WO2022105814A1 - Humanized anti-trka antibodies and uses thereof - Google Patents

Humanized anti-trka antibodies and uses thereof Download PDF

Info

Publication number
WO2022105814A1
WO2022105814A1 PCT/CN2021/131343 CN2021131343W WO2022105814A1 WO 2022105814 A1 WO2022105814 A1 WO 2022105814A1 CN 2021131343 W CN2021131343 W CN 2021131343W WO 2022105814 A1 WO2022105814 A1 WO 2022105814A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
trka
antigen
cancer
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/CN2021/131343
Other languages
English (en)
French (fr)
Inventor
Zhiheng REN
Junji DONG
Zhuandi HE
Kezhu Wang
Jielian LU
Shushan LIN
Liang Liu
Xiang Li
Kuo ZhANG
Yan Jiang
Xiaoping Li
Xiaofeng Chen
Wenjia LI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Sunshine Lake Pharma Co Ltd
Original Assignee
Sunshine Lake Pharma Co Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Sunshine Lake Pharma Co Ltd filed Critical Sunshine Lake Pharma Co Ltd
Priority to US17/911,571 priority Critical patent/US20230357411A1/en
Priority to JP2022555685A priority patent/JP7837873B2/ja
Priority to EP21893961.9A priority patent/EP4247852A4/en
Priority to AU2021382828A priority patent/AU2021382828A1/en
Publication of WO2022105814A1 publication Critical patent/WO2022105814A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/08Drugs for disorders of the urinary system of the prostate
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P15/00Drugs for genital or sexual disorders; Contraceptives
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/08Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/02Drugs for disorders of the nervous system for peripheral neuropathies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/74Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734Complement-dependent cytotoxicity [CDC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the present invention relates to the field of biotechnology. Specifically, the present invention relates to humanized anti-TrkA antibodies and uses thereof. More specifically, the present invention relates to a humanized antibody or antigen-binding fragment thereof, nucleic acid molecule, expression vector, recombinant cell, pharmaceutical composition, pharmaceutical use and a kit for detecting TrkA that can specifically recognize TrkA.
  • non-opioid analgesics are mainly used clinically for mild to moderate pain, such as non-steroidal anti-inflammatory drugs (NSAIDs) ; opioid analgesics are mainly used for moderate to severe pain.
  • NSAIDs have a “ceiling effect” , and opioids only can effectively relieve less than 30%of non-tumor chronic pain, and 20%of patients with cancer pain have opioid resistance.
  • NSAIDs have hidden dangers of gastrointestinal and cardiovascular safety, especially during long-term medication.
  • years of drug improvement experiments have failed to effectively reduce its addiction and many other side effects, and patients expect new safer and more effective drugs.
  • Nerve growth factor is involved in the pathophysiological process of pain. It mainly activates the NGF/TrKA signaling pathway by binding to high-affinity tyrosine-nase (TrkA) receptors, which affects the release of inflammatory mediators, the opening of ion channels and the promotion of the growth of nerve fibers, thereby participating in the occurrence, conduction and sensitization process of pain.
  • TrkA high-affinity tyrosine-nase
  • Studies have shown that blocking NGF-TrkA signaling pathway can effectively reduce pain and hyperalgesia, and NGF-TrkA signaling pathway is an effective target for the development of new analgesics.
  • NGF may have a variety of undesirable agonist properties.
  • TrkA monoclonal antibodies selectively target and bind to TrkA receptors, which can not only block the activation of the TrkA signaling pathway by NGF, effectively inhibit the transmission of pain signals, but also avoid unpredictable side effects such as bone and joint necrosis caused by excessive neutralization of NGF by using anti-NGF antibodies. Therefore, TrkA-targeted analgesic drugs targeting NGF-TrkA may represent a better treatment option.
  • murine monoclonal antibodies have a relatively short half-life, and lack some basic functional properties of immunoglobulins when used in humans, such as complement-dependent cytotoxicity and antibody-dependent cell-mediated cytotoxicity.
