WO2022117044A1 - Glp-1/gcg dual receptor agonist polypeptide and fusion protein thereof - Google Patents

Glp-1/gcg dual receptor agonist polypeptide and fusion protein thereof Download PDF

Info

Publication number
WO2022117044A1
WO2022117044A1 PCT/CN2021/135120 CN2021135120W WO2022117044A1 WO 2022117044 A1 WO2022117044 A1 WO 2022117044A1 CN 2021135120 W CN2021135120 W CN 2021135120W WO 2022117044 A1 WO2022117044 A1 WO 2022117044A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
fusion protein
amino acid
glp
acid sequence
Prior art date
Application number
PCT/CN2021/135120
Other languages
French (fr)
Inventor
Peng Jiang
Lin Xiao
Linjun Zhou
Hui Wang
Yi Ling
Xiaofeng Chen
Wenjia LI
Original Assignee
Sunshine Lake Pharma Co., Ltd.
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Sunshine Lake Pharma Co., Ltd. filed Critical Sunshine Lake Pharma Co., Ltd.
Publication of WO2022117044A1 publication Critical patent/WO2022117044A1/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/605Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0681Cells of the genital tract; Non-germinal cells from gonads
    • C12N5/0682Cells of the female genital tract, e.g. endometrium; Non-germinal cells from ovaries, e.g. ovarian follicle cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/10Plasmid DNA
    • C12N2800/106Plasmid DNA for vertebrates
    • C12N2800/107Plasmid DNA for vertebrates for mammalian

