F., Severe acute respiratory syndrome coronavirus 2 isolate Wuhan-Hu-1, complete genome, 2020, GenBank: MN908947.3 (https://www.ncbi.nlm.nih.gov/nuccore/MN908947) and in Fan Wu ET AL., A new coronavirus associated with human respiratory disease in China, 2020, Nature, volume 579, pages 265-269 (https://www.nature.eom/articles/s41586-020-2008-3) and has the following amino acid sequence:
  • a receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2 was selected from the above sequence of the S glycoprotein of SARS-CoV-2 based on the analysis of the structure of this glycoprotein (see Example 1), the receptor-binding domain of the S glycoprotein of SARS-CoV-2 having the following amino acid sequence
  • the present invention relates to an isolated codon-optimized nucleic acid that encodes the isolated recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1, which is the nucleotide sequence of SEQ ID NO: 18.
  • An "isolated" nucleic acid molecule is one which is identified and separated from at least one nucleic acid molecule-impurity, which the former is typically bound to in the natural source of nuclease nucleic acid.
  • An isolated nucleic acid molecule is different from the form or set in which it is found under natural conditions. Thus, an isolated nucleic acid molecule is different from a nucleic acid molecule that exists in cells under natural conditions.
  • An isolated nucleic acid molecule however includes a nucleic acid molecule located in cells in which the nuclease is normally expressed, for example, if the nucleic acid molecule has a chromosomal localization that is different from its localization in cells under natural conditions.
  • the above codon-optimized nucleic acid was obtained by codon-optimizing a wild-type nucleic acid with the nucleotide sequence
  • the above codon-optimized nucleic acid with the nucleotide sequence of SEQ ID NO: 18 has an increased codon adaptation index (a standard measure for evaluating a sequence for codon usage frequencies) for mammalian cells as compared to that of the wild-type nucleic acid with the nucleotide sequence of SEQ ID NO: 2.
  • Expression cassette Expression vector.
  • the present invention relates to a cassette that expresses the recombinant receptor-binding domain of S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1, which includes the above nucleic acid.
  • RBD-S S glycoprotein
  • cassette which expresses refers in particular to a DNA fragment that is capable, in an appropriate setting, of triggering the expression of a polynucleotide encoding a polypeptide of interest that is included in said expression cassette.
  • the expression cassette When introduced into a host cell, the expression cassette is, inter alia, capable of engaging cellular mechanisms to transcribe the polynucleotide encoding the polypeptide of interest into RNA that is then typically further processed and eventually translated into the polypeptide of interest.
  • the expression cassette may be contained in an expression vector.
  • the expression cassette of the present invention comprises a promoter as an element.
  • promoter refers in particular to a DNA element that promotes the transcription of a polynucleotide to which the promoter is operably linked.
  • the promoter may further form part of a promoter/enhancer element.
  • promoter typically refers to a site on the nucleic acid molecule to which an RNA polymerase and/or any associated factors binds and at which transcription is initiated. Enhancers potentiate promoter activity temporally as well as spatially. Many promoters are known in the art to be transcriptionally active in a wide range of cell types.
  • Promoters can be divided into two classes, those that function constitutively and those that are regulated by induction or derepression. The both classes are suitable for protein expression. Promoters that are used for high-level production of polypeptides in eukaryotic cells and, in particular, in mammalian cells, should be strong and preferably active in a wide range of cell types. Strong constitutive promoters which are capable of driving expression in many cell types are well known in the art and, therefore, it is not herein necessary to describe them in detail. In accordance with the idea of the present invention, it is preferable to use the cytomegalovirus (CMV) promoter.
  • CMV cytomegalovirus
  • a promoter or promoter/enhancer derived from the immediate early (IE) region of human cytomegalovirus (hCMV) is particularly suitable as a promoter in the expression cassette of the present invention.
  • the immediate early (IE) region of human cytomegalovirus (hCMV) and obtained therefrom functional expression-inducing fragments and/or functional expressionaugmenting fragments, for example, are described in EP0173177 and EP0323997 and are also well known in the art.
  • several fragments of the immediate early (IE) region of hCMV may be used as a promoter and/or promoter/enhancer.
  • the human CMV promoter is used in the expression cassette of the present invention.
  • the cassette includes the following elements in the 5'-end to 3'-end direction: a left-hand (first) ITR (inverted terminal repeats); a CMV (cytomegalovirus) enhancer; a CMV (cytomegalovirus) promoter; an intron of the hBGl gene (hemoglobin subunit gamma 1 gene); a codon-optimized nucleic acid that encodes the isolated recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1 and has the nucleotide sequence of SEQ ID NO: 18; an hGHl polyadenylation signal (human growth hormone gene polyadenylation signal); a right-hand (second) ITR.
  • a left-hand (first) ITR inverted terminal repeats
  • CMV cytomegalovirus
  • CMV cytomegalovirus
  • hBGl gene hemoglobin subunit gamma 1 gene
  • the left-hand (first) ITR (inverted terminal repeats) has the following nucleic acid sequence:
  • the CMV (cytomegalovirus) enhancer has the following nucleic acid sequence: cgttacataacttacggtaaatggcccgcctggctgaccgcccaacgacccccgcccattgacgtcaataatgacgtatgttccc atagtaacgCcaatagggactttccattgacgtcaatgggtggagtattttacggtaaactgcccacttggcagtacatcaagtgtatcatatgc caagtacgccccctattgacgtcaatgacggtaaatggccctggcattatgcccagtacatgaccttatgggactttcctacttggcagta catctacgtattagtcatcgctattaccatg (SEQ ID NO: 9).
  • the CMV (cytomegalovirus) promoter has the following nucleic acid sequence: gtgatgcggttttggcagtacatcaatgggcgtggatagcggtttgactcacggggatttccaagtctccaccccattgacgtcaa tgggagtttgtttgGcaccaaaatcaacgggactttccaaaatgtcgtaacaactccgcccattgacgcaaatgggcggtaggcgtgtac ggtgggaggtctatataagcagagct (SEQ ID NO: 10).
  • the intron of the hBGl (hemoglobin subunit gamma 1) gene has the following nucleic acid sequence: cgaatcccggccgggaacggtgcattggaacgcggattcccgtgccaagagtgacgtaagtaccgcctatagagtctatagg cccacaaaaatgctttcttctttttaatatactttttttgttttatctttctaatactttccctaatctcttttttcagggcaataatgatacaatgtatca tgtgcctcttgcaccattctaaagaataacagtgataatttctgggttaaggcaatagcaatatttctgcatataaatatttctgcatataaattgtaac tgatgta
  • the hGHl (human growth hormone 1 gene) polyadenylation signal has the following nucleic acid sequence:
  • the right-hand (second) ITR has the following nucleic acid sequence: aggaacccctagtgatggagttggccactccctctgcgcgctcgctcactgaggccgggcgaccaaaggtcgcccga cgcccgggctttgcccgggcggcctcagtgagcgagcgagcgcgcagctgcctgcagg (SEQ ID NO: 13).
  • the cassette includes a nucleic acid with the nucleotide sequence: cctgcaggcagctgcgcgctcgctcactgaggccgcccgggcgtcgggcgacctttggtcgcccggcctcagtgagcgagcgag cgcgcagagagggagtggccaactccatcactaggggttcctgcggccgcacgcgtctagttattaatagtaatcaattacggggtcattag ttcatagcccatatatggagttccgcgttacataacttacggtaaatggcccgctggctgaccgcccaacgacccccgcccattgacgtca ataatgacgtatgttcccatagtaacgCcaatagggactttccattttttttgac
  • the present invention relates to a vector that expresses the recombinant receptor-binding domain of S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1, which includes the above nucleic acid or any of the above cassettes.
  • RBD-S S glycoprotein
  • a vector is a plasmid, i.e., a circular double stranded piece of DNA into which additional DNA segments may be ligated.
  • a vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
  • vectors are capable of autonomous replication in a host cell into which they are introduced (e.g. bacterial vectors having a bacterial origin site of replication and episomal mammalian vectors).
  • vectors e.g. non-episomal mammalian vectors