  • non-human monoclonal antibodies contain immunogenic amino acid sequences if injected into patients. Although so-called chimeric antibodies (variable murine regions linked to human constant regions) have produced some positive results, there are still immunogenicity problems.
  • the NGF-TrkA signaling pathway is an effective target for the development of new analgesics. If TrkA monoclonal antibodies selectively target and bind to TrkA receptors, it can not only block the activation of the TrkA signaling pathway by NGF, effectively inhibit the transmission of pain signals, but also avoid unpredictable side effects such as bone and joint necrosis caused by excessive neutralization of NGF by using anti-NGF antibodies.
  • TrkA molecule is a receptor membrane protein, it is more difficult to screen for blocking anti-TrkA monoclonal antibodies.
  • designing blocking TrkA receptor antibodies has safety risks due to antibody-mediated immune responses. Therefore, it is difficult to design and develop monoclonal antibodies against TrkA.
  • the inventors of the present application not only successfully screened a new type of anti-TrkA monoclonal antibody with long-acting analgesic effect, but more importantly, the inventors humanized the murine anti-TrKA monoclonal antibody that was screened out into a humanized monoclonal antibody. Specifically, the FR regions and constant regions of the murine anti-TrKA monoclonal antibodies screened by hybridoma technology were replaced with human ones, and the CDRs of the variable regions of the murine anti-TrKA monoclonal antibodies were retained, and a series of humanized monoclonal antibodies against TrkA were obtained.
  • the human-mouse chimeric anti-TrkA monoclonal antibody 23E12 had the heavy chain variable region VH0 with the amino acid sequence shown in SEQ ID NO: 1 and the light chain variable region VL0 with the amino acid sequence shown in SEQ ID NO: 9.
  • the present invention provides a humanized antibody or antigen-binding fragment thereof capable of specifically recognizing TrkA.
  • the antibody or antigen-binding fragment thereof comprises a heavy chain variable region with the VH-CDR1 shown in SEQ ID NO: 41, the VH-CDR2 shown in SEQ ID NO: 42 or SEQ ID NO: 43, and the VH-CDR3 shown in SEQ ID NO: 44; and
  • VL-CDR1 shown in SEQ ID NO: 45
  • VL-CDR2 shown in SEQ ID NO: 46 or SEQ ID NO: 47
  • VL-CDR3 shown in SEQ ID NO: 48.
  • GYAFTNYWLG SEQ ID NO: 41
  • GFYPRTGNTF (SEQ ID NO: 43) .
  • ARAGTGFDY (SEQ ID NO: 44) .
  • ENVGGYVS (SEQ ID NO: 45) .
  • GASSRHT (SEQ ID NO: 46) .
  • GASSRAT SEQ ID NO: 47
  • NYIYPFT (SEQ ID NO: 48) .
  • the antibody or antigen-binding fragment thereof comprises a heavy chain variable region with the VH-CDR1 shown in SEQ ID NO: 41, the VH-CDR2 shown in SEQ ID NO: 42 and the VH-CDR3 shown in SEQ ID NO: 44; and
  • VL-CDR1 shown in SEQ ID NO: 45
  • VL-CDR2 shown in SEQ ID NO: 46
  • VL-CDR3 shown in SEQ ID NO: 48.
  • VL-CDR1 shown in SEQ ID NO: 45
  • VL-CDR2 shown in SEQ ID NO: 46
  • VL-CDR3 shown in SEQ ID NO: 48.
  • the antibody or antigen-binding fragment thereof comprises a heavy chain variable region with the VH-CDR1 shown in SEQ ID NO: 41, the VH-CDR2 shown in SEQ ID NO: 42 and the VH-CDR3 shown in SEQ ID NO: 44; and
  • VL-CDR1 shown in SEQ ID NO: 45
  • VL-CDR2 shown in SEQ ID NO: 47
  • VL-CDR3 shown in SEQ ID NO: 48.