Definitions

  • the present invention relates to the field of biomedicine. Specifically, the present invention relates to GLP-1/GCG dual receptor agonist polypeptides, fusion proteins, nucleic acids, constructs, recombinant cells, pharmaceutical compositions and pharmaceutical applications.
  • Obesity is closely related to type II diabetes, hyperlipidemia and hypertension.
  • the main effect of drugs for the tier-1 treatment of type II diabetes is to reduce blood glucose, but the effect of reducing weight is very limited. How to develop a drug with good effects of reducing blood glucose and weight at the same time is the current research and development hotspot in this field.
  • Glucagon-like peptide-1 (GLP-1) is a polypeptide hormone secreted by the intestinal L-cells after eating, which can stimulate the pancreatic ⁇ -cells to secrete insulin, thereby stabilizing the fluctuation of blood glucose after a meal. Its effect of lowering blood glucose is dependent on glucose concentration. While regulating blood glucose, it greatly reduces the risk of hypoglycemia. In recent years, GLP-1 based drugs, such as liraglutide, duraglutide and semaglutide, have gradually occupied a very important position in diabetes drugs. The GLP-1 drugs also have a weight loss effect when lowering blood glucose.
  • GLP-1 acts on the gastrointestinal tract to delay gastric emptying and intestinal peristalsis, and acts on the central nervous system to suppress appetite, so as to achieve the purpose of reducing food intake.
  • liraglutide has been approved as a weight-loss drug
  • its upgraded product semaglutide (trade name is wegovy) has a better weight loss effect and has been approved by the FDA in June 2021.
  • GLP-1 receptor agonists are also obvious, mainly in the following aspects: firstly, the short half-life leads to intensive injection frequency and inconvenience to patients; secondly, the pharmacokinetics and safety are both not clear, and how the introduced exogenous chemical group is metabolized and excreted, and what effects it has on the human body are still unclear, and further research is needed.
  • the preclinical studies have shown that the glucagon-like peptide-1 and glucagon (GLP-1/GCG) dual receptor agonists have shown better weight loss and blood glucose lowering effects than single target GLP-1 agonists, and have a very large development potential.
  • Oxntomodulin is a dual receptor agonist that activates glucagon-like peptide-1 (GLP-1) and glucagon (GCG) .
  • GLP-1 glucagon-like peptide-1
  • GCG glucagon
  • OXM has a good effect of reducing blood glucose and weight in the animal model, which is significantly better than existing GLP-1 drugs, such as liraglutide.
  • some of the problems of oxyntomodulin (OXM) such as poor stability and low receptor activity, lead to large doses and it is difficult to achieve the best effect of blood glucose control and weight loss.
  • the inventors optimized the OXM to improve its stability, and the half-life in vivo is prolonged.
  • the receptor activity is increased, the balance between receptors is optimized, and achieved the best effect of blood glucose control and weight loss.
  • the polypeptide has an amino acid sequence as shown below: 5’ X 1 SQGT FTSDY SKYLD EKX 18 AK X 21 FX 23 EW LX 27 X 28 X 29 X 30 3’ , wherein, X 1 is H or Y; X 18 is R, A or K; X 21 is E or D; X 23 is V or I; X 27 is L or I; X 28 is A or E; X 29 is A or G; X 30 is GPSSGAPPPS or absent; when X 27 is L, X 28 is E.
  • the above-mentioned polypeptide may further comprise at least one of the following additional technical features:
  • the polypeptide has an amino acid sequence as shown below: 5’ X 1 SQGT FTSDY SKYLD EKX 18 AK EFX 23 EW LX 27 X 28 GX 30 3’ , wherein, X 1 is H or Y, X 18 is R, A or K, X 23 is V or I, X 27 is L or I, X 28 is A or E.
  • the polypeptide has an amino acid sequence as shown below: HSQGT FTSDY SKYLD EKX 18 AK EFX 23 EW LX 27 X 28 G;
  • X 18 is R, Aor K, X 23 is V or I, X 27 is L or I, X 28 is A or E.
  • the polypeptide has the aforementioned amino acid sequence, and in the amino acid sequence of the polypeptide, at least one of X 23 or X 27 is I.
  • the polypeptide has an amino acid sequence shown in any one of SEQ ID NO: 1 ⁇ 5.
  • the fusion protein comprises the aforementioned polypeptide, a connecting peptide, and an IgG Fc fragment, and the connecting peptide is arranged between the head and tail of the polypeptide and the IgG Fc fragment.
  • the fusion protein according to the embodiments of the present invention has a good effect of reducing blood glucose and weight, and has a long half-life in the body, and it is an effective long-acting weight-losing and glucose-controlling drug.
  • the aforementioned fusion protein may further comprise at least one of the following additional technical features:
  • the N-terminus of the connecting peptide is connected with the C-terminus of the polypeptide, and the C-terminus of the connecting peptide is connected with the N-terminus of the IgG Fc fragment.
  • the connecting peptide has an amino acid sequence shown in any one of SEQ ID NO: 6 ⁇ 8.
  • GGGGSGGGGSGGGGS SEQ ID NO: 6 .
  • the IgG Fc fragment of the present invention is derived from the Fc region of human IgG1, IgG2, or IgG4 or a mutant thereof. Preferably, it is derived from the Fc region of human IgG4 or a mutant thereof.
  • the IgG Fc fragment is derived from a mutant of the Fc region of human IgG4, which comprises the following amino acid sequence:
  • the IgG4 Fc mutant has three site mutations (EU numbering) of S228P, F234A, and L235A compared with human wild-type IgG4-Fc, and these mutations correspond to the position 10, position 16 and position 17 in SEQ ID NO: 9 respectively.
  • the above mutations can further eliminate the effector functions of IgG4-Fc, such as ADCC and CDC, to improve the safety of the fusion protein.
  • the lysine of K447 at the C-terminal is deleted to avoid the heterogeneity of the fusion protein.
  • the fusion protein has an amino acid sequence shown in any one of SEQ ID NO: 10 ⁇ 14.
  • nucleic acid encodes the aforementioned polypeptide or the aforementioned fusion protein.
  • the construct carries the aforementioned nucleic acid.
  • the construct may further comprise at least one of the following additional technical features:
  • the vector of the construct is pXC17.4.
  • the recombinant cell expresses the aforementioned polypeptide or the aforementioned fusion protein.
  • the recombinant cell comprises the aforementioned construct or the genome of the recombinant cell integrates the aforementioned nucleic acid.
  • the recombinant cell may further comprise at least one of the following additional technical features:
  • the recombinant cell is a CHO cell.
  • the pharmaceutical composition comprises the aforementioned polypeptide or the aforementioned fusion protein.
  • the pharmaceutical composition may further comprise at least one of the following additional technical features:
  • the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
  • the pharmaceutical composition further comprises other anti-diabetic drugs, wherein the other anti-diabetic drugs comprise at least one selected from insulin, biguanides, sulfonylureas, rosiglitazone or pioglitazone, ⁇ -glucosidase inhibitors, and aminodipeptidase IV inhibitors.
  • the other anti-diabetic drugs comprise at least one selected from insulin, biguanides, sulfonylureas, rosiglitazone or pioglitazone, ⁇ -glucosidase inhibitors, and aminodipeptidase IV inhibitors.
  • the protein formulation comprises the aforementioned polypeptide or the aforementioned fusion protein.
  • the protein preparation according to the embodiments of the present invention is an effective long-acting weight-losing and glucose-controlling drug.
  • aforementioned polypeptide or the aforementioned fusion protein or the aforementioned protein formulation in the manufacture of a medicament for treating or preventing metabolic diseases.
  • the metabolic diseases comprise at least one selected from non-alcoholic fatty liver disease (NAFLD) , Non-alcoholic steatohepatitis (NASH) , diabetes, and obesity.
  • NAFLD non-alcoholic fatty liver disease
  • NASH Non-alcoholic steatohepatitis
  • diabetes and obesity.
  • provided herein is a method of treating or preventing metabolic diseases in a subject comprising administering to the subject a therapeutically effective amount of the aforementioned polypeptide or the aforementioned fusion protein or the aforementioned protein formulation.
  • the metabolic diseases comprise at least one selected from non-alcoholic fatty liver disease (NAFLD) , Non-alcoholic steatohepatitis (NASH) , diabetes, and obesity.
  • NAFLD non-alcoholic fatty liver disease
  • NASH Non-alcoholic steatohepatitis
  • diabetes and obesity.
  • aforementioned polypeptide or the aforementioned fusion protein or the aforementioned protein formulation for use in treating or preventing metabolic diseases in a subject.
  • the metabolic diseases comprise at least one selected from non-alcoholic fatty liver disease (NAFLD) , Non-alcoholic steatohepatitis (NASH) , diabetes, and obesity.
  • NAFLD non-alcoholic fatty liver disease
  • NASH Non-alcoholic steatohepatitis
  • diabetes and obesity.
  • Figure 1 is a blood glucose concentration-time curve at different time points after administration of the glucose loaded mice according to the embodiments of the present invention
  • Figure 2 is a blood glucose concentration-time curve at different time points after administration of the glucose loaded mice according to the embodiments of the present invention
  • Figure 3 is a curve of the experimental results showing the effect of the fusion protein on the glucose tolerance of DIO mice according to the embodiments of the present invention.
  • Figure 4 is a curve of the experimental results showing the effect of the fusion protein on the body weight of DIO mice according to the embodiments of the present invention.
  • Figure 5 is a curve of the experimental results showing the fusion protein HEC-C70 on the glucose tolerance of DIO mice according to the embodiments of the present invention.
  • Figure 6 is a curve of the experimental results showing the effect of the fusion protein HEC-C70 on the body weight of DIO mice according to the embodiments of the present invention.
  • Figure 7 is a curve of the experimental results showing the fusion protein HEC-C70 on random blood glucose of db/db mice according to the embodiments of the present invention.
  • Figure 8 is a curve of the experimental results showing the effect of the fusion protein HEC-C70 on the body weight of db/db mice according to the embodiments of the present invention.
  • protein and polypeptide are interchangeable, and in their broadest sense, the terms refer to compounds of two or more subunit amino acids, amino acid analogue, or peptidomimetics.
  • the subunits can be connected by peptide bonds. In another embodiment, the subunits can be connected by other bonds, such as esters, ethers, amino groups, and the like.
  • the protein or polypeptide must contain at least two amino acids and there is no limit to the maximum number of amino acids that can constitute a protein or peptide sequence.
  • amino acid refers to natural and/or unnatural or synthetic amino acids, including D and L optical isomers of amino acids, such as glycine and D and L optical isomers, amino acid analogue, and peptidomimetics.
  • the "Fc fragment” described herein is composed of the hinge regions, CH2 and CH3 constant regions of an antibody.
  • the antibody comprises two functionally independent parts, a variable domain called “Fab” that binds to an antigen and a constant domain called “Fc” that participates in effector functions (such as complement activation and attack by phagocytes) .
  • Fc has a long serum half-life, while Fab has a short life (Capon et al., 1989, Nature 337: 525-31) .
  • the Fc domain can provide a longer half-life, or provide functions such as binding to Fc receptor, binding to protein A, binding to complement, or even placental transfer (Capon et al., 1989) .
  • Fc refers to the wild-type Fc sequence, which is derived from a natural antibody (for example, human IgG1, IgG2, IgG3 or IgG4) , and also comprises variants thereof.
  • the variants may comprise one or more amino acid substitutions, additions, and/or deletions that have been disclosed.
  • the Fc variant has the activity of wild-type Fc, such as binding to Fc receptors.
  • the amino acid number of the IgG4 Fc fragment described herein is numbered according to the EU numbering system.
  • the “S228P” refers to that the serine at position 228 according to the EU numbering system is replaced by proline;
  • the “K447” refers to that the lysine at position 447 according to the EU numbering system is deleted or absent.
  • fusion protein generally refers to a protein obtained by fusing two or more proteins or polypeptides.
  • the genes or nucleic acid molecules encoding the two or more proteins or polypeptides can be linked to each other to form a fusion gene or a fusion nucleic acid molecule, and the fusion gene or fusion nucleic acid molecule can encode the fusion protein.
  • the translation of the fusion gene produces a single polypeptide, which has the properties of at least one or even each of the two or more proteins or polypeptides before the fusion.
  • the recombinant fusion protein is artificially created by recombinant DNA technology used in biological research or therapy.
  • the recombinant fusion protein is a protein created by genetic engineering of fusion gene.
  • the present invention relates to a recombinant fusion protein, and the terms "fusion protein” and "recombinant fusion protein” described herein have the same meaning.