  • certain vectors are capable of directing the expression of genes to which they are operably linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply, "expression vectors").
  • Expression vectors include plasmids, retroviruses, adenoviruses, adeno-associated viruses (AAVs), plant viruses, such as cauliflower mosaic virus, tobacco mosaic virus, cosmids, YACs, EBV derived episomes, and the like.
  • DNA molecules may be ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the DNA.
  • An expression vector and expression control sequences may be chosen to be compatible with the expression host cell used.
  • DNA molecules may be introduced into the expression vector by standard methods (e.g. ligation of complementary restriction sites, or blunt end ligation if no restriction sites are present).
  • the recombinant expression vector may also encode a leader peptide (or a signal peptide) that facilitates the secretion of the protein of interest from a host cell.
  • the gene of the protein of interest may be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the protein of interest.
  • the leader peptide (or signal peptide) may be an immunoglobulin leader peptide or other leader peptide (that is, a non-immunoglobulin protein leader peptide).
  • the recombinant expression of the vectors according to the present invention may carry regulatory sequences that control the expression of the RBD-S gene of SARS-CoV-2 in a host cell. It will be understood by those skilled in the art that the design of an expression vector, including the selection of regulatory sequences, may depend on such factors as the choice of a host cell to be transformed, the level of expression of a desired protein, and so forth.
  • Preferred control sequences for an expression host cell in mammals include viral elements that ensure high levels of protein expression in mammalian cells, such as promoters and/or enhancers derived from a retroviral LTR, cytomegalovirus (CMV) (such as a CMV promoter/enhancer), simian virus 40 (SV40) (such as a SV40 promoter/enhancer), adenovirus, (e.g. the major late promoter adenovirus (AdMLP)), polyomavirus and strong mammalian promoters such as native immunoglobulin promoter or actin promoter.
  • CMV cytomegalovirus
  • SV40 simian virus 40
  • AdMLP major late promoter adenovirus
  • polyomavirus e.g. the major late promoter adenovirus (AdMLP)
  • AdMLP major late promoter adenovirus
  • strong mammalian promoters such as native immunoglobulin promoter or
  • control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
  • the control sequences that are suitable for prokaryotes are, for example, a promoter, optionally an operator sequence and a ribosome binding site.
  • Eukaryotic cells are known to include promoters, polyadenylation signals, and enhancers.
  • promoter or “transcription regulatory sequence” or “regulatory sequence” refers to a nucleic acid fragment that controls the transcription of one or more coding sequences, and that is located upstream with respect to the direction of reading relative to the direction of transcription from the transcription initiation site of the coding sequence, and is structurally identified by the presence of a binding site for DNA-dependent RNA polymerase, transcription initiation sites and any other DNA sequences, including, but not limited to, transcription factor binding sites, repressor and activator protein binding sites, and any other sequences of nucleotides known to one of skill in the art that directly or indirectly regulate the level of transcription with said promoter.
  • a “constitutive” promoter is a promoter that is active in most tissues under typical physiological and developmental conditions.
  • An “inducible” promoter is a promoter that is physiologically or developmentally regulated, e.g. under the influence of a chemical inducer.
  • a “tissue specific” promoter is only active in specific types of tissues or cells.
  • Enhancer elements may refer to a DNA sequence that is located adjacent to the DNA sequence that encodes a recombinant product.
  • Enhancer elements are typically located in a 5' direction from a promoter element or can be located downstream of or within a coding DNA sequence (e.g. a DNA sequence transcribed or translated into a recombinant product or products).
  • a coding DNA sequence e.g. a DNA sequence transcribed or translated into a recombinant product or products.
  • an enhancer element can be located 100 base pairs, 200 base pairs, or 300 or more base pairs upstream of a DNA sequence that encodes a recombinant product, or downstream of said sequence.
  • Enhancer elements may increase the amount of a recombinant product being expressed from a DNA sequence above the level of expression associated with a single promoter element. Multiple enhancer elements are readily available to those of ordinary skill in the art.
  • recombinant expression vectors of the invention may carry additional sequences, such as sequences that regulate replication of a vector in host cells (e.g. origins of replication) and selectable marker genes.
  • the selectable marker gene facilitates the selection of host cells into which a vector has been introduced (see e.g., U.S. Patent Nos. 4,399,216, 4,634,665 and 5,179,017).
  • the selectable marker gene confers resistance to medicinal agents, such as G418, hygromycin or methotrexate, on a host cell into which a vector has been introduced.
  • selectable marker genes include a dihydrofolate reductase (DHFR) gene (for use in dhfr-host cells during methotrexate selection/amplification), a neo gene (for G418 selection), and a glutamate synthetase gene.
  • DHFR dihydrofolate reductase
  • neo for G418 selection
  • glutamate synthetase gene for use in dhfr-host cells during methotrexate selection/amplification
  • expression control sequence refers to polynucleotide sequences that are necessary to effect the expression and processing of coding sequences to which they are ligated.
  • Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance protein secretion.
  • control sequences differs depending upon the host organism; in prokaryotes, such control sequences generally include the promoter of ribosome binding site, and transcription termination sequences; in eukaryotes, typically, such control sequences include promoters and transcription termination sequences.
  • control sequences includes at least all components, the presence of which is essential for expression and processing, and can also include additional components, the presence of which is advantageous, for example, leader sequences and fusion partner sequences.
  • operably linked refers to a linkage of polynucleotide (or polypeptide) elements in a functional relationship.
  • a nucleic acid is “operably linked” when it is present in functional relationship conditions with another nucleic acid sequence.
  • a transcription regulatory sequence is operably linked to a coding sequence if it affects the transcription of said coding sequence.
  • operably linked means that the DNA sequences being linked are typically contiguous and, where it is necessary to join two protein coding regions, are also contiguous and are present in the reading frame.
  • expression vector relates to a vector comprising one or more polynucleotide sequences of interest, genes of interest, or “transgenes” that are flanked by parvoviral sequences or inverted terminal repeat (ITR) sequences.
  • AAV5 (adeno-associated virus serotype 5)-based recombinant virus
  • the present invention relates to an isolated AAV5 (adeno-associated virus serotype 5)-based recombinant virus for the induction of specific immunity to SARS-CoV-2 and/or prevention of the SARS-CoV-2-related coronavirus infection, which expresses the recombinant receptor-binding domain of S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO:1, which includes the above nucleic acid or any of the above cassettes.
  • AAV5 adeno-associated virus serotype 5
  • RBD-S S glycoprotein
  • AAV-based recombinant virus (or "AAV-based virus-like particle”, or “AAV recombinant virus strain”, or “AAV recombinant vector”, or “rAAV vector”) as used in this description refers to the above expression cassette (or the above expression vector), which is enclosed within the AAV capsid.
  • the Cap gene encodes 3 capsid proteins (VP1, VP2, and VP3).
  • VP1, VP2, and VP3 are present at 1 : 1 : 10 ratio to form an icosahedral capsid (Xie Q. et al.