  • the antibody or antigen-binding fragment thereof comprises a heavy chain variable region with the amino acid sequence shown in any one of SEQ ID NO: 2-8, and a light chain variable region with the amino acid sequence shown in any one of SEQ ID NO: 10-13.
  • the variable region includes murine CDRs and human framework regions.
  • SEQ ID NO: 2-8 are called VH1-VH7 in turn.
  • SEQ ID NO: 10-13 are called VL1-VL4 in turn.
  • the underlined parts are the CDR sequence of the heavy chain variable region and the CDR sequence of the light chain variable region, respectively.
  • the antibody or antigen-binding fragment thereof comprises a heavy chain variable region and a light chain variable region selected from:
  • the antibody or antigen-binding fragment thereof specifically recognizes the extracellular region of TrkA.
  • the antibody comprises at least one of a heavy chain framework region sequence and a light chain framework region sequence, and both the heavy chain framework region sequence and the light chain framework region sequence are derived from human IgG antibodies or their mutants. Furthermore, the immunogenicity of the antibody can be effectively reduced.
  • the light chain constant region of the antibody is derived from a human Kappa light chain constant region; the heavy chain constant region is derived from a human IgG4 heavy chain constant region.
  • the Fc region of the antibody has S10P, F16A, L17A, R191K mutations and 229 K deletion mutations compared with human IgG4 wild-type Fc.
  • the location of the above-mentioned amino acid position is based on the amino acid sequence shown in SEQ ID NO: 16 of the human IgG4 wild-type Fc sequence.
  • S10P means that the 10th S of the amino acid sequence shown in SEQ ID NO: 16 is mutated to P, and so on.
  • the full-length sequence of the constant region of the antibody is as shown in SEQ ID NO: 14 or 15.
  • the full-length sequence of the constant region of the antibody shown in SEQ ID NO: 14 is an IgG4 light chain constant region.
  • the full-length sequence of the constant region of the antibody shown in SEQ ID NO: 15 includes the IgG4 heavy chain constant region and the Fc region, wherein the IgG4 heavy chain constant region sequence is ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSG LYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRV, the sequence of the Fc region is ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY
  • the antibody comprises a heavy chain with the amino acid sequence shown in any one of SEQ ID NO: 17-23 and a light chain with the amino acid sequence shown in any one of SEQ ID NO: 24-27.
  • SEQ ID NO: 17-23 are called H1-H7 in turn.
  • SEQ ID NO: 24-27 are called L1-L4 in turn.
  • the human-mouse chimeric anti-TrkA monoclonal antibody 23E12 has a heavy chain H0 with the amino acid sequence shown in SEQ ID NO: 28 and a light chain L0 with the amino acid sequence shown in SEQ ID NO: 29.
  • the full-length sequence of the constant region of the antibody shown in SEQ ID NO: 49 includes the IgG1 heavy chain constant region and the Fc region, wherein the IgG1 heavy chain constant region sequence is ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV and the Fc region sequence is EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSPGK.
  • the antibody comprises a heavy chain and a light chain selected from the group selected from:
  • the humanized monoclonal antibody composed of the above-mentioned H1 and L1 with the IGHG4 heavy chain isotype and the Kappa isotype light chain is called H1L1-IgG4
  • the antibody composed of the above H3 and L1 with the IGHG4 heavy chain isotype and the Kappa isotype light chain is called H3L1-IgG4
  • the antibody composed of the above H3 and L2 with the IGHG4 heavy chain isotype and the Kappa isotype light chain is called H3L2-IgG4
  • the humanized monoclonal antibody composed of the above-mentioned H1 and L1 with the IGHG1 heavy chain isotype and the Kappa isotype light chain is called H1L1-IgG1, and so on.
  • the antibody is a single-chain antibody, a multimeric antibody, or a CDR-grafted antibody.