  • the fusion protein described herein generally comprises at least two domains (A and C) , and optionally it comprises a third component, a linker between the two domains.
  • the production of recombinant fusion protein is known in the art, and usually involves removing the stop codon from the cDNA sequence encoding the first protein or polypeptide, and then attaching the cDNA sequence of the second protein in frame by ligation or overlap extension PCR. Then the DNA sequence will be expressed as a single protein by the cell.
  • the protein can be engineered to include the complete sequence of the two original proteins or polypeptides, or only a portion of either.
  • linker or connecting peptide can be used, but not necessarily.
  • the G-rich polypeptide of the present invention can be selected from (G) 3-S (i.e. "GGGS” ) , (G) 4-S (i.e. "GGGGS” ) and (G) 5-S (i.e. "GGGGGS” ) ) .
  • the connecting peptide comprises GGGGSGGGGS (SEQ ID NO: 8) , GGGGSGGGGSGGGGS (SEQ ID NO: 6) , or GGGGSGGGGSGGGGSA (SEQ ID NO: 7) .
  • the linker described herein is exemplary, and the linker can be a much longer linker and a linker comprising other residues.
  • the linker described herein may also be a non-peptide linker.
  • the fusion gene was formed by adding the gene sequence of the SUMO tag at the 5' end of the gene encoding the polypeptide.
  • the fusion gene was cloned into a prokaryotic expression vector and induced expression in E. coli cells. The cells were collected by centrifugation, and then ultrasonically broken and centrifuged to obtain the supernatant, then the supernatant was purified by a nickel column to obtain the fusion protein. Finally, after digestion with SUMO protease, the target polypeptide was obtained by reversed-phase purification.
  • the specific processes are as follows:
  • the pET-28a was used as an expression vector, and BL21 (DE3) was used as a host.
  • the specific steps for preparing the polypeptides are as follows:
  • the primers were designed and served as templates for each other to amplify polypeptide gene fragments.
  • the polypeptide gene fragments and SUMO gene fragments were used as templates.
  • the fusion gene fragments were amplified by fusion PCR method.
  • the constructed BL21 (DE3) bacterial strain was cultured in LB, then kanamycin at a final concentration of 50 ⁇ g/mL was added. IPTG was used to induce expression for 5h after the culture. After centrifugation, the cells were taken and dissolved with equilibration buffer (20mM Tris-HCl, pH8.0, 150mM NaCl) , and the cells were broken by an ultrasonic instrument. The supernatant after centrifugation was used to purify the fusion protein. The supernatant was purified by Ni-NTA affinity chromatography column (GE Healthcare) and eluted with elution buffer (20mM Tris-HCl, pH8.0, 150mM NaCl, 200mM imidazole) to obtain the fusion protein.
  • equilibration buffer 20mM Tris-HCl, pH8.0, 150mM NaCl, 200mM imidazole
  • polypeptides prepared by expression human GLP-1 (SEQ ID NO: 17, TOCRIS Company, catalog number 5374 (BATH: 2A) ) and GCG (SEQ ID NO: 18, Novo Nordisk, Novo Sang) were applied to the HEK293 cells expressing GLP-1R or GCGR respectively.
  • the specific operations are:
  • the genes GCGR and GLP-1R were optimized and routinely synthesized in Jinweizhi Company, and the genes were cloned into the vector pUC57-Amp.
  • the mini-scale recombinant plasmid DNA and puncture bacteria containing the recombinant plasmid were prepared;
  • pUC57-GCGR recombinant plasmid DNA was taken and double digested with Hind III and EcoR I
  • pUC57-GLP-1R was taken and double digested with Hind III and Xho I. After the digested product was electrophoresed on 1%agarose gel, the target strip was cut with a clean blade, and the target fragment was recovered by a gel extraction kit;
  • Human GLP-1 HAEGT FTSDV SSYLE GQAAK EFIAW LVKGRG (SEQ ID NO: 17)
  • the target fragment digested and recovered product and the vector plasmid pcDNA3.1 fragment were linked by T4 ligase and then transformed into DH5 ⁇ competent cells.
  • the plates were coated with the transformed DH5 ⁇ competent cells to separate single colonies, and the transformants were picked for expanding culture, and verified by restriction enzyme digestion and sequencing.
  • the host cell was HEK293.
  • the cells were plated in a 6-well plate at a density of 2 ⁇ 10 6 cells/well, 1 mL/well.
  • the recovered linearized plasmid was transfected into HEK293 cells by Lipofectamine 3000 liposome transfection method. G418 was added to screen to obtain a mixed strain, and then a single clone was obtained by limiting dilution and separation, and the activity test was carried out.
  • the cAMP detection kit (Cisbio, 62AM6PEC) was used to detect cAMP produced by the recipient cells according to the steps described in the operating instructions. The specific steps were as follows:
  • test sample and the control sample human GLP-1 and GCG were diluted to a stock solution with an initial concentration of 500 nM, and then 20 ⁇ L of the stock solution was added to 80 ⁇ L Assay buffer (diluted 5 times) for gradient dilution. There were 8 compound concentration gradients including the stock solution;
  • a 384-well plate was divided into GLP-1R cells area and GCGR cells area.
  • a 12-lane change adjustable dispenser was used and the cell suspension was added to the wells in the corresponding area with 5 ⁇ L/well.
  • the test sample and the positive control sample gradient dilution were added to the 384-well plate corresponding to the cells by using the 12-lane change adjustable dispenser with 5 ⁇ L/well (2 replicate wells for the same concentration sample) .
  • Negative control 10 ⁇ L assay buffer/well, each 384-well plate was set with 3 holes and covered with a white sealing film, then placed in a 37°C constant temperature incubator. The plate was taken out after half an hour;
  • the cAMP-d2 working solution and anti-cAMP-crytate working solution were diluted to 20 times with lysis buffer in the Hi-range kit, and mixed with 1: 1 to form a cAMP detection reagent mixed solution.
  • cAMP detection reagent mixed solution was added with 10 ⁇ L/well.
  • 5 ⁇ L of lysis buffer and 5 ⁇ L of diluted anti-cAMP-crytate working solution were added to each well. The plate was covered with a white lid, and stored at room temperature in the dark for 1 hour;
  • the Chinese hamster ovary cells were resuscitated and subcultured. When the density was about 6*106 cells/mL, the cells were collected and transfected by using ExpiCHOFectamineTM CHO Transfection Kit (ThermoFisher Scientific) . The final concentration of the vector constructed in Example 2 was 1 ⁇ g /mL. Reagents such as enhancers were added on the second day of the transfection to maintain the growth of the transfected cells. The cell culture solution was harvested when the cell viability lowered to about 80%.
  • the cell culture solution was centrifuged and the supernatant was collected, and the residual cell debris were removed by filtering with a 0.22 ⁇ m filter.
  • the collected cell culture solution was purified by a Protein A chromatography column, the target peak was collected, and then further purified by anion exchange chromatography.
  • the protein was finally eluted and collected with 0.02M PBS.
  • the samples were quantified using a micro-nucleic acid protein analyzer (NanoDrop 2000/2000c Spectrophotometer) .
  • the samples were detected by 12%SDS-PAGE electrophoresis, and the electrophoresis pattern showed as a single band.
  • the precise molecular weight of the fusion protein was determined by mass spectrometry, and it was basically consistent with the theoretical molecular weight.
  • HEK293 cells expressing GLP-1R or GCGR were stimulated by the fusion protein.
  • cAMP detection kit (Cisbio, 62AM6PEC) was used to detect the cAMP produced by the recipient cells.
  • a dose-effect curve was established, and the EC 50 values were calculated and compared with each other. The results are shown in Table 3.
  • mice Normal C57BL/6 mice were divided into 6 groups according to blood glucose and body weight (Control, Dulaglutide -7.5nmol/kg, HEC-C80-7.5nmol/kg, HEC-C85-7.5nmol/kg, HEC-C86-7.5 nmol/kg, HEC-C87-7.5nmol/kg) , 6 mice per group.
  • the corresponding menstruum or candidate was administered by subcutaneous injection, the mice were fasted 56h after administration, and the mice in each group were injected intraperitoneally with 2g/kg glucose 72h after administration.
  • the blood glucose test was performed before and 15, 30, 60, and 90 minutes after glucose administration. The results are shown in Table 4.
  • the blood glucose concentration-time curve was plotted according to the blood glucose measured at different time points, as shown in Figure 1.
  • the blood glucose drop rate of each dose group of AUC 0 ⁇ 90min Glu and at the peak blood glucose were calculated.
  • HEC-C80, HEC-C85, HEC-C86 and HEC-C87 can significantly reduce the blood glucose level of glucose loaded mice.
  • mice Normal C57BL/6 mice were divided into 3 groups according to blood glucose and body weight (Control, Dulaglutide-7.5nmol/kg, HEC-C70-7.5nmol/kg) , 8 mice per group. The corresponding menstruum or candidate was administered by subcutaneous injection, the mice were fasted 56h after administration, and the mice in each group were injected intraperitoneally with 2g/kg glucose 72h after administration. The blood glucose test was performed before and 15, 30, 60, and 90 minutes after glucose administration. The results are shown in Table 5. The blood glucose concentration-time curve was plotted according to the blood glucose measured at different time points, as shown in Figure 2. The blood glucose drop rate of each dose group of AUC 0 ⁇ 90min Glu and at the peak blood glucose were calculated.
  • HEC-C70 can significantly reduce the blood glucose level of glucose loaded mice.
  • mice 8-week-old C57BL/6 mice were fed with high-fat diet for 15 weeks and divided into 7 groups according to body weight (Model, semaglutide-5nmol/kg, HEC-C70-5nmol/kg, HEC-C80-5nmol/kg, HEC-C85-5nmol/kg, HEC-C86-5nmol/kg, HEC-C87-5nmol/kg) . From the 16th week, the mice were administered (the model group was administered the corresponding menstruum) . The semaglutide group was administered once a day, and the other groups were administered twice a week, and a total of 4 weeks of administration. The mice were weighed before each administration and the IPGTT experiment was carried out in 4 weeks.
  • HEC-C70-5nmol/kg the effect of HEC-C70-5nmol/kg on improving glucose tolerance is similar to semaglutide-10nmol/kg.
  • HEC-C70-5nmol/kg, HEC-C80-5nmol/kg, HEC-C85-5nmol/kg, HEC-C86-5nmol/kg and HEC-C87-5nmol/kg all have a significant effect on reducing the body weight of DIO mice, and the effects of HEC-C70-5nmol/kg and HEC-C85-5nmol/kg are better than semaglutide-5nmol/kg.
  • the specific data are shown in Table 6, Table 7, Figure 3 and Figure 4.
  • HEC-C70, HEC-C80, HEC-C85, HEC-C86, HEC-C87 can significantly improve the glucose tolerance and significantly reduce the body weight of DIO mice.
  • mice 6-week-old C57BL/6N mice were fed with high-fat diet for 15 weeks and divided into 6 groups according to body weight (Model, LY3298176-10nmo/kg, semaglutide-10nmol/kg, MEDI0382-10nmol/kg, HEC-C70-2.5nmol/kg, HEC-C70-10nmol/kg) . From the 16th week, the mice were administered (the model group was administered the corresponding menstruum) . The semaglutide group and MEDI0382 group were administered once a day, and the other groups were administered twice a week, and a total of 4 weeks of administration. The mice were weighed before each administration and the IPGTT experiment was carried out in 4 weeks.
  • Control group LY3298176 sequence YX 1 EGTFTSDYSIX 2 LDKIAQKAFVQWLIAGGPSSGAPPPS-NH 2 (SEQ ID NO: 15) , wherein the X 1 and X 2 are Aib, and K at position 20 is connected with ( [2- (2-amino-ethoxy) -ethoxy] -acetyl) 2 - ⁇ Glu-CO- (CH 2 ) 18 -CO 2 H through the side chain ⁇ -amino.
  • HEC-C70-10nmol/kg has a significant effect on reducing the body weight of DIO mice, and it is better than semaglutide-10nmol/kg.
  • Table 8 The effect of long-term administration on the rate of blood glucose drop of DIO mice with glucose load
  • HEC-C70 Long-term administration of HEC-C70 can significantly improve the glucose tolerance and significantly reduce the body weight of DIO mice.
  • Ob/ob mice aged 6-7 weeks were divided into 3 groups (Model, Dulaglutide-30nmo/kg, HEC-C70-30nmol/kg) according to random blood glucose and body weight.
  • Ob/ob mice were administered for a total of 4 weeks (the model group was administered the corresponding menstruum) , Dulaglutide and HEC-C70 were administered twice a week. During the administration, the random blood glucose and body weight of the mice in each group were monitored.
  • HEC-C70-30nmol/kg has a significant effect on reducing the body weight of db/db mice, and it is better than Dulaglutide-30nmol/kg.
  • the specific data are shown in Table 10, Table 11, Figure 7 and Figure 8.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Genetics & Genomics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Diabetes (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Endocrinology (AREA)
  • Biotechnology (AREA)
  • Biophysics (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Molecular Biology (AREA)
  • Wood Science & Technology (AREA)
  • Toxicology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Pain & Pain Management (AREA)
  • Rheumatology (AREA)
  • Emergency Medicine (AREA)
  • Child & Adolescent Psychology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Cell Biology (AREA)
  • Reproductive Health (AREA)