  • AAV-2 adeno-associated virus
  • Transcription of these genes starts from a single promoter, p40.
  • the molecular weights of the corresponding proteins (VP1, VP2 u VP3) are 87, 72, and 62 kDa, respectively. All of the three proteins are translated from a single mRNA. Following transcription, pre-mRNA may be spliced in two different manners, where either longer or shorter intron is excised to form mRNAs of various nucleotide lengths.
  • an expression cassette flanked by ITR is packaged into an AAV capsid.
  • the genes required for AAV replication, as mentioned above, are not included in the cassette.
  • the expression cassette DNA is packaged into a viral capsid in the form of a single stranded DNA molecule (ssDNA) being approximately 3000 nucleotides long. Once a cell is infected with the virus, the single-stranded DNA is converted to the form of double-stranded DNA (dsDNA).
  • ssDNA single stranded DNA molecule
  • dsDNA double-stranded DNA
  • the dsDNA can only be used by the cell's proteins, which transcribe the present gene or genes into RNA.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLVLPGYNYLGPGNGL DRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLGK AVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPSG SQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRVV TKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRDW QRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVVG NGTEGCLPAFPPQVFTLPQYGYATL
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP2.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP2 having the following amino acid sequence: TAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPSGSQQLQIPAQPASSLGADTMSAG GGGPLGDNNQGADGVGNASGDWHCDSTWMGDRVVTKSTRTWVLPSYNNHQYREIKS GSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRDWQRLINNYWGFRPRSLRVKIFNIQ VKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVVGNGTEGCLPAFPPQVFTLPQYGYA TLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFTYNFEEVPFHSSFAPSQNLFKLANPL VDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKNWFPGPMGRTQGWNLGSGVNRASV SAFATTNRMELEGASYQVPPQ
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP3.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP3 having the following amino acid sequence MSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRVVTKSTRTWVLPSYNNHQY REIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRDWQRLINNYWGFRPRSLRVK IFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVVGNGTEGCLPAFPPQVFTLPQ YGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFTYNFEEVPFHSSFAPSQNLFK LANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKNWFPGPMGRTQGWNLGSGV NRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSNTYALENTMIFNSQPANPGTT ATYLEGNMLITSESETQPVNR
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 proteins VP1, VP2, and VP3.
  • the AAV5 -based recombinant virus has a capsid that includes the proteins VP1 with the amino acid sequence of SEQ ID NO: 4, VP2 with the amino acid sequence of SEQ ID NO: 14, and VP3 with the amino acid sequence of SEQ ID NO: 15.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 4 with one or more point mutations.
  • the AAV5-based recombinant virus has a capsid that includes an AAV5 protein VP1 having an amino acid sequence that includes amino acid substitutions at positions S2A and T711S of wild-type AAV5 VP1 (SEQ ID NO: 4), and has the amino acid sequence
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP2 having the amino acid sequence of SEQ ID NO: 14 with one or more point mutations.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP2 having an amino acid sequence that includes amino acid substitutions at position T575S of wild-type AAV5 VP2 (SEQ ID NO: 14), and has the amino acid sequence
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP3 having the amino acid sequence of SEQ ID NO: 15 with one or more point mutations.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP3 having an amino acid sequence that includes amino acid substitutions at position T519S of wild-type AAV5 VP3 (SEQ ID NO: 15), and has the amino acid sequence MSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRVVTKSTRTWVLPSYN NHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRDWQRLINNYWGFRPRS LRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVVGNGTEGCLPAFPPQVF TLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFTYNFEEVPFHSSFAPSQ NLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKNWFPGPMGRTQGWNL GSGVNRASVSAFATTNRMELEGASY
  • the AAV5 -based recombinant virus has a capsid that includes the proteins VP1 with the amino acid sequence of SEQ ID NO: 4 with one or more point mutations, VP2 with the amino acid sequence of SEQ ID NO: 14 with one or more point mutations, and VP3 with the amino acid sequence of SEQ ID NO: 15 with one or more point mutations.
  • the AAV5 -based recombinant virus has a capsid that includes the proteins VP1 with the amino acid sequence of SEQ ID NO: 5, VP2 with the amino acid sequence of SEQ ID NO: 16, and VP3 with the amino acid sequence of SEQ ID NO: 17.
  • amino acids are typically divided into four families: (1) acidic amino acids are aspartate and glutamate; (2) basic amino acids are lysine, arginine, histidine; (3) nonpolar amino acids are alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, and (4) uncharged polar amino acids are glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine.
  • Phenylalanine, tryptophan, and tyrosine are sometimes classified as aromatic amino acids.
  • an isolated substitution of leucine for isoleucine or valine, an aspartate for a glutamate, a threonine for a serine, or a similar conservative substitution of an amino acid for a structurally related amino acid will not have a major effect on the biological activity.
  • the polypeptide of interest may include up to about 5-10 conservative or non-conservative amino acid substitutions, so long as the desired function of the molecule remains intact.
  • An embodiment with point mutations in the sequences of AAV5 proteins VP1, VP2, or VP3 using amino acid substitutions is a substitution of at least one amino acid residue in the AAV5 protein VP1, VP2, or VP3 with another amino acid residue. Conservative substitutions are shown in Table A under "preferred substitutions".
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 4 or the amino acid sequence of SEQ ID NO: 4 with one or more point mutations
  • the expression cassette includes the following elements in the 5'-end to 3'-end direction: a left-hand (first) ITR (inverted terminal repeats); a CMV (cytomegalovirus) enhancer; a CMV (cytomegalovirus) promoter; an intron of the hBGl gene (hemoglobin subunit gamma 1 gene); a codon-optimized nucleic acid that encodes the isolated recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1 and has the nucleotide sequence of SEQ ID NO: 18; an hGHl polyadenylation signal (human growth hormone gene polyadenylation signal); a
  • the AAV5 -based recombinant virus has a capsid that includes the proteins VP1 with the amino acid sequence of SEQ ID NO: 4, VP2 with the amino acid sequence of SEQ ID NO: 14, and VP3 with the amino acid sequence of SEQ ID NO: 15, and the expression cassette includes the following elements in the 5'-end to 3'-end direction: a left-hand (first) ITR (inverted terminal repeats); a CMV enhancer; a CMV promoter; an intron of the hBGl gene (hemoglobin subunit gamma 1 gene); a codon-optimized nucleic acid that encodes the isolated recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1 and has the nucleotide sequence of SEQ ID NO: 18; an hGHl polyadenylation signal; a right-hand ITR.
  • first ITR inverted terminal repeats
  • the AAV5 -based recombinant virus has a capsid that includes the proteins VP1 with the amino acid sequence of SEQ ID NO: 4 with one or more point mutations, VP2 with the amino acid sequence of SEQ ID NO: 14 with one or more point mutations, and VP3 with the amino acid sequence of SEQ ID NO: 15 with one or more point mutations
  • the expression cassette includes the following elements in the 5'-end to 3'-end direction: a left-hand (first) ITR (inverted terminal repeats); a CMV enhancer; a CMV promoter; an intron of the hBGl gene; a codon-optimized nucleic acid that encodes the isolated recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1 and has the nucleotide sequence of SEQ ID NO: 18; an hGHl polyadenylation signal; a right-hand ITR.