Abstract

Provided are a GLP-1/GCG dual receptor agonist polypeptide and a fusion protein containing the GLP-1/GCG dual receptor agonist polypeptide. The GLP-1/GCG dual receptor agonist polypeptide and fusion protein have different mutation sites from the existing published polypeptide or fusion protein. The polypeptide or fusion protein provided herein has good effect on reducing blood glucose and weight, and has a long half-life in vivo, which is a more effective weight-losing and glucose-controlling drug.

Description

GLP-1/GCG DUAL RECEPTOR AGONIST POLYPEPTIDE AND FUSION PROTEIN THEREOF
CROSS-REFERENCE TO RELATED APPLICATION
This application claims the priority and benefits of Chinese Patent Application No. 202011405942. X, filed with the State Intellectual Property Office of China on December 03, 2020, which is incorporated herein by reference in its entirety.
FIELD
The present invention relates to the field of biomedicine. Specifically, the present invention relates to GLP-1/GCG dual receptor agonist polypeptides, fusion proteins, nucleic acids, constructs, recombinant cells, pharmaceutical compositions and pharmaceutical applications.
BACKGROUND
Obesity is closely related to type II diabetes, hyperlipidemia and hypertension. At present, the main effect of drugs for the tier-1 treatment of type II diabetes is to reduce blood glucose, but the effect of reducing weight is very limited. How to develop a drug with good effects of reducing blood glucose and weight at the same time is the current research and development hotspot in this field.
Glucagon-like peptide-1 (GLP-1) is a polypeptide hormone secreted by the intestinal L-cells after eating, which can stimulate the pancreatic β-cells to secrete insulin, thereby stabilizing the fluctuation of blood glucose after a meal. Its effect of lowering blood glucose is dependent on glucose concentration. While regulating blood glucose, it greatly reduces the risk of hypoglycemia. In recent years, GLP-1 based drugs, such as liraglutide, duraglutide and semaglutide, have gradually occupied a very important position in diabetes drugs. The GLP-1 drugs also have a weight loss effect when lowering blood glucose. The mechanism is that GLP-1 acts on the gastrointestinal tract to delay gastric emptying and intestinal peristalsis, and acts on the central nervous system to suppress appetite, so as to achieve the purpose of reducing food intake. Prior to this, liraglutide has been approved as a weight-loss drug, and its upgraded product semaglutide (trade name is wegovy) has a better weight loss effect and has been approved by the FDA in June 2021.
However, clinical trials have proved that the shortcomings of GLP-1 receptor agonists are also obvious, mainly in the following aspects: firstly, the short half-life leads to intensive injection frequency and inconvenience to patients; secondly, the pharmacokinetics and safety are both not  clear, and how the introduced exogenous chemical group is metabolized and excreted, and what effects it has on the human body are still unclear, and further research is needed. The preclinical studies have shown that the glucagon-like peptide-1 and glucagon (GLP-1/GCG) dual receptor agonists have shown better weight loss and blood glucose lowering effects than single target GLP-1 agonists, and have a very large development potential.
Oxntomodulin (OXM) is a dual receptor agonist that activates glucagon-like peptide-1 (GLP-1) and glucagon (GCG) . Studies have shown that OXM has a good effect of reducing blood glucose and weight in the animal model, which is significantly better than existing GLP-1 drugs, such as liraglutide. However, some of the problems of oxyntomodulin (OXM) , such as poor stability and low receptor activity, lead to large doses and it is difficult to achieve the best effect of blood glucose control and weight loss.
SUMMARY OF THE INVENTION
In order to solve the above problems, the inventors optimized the OXM to improve its stability, and the half-life in vivo is prolonged. The receptor activity is increased, the balance between receptors is optimized, and achieved the best effect of blood glucose control and weight loss.
Based on the above optimization and transformation results, the technical solution provided by the present invention is:
In the first aspect, provided herein is a GLP-1/GCG dual receptor agonist polypeptide. According to the embodiments of the present invention, the polypeptide has an amino acid sequence as shown below:  5’X 1SQGT FTSDY SKYLD EKX 18AK X 21FX 23EW LX 27X 28X 29X 30 3’, wherein, X 1 is H or Y; X 18 is R, A or K; X 21 is E or D; X 23 is V or I; X 27 is L or I; X 28 is A or E; X 29 is A or G; X 30 is GPSSGAPPPS or absent; when X 27 is L, X 28 is E.
According to the embodiments of the present invention, the above-mentioned polypeptide may further comprise at least one of the following additional technical features:
According to the embodiments of the present invention, the polypeptide has an amino acid sequence as shown below:  5’X 1SQGT FTSDY SKYLD EKX 18AK EFX 23EW LX 27X 28GX 30 3’, wherein, X 1 is H or Y, X 18 is R, A or K, X 23 is V or I, X 27 is L or I, X 28 is A or E.
According to the embodiments of the present invention, the polypeptide has an amino acid sequence as shown below: HSQGT FTSDY SKYLD EKX 18AK EFX 23EW LX 27X 28G;
wherein, X 18 is R, Aor K, X 23 is V or I, X 27 is L or I, X 28 is A or E.
According to the embodiments of the present invention, the polypeptide has the aforementioned amino acid sequence, and in the amino acid sequence of the polypeptide, at least one of X 23 or X 27 is I.
According to the embodiments of the present invention, the polypeptide has an amino acid sequence shown in any one of SEQ ID NO: 1~5.
HSQGT FTSDY SKYLD EKAAK EFIEW LLEG (SEQ ID NO: 1) .
HSQGT FTSDY SKYLD EKRAK EFIEW LIAG (SEQ ID NO: 2) .
HSQGT FTSDY SKYLD EKRAK EFVEW LIAG (SEQ ID NO: 3) .
HSQGT FTSDY SKYLD EKKAK EFIEW LIAG (SEQ ID NO: 4) .
HSQGT FTSDY SKYLD EKKAK EFVEW LIAG (SEQ ID NO: 5) .
The inventors found that the GLP-1/GCG dual receptor agonist polypeptide with the amino acid sequence shown in SEQ ID NO: 1~5 has strong in vitro biological activity on GLP-1R and GCGR cells, and at the same time, the in vivo experimental research results show that the GLP-1/GCG dual receptor agonist polypeptide with the amino acid sequence shown in SEQ ID NO: 1~5 has significant effects in controlling body weight and reducing blood glucose.
In the second aspect, provided herein is a fusion protein. According to the embodiments of the present invention, the fusion protein comprises the aforementioned polypeptide, a connecting peptide, and an IgG Fc fragment, and the connecting peptide is arranged between the head and tail of the polypeptide and the IgG Fc fragment. The fusion protein according to the embodiments of the present invention has a good effect of reducing blood glucose and weight, and has a long half-life in the body, and it is an effective long-acting weight-losing and glucose-controlling drug.
According to the embodiments of the present invention, the aforementioned fusion protein may further comprise at least one of the following additional technical features:
According to the embodiments of the present invention, the N-terminus of the connecting peptide is connected with the C-terminus of the polypeptide, and the C-terminus of the connecting peptide is connected with the N-terminus of the IgG Fc fragment.
According to the embodiments of the present invention, the connecting peptide has an amino acid sequence shown in any one of SEQ ID NO: 6~8.
GGGGSGGGGSGGGGS (SEQ ID NO: 6) .
GGGGSGGGGSGGGGSA (SEQ ID NO: 7) .
GGGGSGGGGS (SEQ ID NO: 8) .
The IgG Fc fragment of the present invention is derived from the Fc region of human IgG1, IgG2, or IgG4 or a mutant thereof. Preferably, it is derived from the Fc region of human IgG4 or a mutant thereof.
According to the embodiments of the present invention, the IgG Fc fragment is derived from a mutant of the Fc region of human IgG4, which comprises the following amino acid sequence:
Figure PCTCN2021135120-appb-000001
Figure PCTCN2021135120-appb-000002
Wherein, the IgG4 Fc mutant has three site mutations (EU numbering) of S228P, F234A, and L235A compared with human wild-type IgG4-Fc, and these mutations correspond to the position 10, position 16 and position 17 in SEQ ID NO: 9 respectively. The above mutations can further eliminate the effector functions of IgG4-Fc, such as ADCC and CDC, to improve the safety of the fusion protein. At the same time, the lysine of K447 at the C-terminal is deleted to avoid the heterogeneity of the fusion protein.
According to the embodiments of the present invention, the fusion protein has an amino acid sequence shown in any one of SEQ ID NO: 10~14.
Figure PCTCN2021135120-appb-000003
Figure PCTCN2021135120-appb-000004
Figure PCTCN2021135120-appb-000005
Figure PCTCN2021135120-appb-000006
Figure PCTCN2021135120-appb-000007
Figure PCTCN2021135120-appb-000008
Figure PCTCN2021135120-appb-000009
Figure PCTCN2021135120-appb-000010
Figure PCTCN2021135120-appb-000011
Figure PCTCN2021135120-appb-000012
In the third aspect, provided herein is a nucleic acid. According to the embodiments of the present invention, the nucleic acid encodes the aforementioned polypeptide or the aforementioned fusion protein.
In the fourth aspect, provided herein is a construct. According to the embodiments of the present invention, the construct carries the aforementioned nucleic acid.
According to the embodiments of the present invention, the construct may further comprise at least one of the following additional technical features:
According to the embodiments of the present invention, the vector of the construct is pXC17.4.
In the fifth aspect, provided herein is a recombinant cell. According to the embodiments of the present invention, the recombinant cell expresses the aforementioned polypeptide or the aforementioned fusion protein.
In the sixth aspect, provided herein is a recombinant cell. According to the embodiments of the present invention, the recombinant cell comprises the aforementioned construct or the genome of the recombinant cell integrates the aforementioned nucleic acid.
According to the embodiments of the present invention, the recombinant cell may  further comprise at least one of the following additional technical features:
According to the embodiments of the present invention, the recombinant cell is a CHO cell.
In the seventh aspect, provided herein is a pharmaceutical composition. According to the embodiments of the present invention, the pharmaceutical composition comprises the aforementioned polypeptide or the aforementioned fusion protein.
According to the embodiments of the present invention, the pharmaceutical composition may further comprise at least one of the following additional technical features:
According to the embodiments of the present invention, the pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
According to the embodiments of the present invention, the pharmaceutical composition further comprises other anti-diabetic drugs, wherein the other anti-diabetic drugs comprise at least one selected from insulin, biguanides, sulfonylureas, rosiglitazone or pioglitazone, α-glucosidase inhibitors, and aminodipeptidase IV inhibitors.
In the eighth aspect, provided herein is a protein formulation. According to the embodiments of the present invention, the protein formulation comprises the aforementioned polypeptide or the aforementioned fusion protein. The protein preparation according to the embodiments of the present invention is an effective long-acting weight-losing and glucose-controlling drug.
In the ninth aspect, provided herein is use of the aforementioned polypeptide or the aforementioned fusion protein or the aforementioned protein formulation in the manufacture of a medicament for treating or preventing metabolic diseases.
According to the embodiments of the present invention, the metabolic diseases comprise at least one selected from non-alcoholic fatty liver disease (NAFLD) , Non-alcoholic steatohepatitis (NASH) , diabetes, and obesity.
In another aspect, provided herein is a method of treating or preventing metabolic diseases in a subject comprising administering to the subject a therapeutically effective amount of the aforementioned polypeptide or the aforementioned fusion protein or the aforementioned protein formulation.
According to the embodiments of the present invention, the metabolic diseases comprise at least one selected from non-alcoholic fatty liver disease (NAFLD) , Non-alcoholic  steatohepatitis (NASH) , diabetes, and obesity.
In another aspect, provided herein is the aforementioned polypeptide or the aforementioned fusion protein or the aforementioned protein formulation for use in treating or preventing metabolic diseases in a subject.
According to the embodiments of the present invention, the metabolic diseases comprise at least one selected from non-alcoholic fatty liver disease (NAFLD) , Non-alcoholic steatohepatitis (NASH) , diabetes, and obesity.
DESCRIPTION OF THE DRAWINGS
Figure 1 is a blood glucose concentration-time curve at different time points after administration of the glucose loaded mice according to the embodiments of the present invention;