  • the AAV5 -based recombinant virus has a capsid that includes the proteins VP1 with the amino acid sequence of SEQ ID NO: 5, VP2 with the amino acid sequence of SEQ ID NO: 16, and VP3 with the amino acid sequence of SEQ ID NO: 17, and the expression cassette includes the following elements in the 5'-end to 3'-end direction: a left-hand (first) ITR (inverted terminal repeats); a CMV enhancer; a CMV promoter; an intron of the hBGl gene; a codon-optimized nucleic acid that encodes the isolated recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1 and has the nucleotide sequence of SEQ ID NO: 18; an hGHl polyadenylation signal; a right-hand ITR.
  • a left-hand (first) ITR inverted terminal repeats
  • CMV enhancer a CMV promote
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 4 or the amino acid sequence of SEQ ID NO: 4 with one or more point mutations, and the expression cassette comprises a nucleic acid with SEQ ID NO: 19.
  • the AAV5 -based recombinant virus has a capsid that includes the AAV5 protein VP1 having the amino acid sequence of SEQ ID NO: 4 with point mutations S2A and T71 IS, which is the amino acid sequence of SEQ ID NO: 5.
  • the AAV5 -based recombinant virus has a capsid that includes the proteins VP1 with the amino acid sequence of SEQ ID NO: 4, VP2 with the amino acid sequence of SEQ ID NO: 14, and VP3 with the amino acid sequence of SEQ ID NO: 15, and the expression cassette comprises a nucleic acid with SEQ ID NO: 19.
  • the AAV5 -based recombinant virus has a capsid that includes the proteins VP1 with the amino acid sequence of SEQ ID NO: 4 with one or more point mutations, VP2 with the amino acid sequence of SEQ ID NO: 14 with one or more point mutations, and VP3 with the amino acid sequence of SEQ ID NO: 15 with one or more point mutations, and the expression cassette comprises a nucleic acid with SEQ ID NO: 19.
  • the AAV5 -based recombinant virus has a capsid that includes the proteins VP1 with the amino acid sequence of SEQ ID NO: 5, VP2 with the amino acid sequence of SEQ ID NO: 16, and VP3 with the amino acid sequence of SEQ ID NO: 17, and the expression cassette comprises a nucleic acid with SEQ ID NO: 19.
  • composition/vaccine in one aspect, relates to a pharmaceutical composition for the induction of specific immunity to SARS-CoV-2 and/or prevention of SARS-CoV-2-related coronavirus infection, which comprises any of the above AAV5-based recombinant viruses in combination with one or more pharmaceutically acceptable excipients.
  • the present invention relates to a pharmaceutical composition for the prevention of SARS-CoV-2-related coronavirus infection, which comprises any of the above AAV5-based recombinant viruses in combination with one or more pharmaceutically acceptable excipients.
  • the present invention relates to a pharmaceutical composition for the induction of specific immunity to SARS-CoV-2, which comprises any of the above AAV5-based recombinant viruses in combination with one or more pharmaceutically acceptable excipients.
  • the active substance in the above compositions is present in an effective amount, for example, in a biologically effective amount.
  • the present invention relates to a pharmaceutical composition
  • a pharmaceutical composition comprising the AAV5-based recombinant virus of the invention in a pharmaceutically acceptable carrier or in other pharmaceutical agents, adjuvants, diluents, etc.
  • the carrier will typically be a liquid carrier.
  • the carrier may be either solid or liquid, such as sterile pyrogen-free water or sterile pyrogen-free phosphate-buffered saline solution.
  • the carrier is respirable, and preferably is in a solid or liquid particulate form.
  • water that contains the additives that are common for injection solutions such as stabilizing agents, salts or saline, and/or buffers.
  • “Pharmaceutical composition” means a composition comprising the above AAV5 -based recombinant virus of the invention and at least one of components selected from the group consisting of pharmaceutically acceptable and pharmacologically compatible excipients, such as fillers, solvents, diluents, carriers, auxiliary, distributing agents, delivery agents, preservatives, stabilizers, emulsifiers, suspending agents, thickeners, prolonged delivery controllers, the choice and proportions of which depend on the type and route of administration and dosage.
  • Pharmaceutical compositions of the present invention and methods of preparation thereof will be undoubtedly apparent to those skilled in the art.
  • the pharmaceutical compositions should preferably be manufactured in compliance with the GMP (Good Manufacturing Practice) requirements.
  • the composition may comprise a buffer composition, tonicity agents, stabilizers and solubilizers.
  • “Pharmaceutically acceptable” means a material that does not have biological or other negative side effects, for example, the material can be administered to a subject without causing any undesirable biological effects.
  • such pharmaceutical compositions may be used, for 1 example, in transduction of a cell ex vivo or in administration in vivo of the AAV5-based recombinant virus of the invention directly to a subject.
  • excipient is used herein to describe any ingredient other than the above ingredients of the invention. These are substances of inorganic or organic nature which are used in the pharmaceutical manufacturing in order to give drug products the necessary physicochemical properties.
  • Stabilizer refers to an excipient or a mixture of two or more excipients that provide the physical and/or chemical stability of the active agent.
  • buffer refers to a solution, which is capable of resisting changes in pH by the action of its acid-base conjugate components, which allows the rAAV5 vector product to resist changes in pH.
  • the pharmaceutical composition preferably has a pH in the range from 4.0 to 8.0.
  • buffers used include, but are not limited to, acetate, phosphate, citrate, histidine, succinate, etc. buffer solutions.
  • the pharmaceutical composition is "stable" if the active agent retains physical stability and/or chemical stability and/or biological activity thereof during the specified shelflife at storage temperature, for example, of 2-8 °C.
  • the active agent retains both physical and chemical stability, as well as biological activity. Storage period is adjusted based on the results of stability test in accelerated or natural aging conditions.
  • a pharmaceutical composition of the invention can be manufactured, packaged, or widely sold in the form of a single unit dose or a plurality of single unit doses in the form of a ready formulation.
  • single unit dose refers to discrete quantity of a pharmaceutical composition containing a predetermined quantity of an active ingredient.
  • the quantity of the active ingredient typically equals the dose of the active ingredient to be administered in a subject, or a convenient portion of such dose, for example, half or a third of such dose.
  • the present invention relates to a vaccine for the induction of specific immunity to SARS-CoV-2 and/or prevention of SARS-CoV-2-related coronavirus infection, which comprises any of the above AAV5-based recombinant viruses in an effective amount.
  • the present invention relates to a vaccine for the prevention of SARS-CoV- 2-related coronavirus infection, which comprises any of the above AAV5-based recombinant viruses in an effective amount.
  • the present invention relates to a vaccine for the induction of specific immunity to SARS-CoV-2, which comprises any of the above AAV5-based recombinant viruses in an effective amount.
  • the term "vaccine” refers to an immunogenic composition comprising an antigen derived from a pathogen that is used to induce an immune response against a pathogen that confers protective immunity (e.g., immunity that protects a subject from an infection caused by a pathogen and/or reduces the severity of a disease or a condition caused by an infection as a result of a pathogen).
  • protective immunity may include the production of antibodies and/or cell-mediated response.
  • vaccine may also refer to an antigen suspension or solution that is administered to a vertebrate to develop protective immunity.
  • the vaccine includes an AAV5-based recombinant virus, which is present therein preferably in a biologically effective amount.