Figure 2 is a blood glucose concentration-time curve at different time points after administration of the glucose loaded mice according to the embodiments of the present invention;
Figure 3 is a curve of the experimental results showing the effect of the fusion protein on the glucose tolerance of DIO mice according to the embodiments of the present invention;
Figure 4 is a curve of the experimental results showing the effect of the fusion protein on the body weight of DIO mice according to the embodiments of the present invention;
Figure 5 is a curve of the experimental results showing the fusion protein HEC-C70 on the glucose tolerance of DIO mice according to the embodiments of the present invention;
Figure 6 is a curve of the experimental results showing the effect of the fusion protein HEC-C70 on the body weight of DIO mice according to the embodiments of the present invention;
Figure 7 is a curve of the experimental results showing the fusion protein HEC-C70 on random blood glucose of db/db mice according to the embodiments of the present invention;
Figure 8 is a curve of the experimental results showing the effect of the fusion protein HEC-C70 on the body weight of db/db mice according to the embodiments of the present invention.
EXAMPLES
Embodiments of the present invention are described in detail below, and examples of the embodiments are shown in figures. The embodiments described below with reference to the figures are exemplary and are intended to explain the present invention and should not be construed  as limiting the present invention.
DEFINITION OF TERMS
The terms "protein" and "polypeptide" are interchangeable, and in their broadest sense, the terms refer to compounds of two or more subunit amino acids, amino acid analogue, or peptidomimetics. The subunits can be connected by peptide bonds. In another embodiment, the subunits can be connected by other bonds, such as esters, ethers, amino groups, and the like. The protein or polypeptide must contain at least two amino acids and there is no limit to the maximum number of amino acids that can constitute a protein or peptide sequence. The term "amino acid" as used herein refers to natural and/or unnatural or synthetic amino acids, including D and L optical isomers of amino acids, such as glycine and D and L optical isomers, amino acid analogue, and peptidomimetics.
The "Fc fragment" described herein is composed of the hinge regions, CH2 and CH3 constant regions of an antibody. The antibody comprises two functionally independent parts, a variable domain called "Fab" that binds to an antigen and a constant domain called "Fc" that participates in effector functions (such as complement activation and attack by phagocytes) . Fc has a long serum half-life, while Fab has a short life (Capon et al., 1989, Nature 337: 525-31) . When linked to therapeutic proteins, the Fc domain can provide a longer half-life, or provide functions such as binding to Fc receptor, binding to protein A, binding to complement, or even placental transfer (Capon et al., 1989) . The term "Fc" used herein refers to the wild-type Fc sequence, which is derived from a natural antibody (for example, human IgG1, IgG2, IgG3 or IgG4) , and also comprises variants thereof. The variants may comprise one or more amino acid substitutions, additions, and/or deletions that have been disclosed. In some embodiments, the Fc variant has the activity of wild-type Fc, such as binding to Fc receptors.
The amino acid number of the IgG4 Fc fragment described herein is numbered according to the EU numbering system. For example, the “S228P” refers to that the serine at position 228 according to the EU numbering system is replaced by proline; the “K447” refers to that the lysine at position 447 according to the EU numbering system is deleted or absent.
The term "fusion protein" generally refers to a protein obtained by fusing two or more proteins or polypeptides. The genes or nucleic acid molecules encoding the two or more proteins or polypeptides can be linked to each other to form a fusion gene or a fusion nucleic acid molecule, and the fusion gene or fusion nucleic acid molecule can encode the fusion protein. The translation  of the fusion gene produces a single polypeptide, which has the properties of at least one or even each of the two or more proteins or polypeptides before the fusion. The recombinant fusion protein is artificially created by recombinant DNA technology used in biological research or therapy. The recombinant fusion protein is a protein created by genetic engineering of fusion gene. The present invention relates to a recombinant fusion protein, and the terms "fusion protein" and "recombinant fusion protein" described herein have the same meaning. The fusion protein described herein generally comprises at least two domains (A and C) , and optionally it comprises a third component, a linker between the two domains. The production of recombinant fusion protein is known in the art, and usually involves removing the stop codon from the cDNA sequence encoding the first protein or polypeptide, and then attaching the cDNA sequence of the second protein in frame by ligation or overlap extension PCR. Then the DNA sequence will be expressed as a single protein by the cell. The protein can be engineered to include the complete sequence of the two original proteins or polypeptides, or only a portion of either.
When forming the fusion protein of the present invention, linker or connecting peptide can be used, but not necessarily. The G-rich polypeptide of the present invention can be selected from (G) 3-S (i.e. "GGGS" ) , (G) 4-S (i.e. "GGGGS" ) and (G) 5-S (i.e. "GGGGGS" ) ) . In some embodiments, the connecting peptide comprises GGGGSGGGGS (SEQ ID NO: 8) , GGGGSGGGGSGGGGS (SEQ ID NO: 6) , or GGGGSGGGGSGGGGSA (SEQ ID NO: 7) . The linker described herein is exemplary, and the linker can be a much longer linker and a linker comprising other residues. The linker described herein may also be a non-peptide linker.
As described herein, the term "comprise" , "include" or "contain" generally refers to the inclusion of the stated elements, but does not exclude other elements.
Example 1 Preparation method of GLP-1/GCG dual receptor agonist polypeptide
The fusion gene was formed by adding the gene sequence of the SUMO tag at the 5' end of the gene encoding the polypeptide. The fusion gene was cloned into a prokaryotic expression vector and induced expression in E. coli cells. The cells were collected by centrifugation, and then ultrasonically broken and centrifuged to obtain the supernatant, then the supernatant was purified by a nickel column to obtain the fusion protein. Finally, after digestion with SUMO protease, the target polypeptide was obtained by reversed-phase purification. The specific processes are as follows:
1. Vector construction and primer synthesis
The pET-28a was used as an expression vector, and BL21 (DE3) was used as a host. The specific steps for preparing the polypeptides are as follows:
1) The primers were designed and served as templates for each other to amplify polypeptide gene fragments. The polypeptide gene fragments and SUMO gene fragments were used as templates. The fusion gene fragments were amplified by fusion PCR method.
2) Construction of recombinant expression vector: the fusion gene fragments were cloned into prokaryotic expression vector pET-28a, then transformed into E. coli BL21 (DE3) . The recombinants were selected and the recombinant expression plasmid samples were sent to Guangzhou Aiji Biotechnology Co., Ltd. for sequencing verification.
2. Expression and purification
The constructed BL21 (DE3) bacterial strain was cultured in LB, then kanamycin at a final concentration of 50μg/mL was added. IPTG was used to induce expression for 5h after the culture. After centrifugation, the cells were taken and dissolved with equilibration buffer (20mM Tris-HCl, pH8.0, 150mM NaCl) , and the cells were broken by an ultrasonic instrument. The supernatant after centrifugation was used to purify the fusion protein. The supernatant was purified by Ni-NTA affinity chromatography column (GE Healthcare) and eluted with elution buffer (20mM Tris-HCl, pH8.0, 150mM NaCl, 200mM imidazole) to obtain the fusion protein.
3. Digestion of fusion protein
After the protein solution was diluted with equilibration buffer, SUMO protease was added according to the ratio of protein: SUMO protease = 50: 1, and the protein was digested for 1.5h at room temperature.
4. Purification of polypeptides
20%Acetonitrile was added to the polypeptide aqueous solution obtained after digestion. The mixture was passed through a 4.6*250mm C8 packed column with 8μm particle size (Nanomicro UniSil 8-120 C8 Ultra Plus 8 um 4.6*250mm, Suzhou Nanomicro Technology Co., Ltd. ) . Purification was carried out in the AKTA purification system. The purification system was started with 20%acetonitrile/H 2O (containing 20mM Tris-HCl, pH 8.0) and the proportion of acetonitrile was increased at a gradient of 1%/min, the flow rate was 1mL/min. The column was eluted for 30 minutes, and the peptide-containing component was collected. Liquid-mass spectrometry was used to analyze the separated products. The amino acid sequence of the obtained GLP-1/GCG dual receptor agonist polypeptide and the sample name of the corresponding  polypeptide sample are shown in Table 1.
Table 1
SEQ ID sample name amino acid sequences
1 HEC-C080 HSQGT FTSDY SKYLD EKAAK EFIEW LLEG
2 HEC-C070 HSQGT FTSDY SKYLD EKRAK EFIEW LIAG
3 HEC-C085 HSQGT FTSDY SKYLD EKRAK EFVEW LIAG
4 HEC-C086 HSQGT FTSDY SKYLD EKKAK EFIEW LIAG
5 HEC-C087 HSQGT FTSDY SKYLD EKKAK EFVEW LIAG
Example 2 Determination of the in vitro activity of the polypeptide
The polypeptides prepared by expression, human GLP-1 (SEQ ID NO: 17, TOCRIS Company, catalog number 5374 (BATH: 2A) ) and GCG (SEQ ID NO: 18, Novo Nordisk, Novo Sang) were applied to the HEK293 cells expressing GLP-1R or GCGR respectively. The specific operations are:
1. The genes GCGR and GLP-1R were optimized and routinely synthesized in Jinweizhi Company, and the genes were cloned into the vector pUC57-Amp. The mini-scale recombinant plasmid DNA and puncture bacteria containing the recombinant plasmid were prepared;
2. pUC57-GCGR recombinant plasmid DNA was taken and double digested with Hind III and EcoR I, pUC57-GLP-1R was taken and double digested with Hind III and Xho I. After the digested product was electrophoresed on 1%agarose gel, the target strip was cut with a clean blade, and the target fragment was recovered by a gel extraction kit;
Human GLP-1: HAEGT FTSDV SSYLE GQAAK EFIAW LVKGRG (SEQ ID NO: 17)
Human GCG: HSQGT FTSDY SKYLD SRRAQ DFVQW LMNT (SEQ ID NO: 18)
3. the target fragment digested and recovered product and the vector plasmid pcDNA3.1 fragment were linked by T4 ligase and then transformed into DH5α competent cells. The plates were coated with the transformed DH5α competent cells to separate single colonies, and the transformants were picked for expanding culture, and verified by restriction enzyme digestion and sequencing.
4. 200 mL of the verified and correct bacterial solution was inoculated for large-scale plasmid extraction, the used kit was PureLink HiPure Plasmid Maxiprep Kit, and operated according to the instructions. After the plasmid was verified by PCR and restriction enzyme  digestion, it was linearized with pvuI restriction enzyme. Finally, the plasmid was recovered by ethanol precipitation.
5. The host cell was HEK293. One day before transfection, the cells were plated in a 6-well plate at a density of 2×10 6 cells/well, 1 mL/well. The recovered linearized plasmid was transfected into HEK293 cells by Lipofectamine 3000 liposome transfection method. G418 was added to screen to obtain a mixed strain, and then a single clone was obtained by limiting dilution and separation, and the activity test was carried out.
6. The cAMP detection kit (Cisbio, 62AM6PEC) was used to detect cAMP produced by the recipient cells according to the steps described in the operating instructions. The specific steps were as follows:
1) preparation of Assay buffer: complete culture solution (DMEM medium + 10%FBS) was taken and then 4/1000 of 500 mM IBMX stock solution was added. cAMP-d2 working solution and anti-cAMP-crytate working solution was prepared according to the kit instructions;
2) the test sample and the control sample human GLP-1 and GCG were diluted to a stock solution with an initial concentration of 500 nM, and then 20 μL of the stock solution was added to 80 μL Assay buffer (diluted 5 times) for gradient dilution. There were 8 compound concentration gradients including the stock solution;
3) preparation of cell suspension: The cells HEK293-GLP-1R and HEK293-GCGR were taken out from the liquid nitrogen tank, then added into a 37℃ water bath immediately. After the cells were completely thawed within 1.5 minutes, the cells were added dropwise to a 15mL centrifuge tube containing 8mL warm medium on the ultraclean table. The centrifuge tube was centrifuged at 900rpm for 5min, and the supernatant was discarded. The cells were resuspended in 1mL of complete culture solution (pipetted 15 times) , 20μL of the suspension was taken immediately and mixed with equal volume of Trypan Blue. 20μL of the mixed solution was taken to count the number of living cells, then the cells were diluted to 4 x 10 5 cells/mL;