  • a "biologically effective" amount of the recombinant virus is an amount that is sufficient to cause infection (or transduction) and expression of the nucleic acid sequence being delivered, in the cell. If the virus is administered to a cell in vivo (e.g. the virus is administered to a subject, as described below), a "biologically-effective" amount of the viral vector is an amount that is sufficient to cause the transduction and expression of the nucleic acid sequence being delivered, in the target cell.
  • the present invention relates to the use of any of the above AAV5 -based recombinant viruses or the above composition for the induction of specific immunity to SARS- CoV-2 and/or prevention of SARS-CoV-2-related coronavirus infection.
  • the present invention relates to the use of any of the above AAV5 -based recombinant viruses or the above pharmaceutical composition for the prevention of SARS-CoV- 2-related coronavirus infection.
  • the present invention relates to the use of any of the above AAV5 -based recombinant viruses or the above pharmaceutical composition for the induction of specific immunity to SARS-CoV-2.
  • the present invention relates to a method for the induction of specific immunity to SARS-CoV-2 and/or prevention of SARS-CoV-2-related coronavirus infection, which comprises administration into a mammalian organism any of the above AAV5-based recombinant viruses or the above vaccine, in an effective amount.
  • the present invention relates to a method for the induction of specific immunity to SARS-CoV-2, which comprises administering to a mammalian organism any one of the above AAV5-based recombinant viruses, the above composition or the above vaccine for the induction of specific immunity to SARS-CoV-2, in an effective amount.
  • the present invention relates to a method for preventing SARS-CoV-2- related coronavirus infection, which comprises administering to a mammalian organism any one of the above AAV5 -based recombinant viruses, the above composition or the above vaccine for the prevention of SARS-CoV-2-related coronavirus infection, in an effective amount.
  • Expression of SARS-CoV-2 RBD-S in the cells of a mammal that has received any of the above AAV5-based recombinant viruses of the invention, prevention of SARS-CoV-2-related coronavirus infection in the mammal, as well as induction of specific immunity to SARS-CoV-2 in the mammal are links in a chain, since the expression cassette of the invention, which includes a codon-optimized nucleic acid of the invention, which encodes the isolated recombinant receptorbinding domain of the S glycoprotein (RBD-S) of SARS-CoV-2, which is represented by the amino acid sequence of SEQ ID NO: 1, is integrated into the genome of a mammalian cell, and initiation of expression of the isolated recombinant receptor-binding domain of the S glycoprotein (RBD-S) of SARS-CoV-2, which is represented by the amino acid sequence of SEQ ID NO: 1, takes place.
  • the expression cassette of the invention which includes a codon-optimized nucle
  • the SARS-CoV-2 RBD-S protein is then synthesized in the cell and leaves the cell, where it triggers the induction of specific immunity to SARS-CoV-2, said induction results in the prevention of SARS-CoV-2-related coronavirus infection in a mammal that has received any of the above AAV5-based recombinant viruses of the invention.
  • Any method for administering the AAV5-based recombinant virus which is recognized in the art, can be suitably used for the above AAV5 -based recombinant virus of the present invention.
  • Exemplary modes of administration include topical application, intranasal, inhalation, transmucosal, transdermal, enteral (e.g. oral, rectal), parenteral (e.g. intravenous, subcutaneous, intradermal, intramuscular) administrations, as well as direct tissue or organ injections.
  • enteral e.g. oral, rectal
  • parenteral e.g. intravenous, subcutaneous, intradermal, intramuscular administrations, as well as direct tissue or organ injections.
  • Injectables can be prepared in conventional forms, either as liquid solutions or suspensions, solid forms suitable for the preparation of solution or suspensions in liquid prior to injection, or as emulsions.
  • the AAV5 -based recombinant virus is introduced into an organism in an effective amount.
  • the AAV5-based recombinant virus is preferably introduced into an organism in a biologically effective amount.
  • a "biologically effective" amount of the recombinant virus is an amount that is sufficient to cause infection (or transduction) and expression of the nucleic acid sequence in the cell. If the virus is administered to a cell in vivo (e.g. the virus is administered to a subject, as described below), a "biologically-effective" amount of the viral vector is an amount that is sufficient to cause the transduction and expression of the nucleic acid sequence in the target cell.
  • Dosages of the above AAV5 -based recombinant virus of the invention will depend on the mode of administration, the particular viral vector, and they can be determined in a routine manner. Exemplary doses for achieving therapeutic effects are viral titers of at least about 10 5 , 10 6 , 10 7 , 10 8 , 10 9 , IO 10 , 10 11 , 10 12 , 10°, 10 14 , 10 15 , 10 16 transducing units or more, preferably about 10 8 to 10° transducing units, yet more preferably 10 12 transducing units.
  • the cell for administering the above AAV5-based recombinant virus of the invention may be a cell of any type, including but not limited to epithelial cells (e.g. skin, respiratory and gut epithelial cells), hepatic cells, muscle cells, pancreatic cells (including islet cells), hepatic cells, spleen cells, fibroblasts, endothelial cells, and the like.
  • epithelial cells e.g. skin, respiratory and gut epithelial cells
  • hepatic cells e.g. skin, respiratory and gut epithelial cells
  • muscle cells e.g., hepatic cells
  • pancreatic cells including islet cells
  • hepatic cells e.g. spleen cells
  • fibroblasts fibroblasts
  • endothelial cells e.g., endothelial cells, and the like.
  • the above AAV5-based recombinant virus of the invention is not used to modify the genetic integrity of human germ line cells.
  • Desired gene segments were prepared from oligonucleotides made by chemical synthesis. Gene segments of 300 to 1000 bp long, which were flanked by unique restriction sites, were collected by renaturing oligonucleotides on top of each other, followed by PCR amplification from border primers. As a result, a mixture of fragments was produced, including the desired one. The fragments were cloned at restriction sites into intermediate vectors, following which the DNA sequences of the subcloned fragments were confirmed by DNA sequencing.
  • DNA sequences were determined by Sanger sequencing. DNA and protein sequences were analyzed and sequence data was processed in SnapGene Viewer 4.2 or higher for sequence creation, mapping, analysis, annotation and illustration.
  • the suspended HEK293 cells used to produce AAV were cultured under standard conditions at 37° C and 5% CO2 on a complete culture medium without FBS and an antibiotic.
  • Vero-CCL81 adhesion cells used to evaluate the neutralizing activity of serum samples from animals were cultured under standard conditions at 37° C and 5% CO2, on complete DMEM medium supplemented with an antibiotic/antimycotic in the presence of 10% FBS.
  • the content of RBD-S protein following transduction of cells and antibodies to RBD-S protein in the blood plasma of animals following immunization was assessed by enzyme-linked immunosorbent assay (ELISA) using horseradish peroxidase as an indicator enzyme. Briefly, the wells of a 96-well plate were sensitized with primary antibodies to RBD-S protein, followed by layering the test samples. When ELISA was employed to detect antibodies to RBD-S protein, the plate was sensitized with RBD-S protein, followed by adding the blood plasma of the animals to the wells.
  • ELISA enzyme-linked immunosorbent assay
  • the samples were supplemented with secondary antibodies to RBD-S (analysis for the protein itself) or secondary antibodies to immunoglobulins of the research animals (analysis for the presence of antibodies to RBD-S) labeled with biotin and HRP-conjugated streptavidin.
  • a TMB solution was added to visualize the enzymatic reaction, and a stop solution was added to stop the development of the reaction.