4) a 384-well plate was divided into GLP-1R cells area and GCGR cells area. A 12-lane change adjustable dispenser was used and the cell suspension was added to the wells in the corresponding area with 5μL/well. The test sample and the positive control sample gradient dilution were added to the 384-well plate corresponding to the cells by using the 12-lane change adjustable dispenser with 5μL/well (2 replicate wells for the same concentration sample) . Negative control: 10 μL assay buffer/well, each 384-well plate was set with 3 holes and covered with a white sealing film,  then placed in a 37℃ constant temperature incubator. The plate was taken out after half an hour;
5) before use, the cAMP-d2 working solution and anti-cAMP-crytate working solution were diluted to 20 times with lysis buffer in the Hi-range kit, and mixed with 1: 1 to form a cAMP detection reagent mixed solution. In the sample group, cAMP detection reagent mixed solution was added with 10μL/well. In the negative control group, 5μL of lysis buffer and 5μL of diluted anti-cAMP-crytate working solution were added to each well. The plate was covered with a white lid, and stored at room temperature in the dark for 1 hour;
6) the fluorescence values of 665nm and 620nm were detected by the multifunctional enzyme marker;
7) based on this, a dose-effect curve was established, and the EC 50 values were calculated and compared with each other. The specific results are shown in Table 2.
Table 2 Determination of in vitro EC 50 values of polypeptides
Figure PCTCN2021135120-appb-000013
It can be found from the experimental results in Table 2 that the GLP-1/GCG dual receptor agonist polypeptides provided herein can significantly activate GLP-1 receptor cells and GCG receptor cells, respectively.
Example 3 Construction of fusion protein vector
Molecular cloning method was used to fuse the GLP-1/GCG dual receptor agonist polypeptide with IgG4-Fc (SEQ ID NO: 9) with a connecting peptide (SEQ ID NO: 6) . The resulting sequence was double digested and inserted between the same restriction site of the mammalian cell expression vector, and a series of mutant vectors were constructed. After being verified by sequencing, the plasmid vectors were extracted with endotoxin-free plasmid extraction kit (OMEGA) and stored at -20℃. The amino acid sequence of the GLP-1/GCG dual receptor agonist polypeptide in the vector and the name of the corresponding polypeptide sample are shown in Table  1. The sample name of the fusion protein containing the GLP-1/GCG dual receptor agonist polypeptide constructed in Example 2 is consistent with the sample name of the GLP-1/GCG dual receptor agonist polypeptide obtained in Example 1.
Example 4 Vector transfection and expression in cells
The Chinese hamster ovary cells (CHO) were resuscitated and subcultured. When the density was about 6*106 cells/mL, the cells were collected and transfected by using ExpiCHOFectamineTM CHO Transfection Kit (ThermoFisher Scientific) . The final concentration of the vector constructed in Example 2 was 1μg /mL. Reagents such as enhancers were added on the second day of the transfection to maintain the growth of the transfected cells. The cell culture solution was harvested when the cell viability lowered to about 80%.
Example 5 Purification and identification of fusion protein
The cell culture solution was centrifuged and the supernatant was collected, and the residual cell debris were removed by filtering with a 0.22 μm filter. The collected cell culture solution was purified by a Protein A chromatography column, the target peak was collected, and then further purified by anion exchange chromatography. The protein was finally eluted and collected with 0.02M PBS. The samples were quantified using a micro-nucleic acid protein analyzer (NanoDrop 2000/2000c Spectrophotometer) . The samples were detected by 12%SDS-PAGE electrophoresis, and the electrophoresis pattern showed as a single band. The precise molecular weight of the fusion protein was determined by mass spectrometry, and it was basically consistent with the theoretical molecular weight.
Example 6 Determination of the in vitro activity of the fusion protein
The HEK293 cells expressing GLP-1R or GCGR were stimulated by the fusion protein. cAMP detection kit (Cisbio, 62AM6PEC) was used to detect the cAMP produced by the recipient cells. A dose-effect curve was established, and the EC 50 values were calculated and compared with each other. The results are shown in Table 3.
Table 3 Determination of in vitro EC 50 values of fusion protein
Figure PCTCN2021135120-appb-000014
Figure PCTCN2021135120-appb-000015
It can be found from the experimental results in Table 3 that the GLP-1/GCG receptor dual agonist samples provided herein can significantly activate GLP-1 receptor cells and GCG receptor cells respectively.
Example 7 Effect of Candidates on Glucose Tolerance of Normal C57BL/6 Mice
Experimental method: Normal C57BL/6 mice were divided into 6 groups according to blood glucose and body weight (Control, Dulaglutide -7.5nmol/kg, HEC-C80-7.5nmol/kg, HEC-C85-7.5nmol/kg, HEC-C86-7.5 nmol/kg, HEC-C87-7.5nmol/kg) , 6 mice per group. The corresponding menstruum or candidate was administered by subcutaneous injection, the mice were fasted 56h after administration, and the mice in each group were injected intraperitoneally with 2g/kg glucose 72h after administration. The blood glucose test was performed before and 15, 30, 60, and 90 minutes after glucose administration. The results are shown in Table 4. The blood glucose concentration-time curve was plotted according to the blood glucose measured at different time points, as shown in Figure 1. The blood glucose drop rate of each dose group of AUC 0~90min Glu and at the peak blood glucose were calculated.
Results:
Table 4: Effects of different fusion proteins on blood glucose in mice with glucose load
Figure PCTCN2021135120-appb-000016
Conclusion: HEC-C80, HEC-C85, HEC-C86 and HEC-C87 can significantly reduce the blood glucose level of glucose loaded mice.
Example 8 Effect of Candidates on Glucose Tolerance of Normal C57BL/6 Mice
Experimental method: Normal C57BL/6 mice were divided into 3 groups according to blood glucose and body weight (Control, Dulaglutide-7.5nmol/kg, HEC-C70-7.5nmol/kg) , 8  mice per group. The corresponding menstruum or candidate was administered by subcutaneous injection, the mice were fasted 56h after administration, and the mice in each group were injected intraperitoneally with 2g/kg glucose 72h after administration. The blood glucose test was performed before and 15, 30, 60, and 90 minutes after glucose administration. The results are shown in Table 5. The blood glucose concentration-time curve was plotted according to the blood glucose measured at different time points, as shown in Figure 2. The blood glucose drop rate of each dose group of AUC 0~90min Glu and at the peak blood glucose were calculated.
Results:
Table 5: The effect of HEC-C70 on blood glucose of glucose loaded mice
Figure PCTCN2021135120-appb-000017
Conclusion: HEC-C70 can significantly reduce the blood glucose level of glucose loaded mice.
Example 9 Effects of candidates on glucose tolerance and body weight of DIO mice
Experimental method: 8-week-old C57BL/6 mice were fed with high-fat diet for 15 weeks and divided into 7 groups according to body weight (Model, semaglutide-5nmol/kg, HEC-C70-5nmol/kg, HEC-C80-5nmol/kg, HEC-C85-5nmol/kg, HEC-C86-5nmol/kg, HEC-C87-5nmol/kg) . From the 16th week, the mice were administered (the model group was administered the corresponding menstruum) . The semaglutide group was administered once a day, and the other groups were administered twice a week, and a total of 4 weeks of administration. The mice were weighed before each administration and the IPGTT experiment was carried out in 4 weeks.
Experimental results: the effect of HEC-C70-5nmol/kg on improving glucose tolerance is similar to semaglutide-10nmol/kg. HEC-C70-5nmol/kg, HEC-C80-5nmol/kg, HEC-C85-5nmol/kg, HEC-C86-5nmol/kg and HEC-C87-5nmol/kg all have a significant effect on reducing the body weight of DIO mice, and the effects of HEC-C70-5nmol/kg and HEC-C85-5nmol/kg are better than semaglutide-5nmol/kg. The specific data are shown in Table 6, Table 7, Figure 3 and Figure 4.
Table 6: Effects of long-term administration of different fusion proteins on the rate of blood glucose drop in glucose-loaded DIO mice
Figure PCTCN2021135120-appb-000018
Table 7: Effects of long-term administration of different fusion proteins on body weight of DIO mice
Figure PCTCN2021135120-appb-000019
Conclusion: Long-term administration of HEC-C70, HEC-C80, HEC-C85, HEC-C86, HEC-C87 can significantly improve the glucose tolerance and significantly reduce the body weight of DIO mice.
Example 10 Effect of Candidates on Glucose Tolerance and Body Weight of DIO Mice
Experimental method: 6-week-old C57BL/6N mice were fed with high-fat diet for 15 weeks and divided into 6 groups according to body weight (Model, LY3298176-10nmo/kg, semaglutide-10nmol/kg, MEDI0382-10nmol/kg, HEC-C70-2.5nmol/kg, HEC-C70-10nmol/kg) . From the 16th week, the mice were administered (the model group was administered the corresponding menstruum) . The semaglutide group and MEDI0382 group were administered once a day, and the other groups were administered twice a week, and a total of 4 weeks of administration. The mice were weighed before each administration and the IPGTT experiment was carried out in 4  weeks.
Control group LY3298176 sequence: YX 1EGTFTSDYSIX 2LDKIAQKAFVQWLIAGGPSSGAPPPS-NH 2 (SEQ ID NO: 15) , wherein the X 1 and X 2 are Aib, and K at position 20 is connected with ( [2- (2-amino-ethoxy) -ethoxy] -acetyl)  2-γGlu-CO- (CH 218-CO 2H through the side chain ε-amino.
Control group MEDI0382 sequence: HSQGTFTSDKSEYLDSERARDFVAWLEAGG (SEQ ID NO: 16) , wherein, K at position 10 is connected with γGlu-CO- (CH 214-CO 2H through the side chain ε-amino.
Experimental results: the effect of HEC-C70-10nmol/kg on improving glucose tolerance is similar to that of LY3298176-10nmol/kg, and better than semaglutide-10nmol/kg and MEDI0382-10nmol/kg. HEC-C70-10nmol/kg has a significant effect on reducing the body weight of DIO mice, and it is better than semaglutide-10nmol/kg. The specific data are shown in Table 8, Table 9, Figure 5 and Figure 6.
Table 8: The effect of long-term administration on the rate of blood glucose drop of DIO mice with glucose load
Figure PCTCN2021135120-appb-000020
Table 9: The effect of long-term administration on the body weight of DIO mice
Figure PCTCN2021135120-appb-000021
Conclusion: Long-term administration of HEC-C70 can significantly improve the glucose tolerance and significantly reduce the body weight of DIO mice.
Example 11 Effects of candidates on blood glucose and body weight of db/db mice
Experimental method: Ob/ob mice aged 6-7 weeks were divided into 3 groups (Model, Dulaglutide-30nmo/kg, HEC-C70-30nmol/kg) according to random blood glucose and body weight. Ob/ob mice were administered for a total of 4 weeks (the model group was administered the corresponding menstruum) , Dulaglutide and HEC-C70 were administered twice a week. During the administration, the random blood glucose and body weight of the mice in each group were monitored.
Experimental results: the effect of HEC-C70-30nmol/kg on improving glucose tolerance is better than Dulaglutide-30nmol/kg. HEC-C70-30nmol/kg has a significant effect on reducing the body weight of db/db mice, and it is better than Dulaglutide-30nmol/kg. The specific data are shown in Table 10, Table 11, Figure 7 and Figure 8.
Table 10: The effect of long-term administration on blood sugar of db/db mice
Figure PCTCN2021135120-appb-000022
Table 11: The effect of long-term administration on the body weight of db/db mice
Figure PCTCN2021135120-appb-000023
Reference throughout this specification to "an embodiment, " "some embodiments, " "one embodiment" , "another example, " "an example, " "a specific example, " or "some examples, " means that a particular feature, structure, material, or characteristic described in connection with the embodiment or example is included in at least one embodiment or example of the present disclosure. Thus, the appearances of the above terms throughout this specification are not necessarily referring to the same embodiment or example of the present disclosure. Furthermore, the particular features, structures, materials, or characteristics may be combined in any suitable manner in one or more embodiments or examples. In addition, those skilled in the art can integrate and combine different embodiments, examples or the features of them as long as they are not contradictory to one another.
Although explanatory embodiments have been shown and described, it would be appreciated by those skilled in the art that the above embodiments cannot be construed to limit the present disclosure, and changes, alternatives, and modifications can be made in the embodiments without departing from spirit, principles and scope of the present disclosure.

Claims (21)

  1. A GLP-1/GCG dual receptor agonist polypeptide, wherein the polypeptide has an amino acid sequence as shown below:
    5’X 1SQGT FTSDY SKYLD EKX 18AK X 21FX 23EW LX 27X 28X 29X 30 3’
    wherein, X 1 is H or Y; X 18 is R, A or K; X 21 is E or D; X 23 is V or I; X 27 is L or I; X 28 is A or E; X 29 is A or G; X 30 is GPSSGAPPPS or absent;
    when X 27 is L, X 28 is E.
  2. The polypeptide of claim 1, wherein the polypeptide has an amino acid sequence as shown below:
    HSQGT FTSDY SKYLD EKX 18AK EFX 23EW LX 27X 28G;
    wherein, X 18 is R, A or K, X 23 is V or I, X 27 is L or I, X 28 is A or E.
  3. The polypeptide of any one of claims 1 to 2, wherein in the amino acid sequence of the polypeptide, at least one of X 23 or X 27 is I.
  4. The polypeptide of any one of claims 1~3, wherein the polypeptide has an amino acid sequence shown in any one of SEQ ID NO: 1~5.
  5. A fusion protein comprising the polypeptide of any one of claims 1~4, a connecting peptide and an IgG-Fc fragment, wherein the connecting peptide is arranged between the head and tail of the polypeptide and the IgG-Fc fragment.
  6. The fusion protein of claim 5, wherein the N-terminus of the connecting peptide is connected with the C-terminus of the polypeptide, and the C-terminus of the connecting peptide is connected with the N-terminus of the IgG-Fc fragment.
  7. The fusion protein of any one of claims 5~6, wherein the connecting peptide has an amino acid sequence shown in any one of SEQ ID NO: 6~8.
  8. The fusion protein of any one of claims 5~7, wherein the IgG-Fc fragment is an IgG4-Fc mutant and has an amino acid sequence shown in SEQ ID NO: 9.
  9. The fusion protein of any one of claims 5~8, wherein the fusion protein has an amino acid sequence shown in any one of SEQ ID NO: 10~14.
  10. A nucleic acid encoding the polypeptide of any one of claims 1~4 or the fusion protein of any one of claims 5~9.
  11. A construct carrying the nucleic acid of claim 10.
  12. The construct of claim 11, wherein the vector of the construct is pXC17.4.
  13. A recombinant cell expressing the polypeptide of any one of claims 1~4 or the fusion protein of any one of claims 5~9, or comprising the construct of claim 11 or 12, or the genome of which integrates the nucleic acid of claim 10.
  14. The recombinant cell of claim 13, wherein the recombinant cell is a CHO cell.
  15. A pharmaceutical composition comprising the polypeptide of any one of claims 1~4 or the fusion protein of any one of claims 5~9.
  16. The pharmaceutical composition of claim 15, further comprising a pharmaceutically acceptable carrier.
  17. The pharmaceutical composition of claim 15, further comprising other anti-diabetic drugs, and the other anti-diabetic drugs comprising at least one selected from insulin, biguanides, sulfonylureas, rosiglitazone or pioglitazone, α-glucosidase inhibitors, and aminodipeptidase IV inhibitors.
  18. A protein formulation comprising the polypeptide of any one of claims 1~4 or the fusion protein of any one of claims 5~9.
  19. Use of the polypeptide of any one of claims 1~4 or the fusion protein of any one of claims 5~9 or the protein formulation of claim 18 in the manufacture of a medicament for treating or preventing metabolic diseases, wherein the metabolic diseases comprise at least one selected from non-alcoholic fatty liver disease, non-alcoholic steatohepatitis, diabetes, and obesity.
  20. A method of treating or preventing metabolic diseases in a subject comprising administering to the subject a therapeutically effective amount of the polypeptide of any one of claims 1~4 or the fusion protein of any one of claims 5~9 or the protein formulation of claim 18, wherein the metabolic diseases comprise at least one selected from non-alcoholic fatty liver disease, non-alcoholic steatohepatitis, diabetes, and obesity.
  21. The polypeptide of any one of claims 1~4 or the fusion protein of any one of claims 5~9 or the protein formulation of claim 18 for use in treating or preventing metabolic diseases, wherein the metabolic diseases comprise at least one selected from non-alcoholic fatty liver disease, non-alcoholic steatohepatitis, diabetes, and obesity.
PCT/CN2021/135120 2020-12-03 2021-12-02 Glp-1/gcg dual receptor agonist polypeptide and fusion protein thereof WO2022117044A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
CN202011405942 2020-12-03
CN202011405942.X 2020-12-03