  • a calibration curve showing the dependence of the optical density of the solution on the concentration of RBD-S/antibodies to RBD-S in standard samples, and we used optical density to determine the concentration of the test sample.
  • HEK293 producer cells To assemble AAV particles containing the codon-optimized RBD-S gene (coRBD-S), we used HEK293 producer cells, into which 3 plasmids were transfected as follows: pAAV-RBD-S C0 plasmid comprising the AAV genome with RBD-S transgene expression cassette (Fig. 1);
  • a plasmid for expression of the AAV5 serotype Cap gene and the AAV2 serotype Rep gene encodes several protein products
  • Ad5 adenovirus serotype 5
  • the cells were lysed and the viral particles were purified and concentrated using filtration, chromatography and ultracentrifugation methods.
  • the titer of the viral particles was determined by quantitative PCR with primers and a sample that were specific for the region of the recombinant viral genome and expressed as the copy number of viral genomes per 1 ml.
  • the cell line was pre-seeded into the wells of 6-well plates at a seeding density of 10,000 cells/cm 2 , followed by adding the viral particle product at an MOI of 500,000 vg/cell, on day 7 the RBD-S protein content in the culture liquid was determined by ELISA, as described above. All measurements were carried out in 3 independent experiments. Intact cells were used as a negative control.
  • the experiments were performed on BALB/c mice (males and females aged 6-8 weeks). Immunization was carried out by a single intramuscular injection of the products into the pelvic limbs.
  • the negative control group of animals was injected with a buffer solution, the positive control group was injected with a mixture of RBD-S protein, Freund's complete adjuvant and saline. Blood plasma was collected on the day of injection before the administration of the products, then on days 14, 21, 28, 42 and 56 following immunization.
  • RBD-S antigen of SARS-CoV-2 included the analysis of the 5WRG structure of the spike glycoprotein of SARS-CoV provided in ET AL., Cryo-electron microscopy structures of the SARS-CoV spike glycoprotein reveal a prerequisite conformational state for receptor binding, 2017, Cell Res. 27, p. 119-129.
  • Our analysis of the structure of SARS- CoV spike glycoprotein showed that it was possible to use both the conserved RBD-S and its extended portion for immunization.
  • Our analysis revealed that the increased length of RBD-S in question should contribute to the stabilization of the RBD-S protein structure due to the preservation of secondary structures that increase the likelihood of maintaining a stable protein conformation without the need to unwind.
  • the wild-type nucleic acid with the nucleotide sequence of SEQ ID NO: 2 encodes the RBD-S antigen of SARS-CoV-2 with the amino acid sequence of SEQ ID NO: 1.
  • the codon-optimized nucleic acid with the nucleotide sequence of SEQ ID NO: 18 has an increased codon adaptation index (a standard measure for evaluating a sequence for codon usage frequencies) for mammalian cells as compared to that of the wild-type nucleic acid with the nucleotide sequence of SEQ ID NO: 2.
  • the codon-optimized nucleic acid with the nucleotide sequence of SEQ ID NO: 18 is hereinafter referred to in the examples as RBD-S C0 .
  • Example 2 Assembly of a genetic construct comprising an AAV expression cassette with a recombinant codon-optimized RBD-S gene (RBD-S CO ).
  • the target plasmid pAAV-RBD-S C0 (Fig. 1) intended for the production of AAV5 viral vectors with an expression cassette comprising the codon-optimized RBD-S gene (SEQ ID NO: 2) was produced by substituting the sequence of the modified green fluorescent protein in the original construct pAAV-GFP Control plasmid (VPK-402) from CellBiolab (USA) using the restriction enzyme ligase method of cloning at Clal/BamHI sites to the codon-optimized RBD-S sequence with a signal peptide, the RBD-S sequence being synthesized de novo from oligonucleotides generated by chemical synthesis, with adding Clal restriction sites from the 5'- end and BamHI restriction sites from the 3'-end.
  • the final vector contains all the necessary elements for expression and assembly of the gene as part of the recombinant AAV genome:
  • the target plasmid pAAV-RBD-S C0 (Fig. 1) together with the rest of the plasmids required to produce recombinant AAV viral particles (see above) were used to produce the AAV5-RBD-S product carrying a codon-optimized version of the RBD-S gene (AAV5-RBD-S C0 ).
  • Bioprocessing resulted in recombinant AAV5-RBD-S viral particles comprising an expression cassette with the codon-optimized RBD-S gene (AAV5-RBD-S C0 ).
  • AAV5-RBD-S product comprising an expression cassette with the naturally occurring RBD-S gene (AAV5-RBD-S WT ) was also produced to serve as a reference product using the technology described above.
  • the purified AAV5-RBD-S product was tested in vitro prior to animal studies. These experiments were performed using the CHO-K1-S adherent cell line (Fig. 2.). The CHO-K1-S cells were plated into the wells of 6-well plates. Seeding was made into the following growth medium: DMEM/F12 supplemented with glutamine, glucose content was 4.5 g/1, 5% fetal bovine serum (FBS).
  • DMEM/F12 supplemented with glutamine
  • glucose content was 4.5 g/1
  • FBS fetal bovine serum
  • Cell seeding density was 10,000 cell/cm 2 .
  • pre-prepared cells were transduced at MOI of 500,000 vg/cell. All samples were run in triplicates. Intact cells were used as a negative control. It has been shown that the developed AAV5-RBD-S product, which carries a codon-optimized version of the RBD-S gene (AAV5-RBD-S C0 ), makes it possible to efficiently deliver the RBD-S transgene into cells and provide the production of the target protein, which is confirmed by ELISA data (Fig. 2.).
  • the in vivo study of the AAV5-RBD-S product involved BALB/c laboratory mice.
  • the dose of the AAV5-RBD-S WT and AAV5-RBD-S C0 products as used in the study was equal to IxlO 11 VG/mouse.
  • a control solution without AAV and the AAV5 product without an expression cassette with the RBD-S gene were used as negative controls.
  • a purified recombinant RBD-S protein was used as a positive control. Animals were immunized by a single intramuscular injection into the pelvic limbs.
  • the titer of antibodies to the RBD-S protein in blood plasma was determined by ELISA, as described above.
  • the neutralizing activity of antibodies was also evaluated using the native SARS-CoV-2 for blood serum samples obtained 56 days following immunization.
  • immunization with the AAV5 -RBD-S product which carries a codon- optimized version of the RBD-S gene (AAV5-RBD-S C0 ) results in the production of specific antibodies to RBD-S (Fig. 3).
  • the level of antibodies to RBD-S was comparable to that in the group of animals immunized with the recombinant RBD-S protein (Fig. 4,5).
  • Microneutralization reaction showed that antibodies to the RBD-S protein, which were obtained as a result of immunization of animals with the AAV5-RBD-S C0 product, have a neutralizing activity against the native SARS- CoV-2 (Fig. 8). Further, the titer of neutralizing antibodies in serum samples of animals immunized with the AAV5-RBD-S C0 product was significantly higher as compared to that in serum samples of animals immunized with AAV5-RBD-S WT and was comparable to that in serum samples of COVID-19 convalescents (Fig. 8).
  • the AAV5-based recombinant virus carrying the codon-optimized version of the RBD-S gene of the invention and the vaccine based thereon have a high potential for inducing specific immunity to SARS-CoV-2 and may be used to prevent SARS-CoV-2-related coronavirus infection.
  • the AAV vector is capable of providing long-term antigen expression, they are advantageous over traditional systems based on recombinant protein antigens.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Microbiology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Communicable Diseases (AREA)
  • Mycology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Epidemiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Biotechnology (AREA)
  • Biomedical Technology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Pulmonology (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