Publications (1)

Publication Number Publication Date
WO2022117044A1 true WO2022117044A1 (en) 2022-06-09

Family

ID=81814172

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/CN2021/135120 WO2022117044A1 (en) 2020-12-03 2021-12-02 Glp-1/gcg dual receptor agonist polypeptide and fusion protein thereof

Country Status (2)

Country Link
CN (1) CN114591415B (en)
WO (1) WO2022117044A1 (en)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11744873B2 (en) 2021-01-20 2023-09-05 Viking Therapeutics, Inc. Compositions and methods for the treatment of metabolic and liver disorders
CN118240917A (en) * 2024-05-27 2024-06-25 正大天晴药业集团南京顺欣制药有限公司 A method for detecting the biological activity of GLP-1, GLP-1 analogs or GLP-1 fusion proteins

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012136790A1 (en) * 2011-04-07 2012-10-11 Glaxo Group Limited Compositions comprising fusion proteins or conjugates with an improved half -life
AU2013200675A1 (en) * 2008-06-17 2013-02-28 Indiana University Research And Technology Corporation Glucagon/GLP-1 receptor co-agonists
CN104302772A (en) * 2012-05-18 2015-01-21 爱德迪安(北京)生物技术有限公司 Protein and protein conjugate for diabetes treatment, and applications thereof
CN104736558A (en) * 2012-09-07 2015-06-24 赛诺菲 Fusion proteins for treating a metabolic syndrome
CN104926934A (en) * 2014-09-23 2015-09-23 蒋先兴 Oxyntomodulin analogue
CN107108715A (en) * 2014-10-24 2017-08-29 默沙东公司 The co-agonists of hyperglycemic factor and the acceptors of GLP 1
CN107266555A (en) * 2016-04-06 2017-10-20 天津药物研究院有限公司 The analog dimer of long-acting glucagon peptide 1 and its medical applications
CN111108117A (en) * 2017-09-22 2020-05-05 瑞泽恩制药公司 Glucagon-like peptide 1 receptor agonists and uses thereof

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8680051B2 (en) * 2008-12-19 2014-03-25 Qinghua Wang Method of ameliorating symptoms of type 1-diabetes using GABA related compounds and GLP-1/exendin-4 compounds
WO2016077806A1 (en) * 2014-11-13 2016-05-19 AskGene Pharma, Inc. Fusion proteins with dual receptor agonist activities
AU2019218147B2 (en) * 2018-02-08 2023-06-08 Sunshine Lake Pharma Co., Ltd. FGF21 variant, fusion protein and application thereof
CN110878127B (en) * 2018-09-06 2022-06-28 浙江柏拉阿图医药科技有限公司 Long-acting recombinant GLP1-Fc-CD47 protein and preparation and application thereof

Patent Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2013200675A1 (en) * 2008-06-17 2013-02-28 Indiana University Research And Technology Corporation Glucagon/GLP-1 receptor co-agonists
WO2012136790A1 (en) * 2011-04-07 2012-10-11 Glaxo Group Limited Compositions comprising fusion proteins or conjugates with an improved half -life
CN104302772A (en) * 2012-05-18 2015-01-21 爱德迪安(北京)生物技术有限公司 Protein and protein conjugate for diabetes treatment, and applications thereof
CN104736558A (en) * 2012-09-07 2015-06-24 赛诺菲 Fusion proteins for treating a metabolic syndrome
CN104926934A (en) * 2014-09-23 2015-09-23 蒋先兴 Oxyntomodulin analogue
CN107108715A (en) * 2014-10-24 2017-08-29 默沙东公司 The co-agonists of hyperglycemic factor and the acceptors of GLP 1
CN107266555A (en) * 2016-04-06 2017-10-20 天津药物研究院有限公司 The analog dimer of long-acting glucagon peptide 1 and its medical applications
CN111108117A (en) * 2017-09-22 2020-05-05 瑞泽恩制药公司 Glucagon-like peptide 1 receptor agonists and uses thereof

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11744873B2 (en) 2021-01-20 2023-09-05 Viking Therapeutics, Inc. Compositions and methods for the treatment of metabolic and liver disorders
CN118240917A (en) * 2024-05-27 2024-06-25 正大天晴药业集团南京顺欣制药有限公司 A method for detecting the biological activity of GLP-1, GLP-1 analogs or GLP-1 fusion proteins
CN118240917B (en) * 2024-05-27 2024-12-10 正大天晴药业集团股份有限公司 Method for detecting biological activity of GLP-1, GLP-1 analogue or GLP-1 fusion protein

Also Published As

Publication number Publication date
CN114591415A (en) 2022-06-07
CN114591415B (en) 2024-05-14

Similar Documents

Publication Publication Date Title
EP2581389B1 (en) Fusion protein of exendin-4 and its analog, preparation method and use thereof
JP6006309B2 (en) Engineered polypeptides with increased duration of action and reduced immunogenicity
JP4629047B2 (en) GLP-1 analog complex protein
US11858975B2 (en) Multi-domain active protein for treating metabolic diseases
JP7268202B2 (en) Fusion proteins for treating metabolic diseases
US20160129083A1 (en) Mic-1 fusion proteins and uses thereof
JP2024010090A (en) Relaxin fusion polypeptides and uses thereof
JP2013506628A (en) Drug fusions and conjugates with extended half-life
KR20170049319A (en) Long-acting fgf21 fusion proteins and pharmaceutical composition comprising the same
CN102558362A (en) A fusion protein for treating diabetes and its preparation method
US11078250B2 (en) High-activity long-acting hypoglycemic fusion protein as well as preparation method and medical application thereof
WO2022117044A1 (en) Glp-1/gcg dual receptor agonist polypeptide and fusion protein thereof
CN106397607A (en) Recombinant human fibroblast growth factor 21 fusion protein and application thereof in preparation of medicine for treating metabolic diseases
CN107033234B (en) Acylated glp-1 derivatives
CN118344462B (en) Soxhlet Ma Lutai mutant, fusion protein and related products for pulmonary administration
US20050250185A1 (en) OGH fusion polypeptides and therapeutic uses thereof
US10017555B2 (en) Long-acting blood sugar decreasing fusion protein
CN118063624A (en) Recombinant human growth hormone fusion protein and application thereof
CN113150172B (en) GLP-1R/GIPR double-target agonist fusion protein and preparation method and application thereof
WO2023280133A1 (en) Fusion protein and application thereof
JP2024532503A (en) GLP-1/GIP DUAL TARGET POLYPEPTIDES AND FUSION PROTEINS AND THEIR APPLICATIONS - Patent application
WO2021136521A1 (en) Polypeptide and use thereof
KR20180003677A (en) Pharmaceutical compositions comprising mutant proteins of human growth hormone or transferrin fusion proteins thereof
WO2021083306A1 (en) Glp-1/gcg dual-acceptor agonist polypeptide
WO2013059213A1 (en) Chemically and thermodynamically stable insulin analogues and improved methods for their production

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21900070

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21900070

Country of ref document: EP

Kind code of ref document: A1

32PN Ep: public notification in the ep bulletin as address of the adressee cannot be established

Free format text: NOTING OF LOSS OF RIGHTS PURSUANT TO RULE 112(1) EPC (EPO FORM 1205A DATED 17.10.2023)

122 Ep: pct application non-entry in european phase

Ref document number: 21900070

Country of ref document: EP

Kind code of ref document: A1