La présente demande concerne les domaines de la biotechnologie, de l'immunologie, de la virologie, de la génétique et de la biologie moléculaire. Plus particulièrement, la présente invention concerne un acide nucléique optimisé par codon isolé codant pour un domaine recombinant isolé de liaison au récepteur de la glycoprotéine S (RBD-S) du SARS-CoV-2 (coronavirus 2 lié au syndrome respiratoire aigu sévère), une cassette d'expression et un vecteur basé sur celle-ci, ainsi qu'à un virus recombinant à base d'AAV5 (virus adéno-associé de sérotype 5) pour l'induction d'une immunité spécifique au SARS-CoV-2 et/ou la prévention de l'infection par le coronavirus lié au SARS-CoV-2, à un vaccin à base d'AAV5 pour l'induction d'une immunité spécifique contre le SRAS-CoV-2 et/ou la prévention de l'infection à coronavirus liée au SRAS-CoV-2, et à leur utilisation pour l'induction d'une immunité spécifique contre le SRAS-CoV-2 et/ou la prévention de l'infection à coronavirus liée au SRAS-CoV-2.
PCT/RU2021/050447 2020-12-21 2021-12-21 Vaccin à base d'aav5 pour induction d'une immunité spécifique et/ou prévention d'une infection liée au sars-cov-2 WO2022139631A1 (fr)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
RU2020142220 2020-12-21
RU2020142220A RU2760301C1 (ru) 2020-12-21 2020-12-21 Вакцина на основе AAV5 для индукции специфического иммунитета к вирусу SARS-CoV-2 и/или профилактики коронавирусной инфекции, вызванной SARS-CoV-2

Publications (1)

Publication Number Publication Date
WO2022139631A1 true WO2022139631A1 (fr) 2022-06-30

Family

ID=78719331

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/RU2021/050447 WO2022139631A1 (fr) 2020-12-21 2021-12-21 Vaccin à base d'aav5 pour induction d'une immunité spécifique et/ou prévention d'une infection liée au sars-cov-2

Country Status (4)

Country Link
AR (1) AR124461A1 (fr)
RU (1) RU2760301C1 (fr)
UY (1) UY39582A (fr)
WO (1) WO2022139631A1 (fr)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN117210457A (zh) * 2022-06-10 2023-12-12 拜奥卡德联合股份公司 具有启动子活性的核酸及其用途

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
RU2723008C1 (ru) * 2020-05-19 2020-06-08 федеральное государственное бюджетное учреждение «Национальный исследовательский центр эпидемиологии и микробиологии имени почетного академика Н.Ф. Гамалеи» Министерства здравоохранения Российской Федерации Способ получения штамма клеток яичника китайского хомячка, продуцента рекомбинантного белка RBD вируса SARS-CoV-2, штамм клеток яичника китайского хомячка, продуцент рекомбинантного белка RBD вируса SARS-CoV-2, способ получения рекомбинантного белка RBD вируса SARS-CoV-2, тест-система для иммуноферментного анализа сыворотки или плазмы крови человека и ее применение
CN111560354A (zh) * 2020-05-22 2020-08-21 中国人民解放军总医院第五医学中心 重组新型冠状病毒及其制备方法和应用
CN112023035A (zh) * 2020-04-07 2020-12-04 中国医学科学院医学生物学研究所 一种以SARS-CoV-2病毒S蛋白RBD区为抗原的纳米疫苗及其制备

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
RU2733832C1 (ru) * 2020-07-28 2020-10-07 Федеральное бюджетное учреждение науки "Государственный научный центр вирусологии и биотехнологии "Вектор" Федеральной службы по надзору в сфере защиты прав потребителей и благополучия человека (ФБУН ГНЦ ВБ "Вектор" Роспотребнадзора) Искусственный ген Stbl_RBD_TrM_SC2, кодирующий бицистронную структуру, образованную последовательностями рецепторсвязывающего домена гликопротеина S коронавируса SARS-CoV-2, трансмембранного региона, P2A-пептида и гликопротеина G VSV, рекомбинантная плазмида pStem-rVSV-Stbl_RBD_TrM_SC2, обеспечивающая экспрессию искусственного гена, и рекомбинантный штамм вируса везикулярного стоматита rVSV-Stbl_RBD_TrM_SC2, используемый для создания вакцины против коронавируса SARS-CoV-2

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN112023035A (zh) * 2020-04-07 2020-12-04 中国医学科学院医学生物学研究所 一种以SARS-CoV-2病毒S蛋白RBD区为抗原的纳米疫苗及其制备
RU2723008C1 (ru) * 2020-05-19 2020-06-08 федеральное государственное бюджетное учреждение «Национальный исследовательский центр эпидемиологии и микробиологии имени почетного академика Н.Ф. Гамалеи» Министерства здравоохранения Российской Федерации Способ получения штамма клеток яичника китайского хомячка, продуцента рекомбинантного белка RBD вируса SARS-CoV-2, штамм клеток яичника китайского хомячка, продуцент рекомбинантного белка RBD вируса SARS-CoV-2, способ получения рекомбинантного белка RBD вируса SARS-CoV-2, тест-система для иммуноферментного анализа сыворотки или плазмы крови человека и ее применение
CN111560354A (zh) * 2020-05-22 2020-08-21 中国人民解放军总医院第五医学中心 重组新型冠状病毒及其制备方法和应用

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
KHARCHENKO E. Р.: "The Coronavirus SARS-Cov-2: the Characteristics of Structural Proteins, Contagiousness, and Possible Immune Collisions", EPIDEMIOLOGY AND VACCINAL PREVENTION, NUMIKOM, RUSSIA, vol. 19, no. 2, Russia, pages 13 - 30, XP055954460, ISSN: 2073-3046, DOI: 10.31631/2073-3046-2020-19-2-13-30 *

Also Published As

Publication number Publication date
AR124461A1 (es) 2023-03-29
RU2760301C1 (ru) 2021-11-23
UY39582A (es) 2022-05-31

Similar Documents

Publication Publication Date Title
US20200390866A1 (en) Factor viii sequences
US9775918B2 (en) Capsid-modified rAAV vectors and methods of use
KR102063483B1 (ko) Ａａｖ 캡시드 변이체를 이용한 고효율 유전자 전달을 위한 조성물 및 방법
US10308957B2 (en) rAAV vectors and methods for transduction of photoreceptors and RPE cells
JP2018515096A (ja) 神経成長因子シグナルペプチド及び副甲状腺ホルモンを含むａａｖ分離株及び融合タンパク質
US20220280655A1 (en) New Adeno-Associated Virus (AAV) Variants and Uses Thereof for Gene Therapy
US20240091383A1 (en) Synergistic effect of smn1 and mir-23a in treating spinal muscular atrophy
EP4159863A1 (fr) Acide nucléique optimisé par codons qui code la protéine smn1
US20230321220A1 (en) Aav5-based vaccine against sars-cov-2
WO2022139631A1 (fr) Vaccin à base d'aav5 pour induction d'une immunité spécifique et/ou prévention d'une infection liée au sars-cov-2
RU2761879C1 (ru) Вакцина на основе AAV5 для индукции специфического иммунитета к вирусу SARS-CoV-2 и/или профилактики коронавирусной инфекции, вызванной SARS-CoV-2
RU2783313C1 (ru) Вакцина на основе AAV5 для индукции специфического иммунитета к вирусу SARS-CoV-2 и/или профилактики коронавирусной инфекции, вызванной SARS-CoV-2
US20240076691A1 (en) Codon-optimized nucleic acid encoding the fix protein
OA21369A (en) Codon-optimized nucleic acid encoding the fix protein.
OA21365A (en) Synergistic effect of SMN1 and MIR-23A in treating spinal muscular atrophy.
OA21075A (en) Codon-optimized nucleic acid that encodes SMN1 protein, and use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21911663

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21911663

Country of ref document: EP

Kind code of ref document: A1