  • the single-chain antibody comprises a heavy chain variable region with the amino acid sequence shown in any one of SEQ ID NO: 2-8 and a light chain variable region with the amino acid sequence shown in any one of SEQ ID NO: 10-13, wherein the C-terminus of the heavy chain variable region is connected to the N-terminus of the light chain variable region through a connecting peptide linker, or the C-terminus of the light chain variable region is connected to the N-terminus of the heavy chain variable region through a connecting peptide linker.
  • the “connecting peptide linker” of the single-chain antibody described in this application is a connecting peptide used to connect the heavy chain variable region and the light chain variable region of the antibody.
  • the connecting peptide may be a G-rich polypeptide, for example, it may be selected from (G) 3-S (i.e., “GGGS” ) , (G) 4-S (i.e., “GGGGS” ) and (G) 5-S (i.e., “GGGGGS” ) , such as GGGGSGGGGSGGGGS.
  • the antigen-binding fragment comprises at least one of Fab, Fab', F (ab) 2, F (ab') 2, Fv, scFv-Fc fusion protein, scFv-Fv fusion protein, and minimum recognition unit.
  • the present invention provides a nucleic acid molecule.
  • the nucleic acid molecule encodes the aforementioned antibody or antigen-binding fragment thereof.
  • the antibody or antigen-binding fragment encoded by the nucleic acid molecule according to the embodiment of the present invention can specifically target and bind to TrkA and block the binding of NGF and TrkA.
  • the aforementioned nucleic acid molecule may further include at least one of the following additional technical features:
  • the nucleic acid molecule is DNA.
  • the nucleic acid molecule comprises the nucleotide sequence shown in any one of SEQ ID NO: 30-36 or comprises the nucleotide sequence shown in any one of SEQ ID NO: 37-40.
  • the nucleotide sequences shown in SEQ ID NO: 30-36 respectively encode heavy chains H1-H7
  • the nucleotide sequences shown in SEQ ID NO: 37-40 respectively encode light chains L1-L4.
  • the underlined parts encode heavy chain variable regions VH1 ⁇ VH7, and light chain variable regions VL1 ⁇ VL4, respectively.
  • the present invention provides an expression vector.
  • the expression vector carries the aforementioned nucleic acid molecule.
  • the expression vector according to the embodiment of the present invention is introduced into a suitable recipient cell, it can effectively realize the expression of the humanized antibody or its antigen-binding fragment that specifically recognizes TrkA under the mediation of the regulatory system, thereby realizing the large-scale in vitro acquisition of the humanized antibody or antigen-binding fragment.
  • the aforementioned expression vector may further include at least one of the following additional technical features:
  • the expression vector is a eukaryotic expression vector.
  • the aforementioned humanized antibody or its antigen-binding fragment that specifically recognizes TrkA can be expressed in eukaryotic cells, such as CHO cells.
  • the present invention provides a recombinant cell.
  • the recombinant cell carries the aforementioned nucleic acid molecule, or expresses the aforementioned humanized antibody or antigen-binding fragment thereof.
  • the recombinant cells according to the embodiments of the present invention can be used for in vitro expression and large-scale acquisition of the aforementioned humanized antibody or antigen-binding fragment thereof that specifically recognizes TrkA.
  • the aforementioned recombinant cell may further include at least one of the following additional technical features:
  • the recombinant cell is obtained by introducing the aforementioned expression vector into a host cell.
  • the expression vector is introduced into the host cell by electrotransduction.
  • the recombinant cell is a eukaryotic cell.
  • the recombinant cell is a mammalian cell.
  • the present invention provides a pharmaceutical composition.
  • the pharmaceutical composition comprises the aforementioned antibody, the aforementioned nucleic acid molecule, the aforementioned expression vector or the aforementioned recombinant cell.
  • the humanized antibody or expressed humanized antibody contained in the pharmaceutical composition according to the embodiment of the present invention has the same in vivo and in vitro activities as the human-mouse chimeric anti-TrkA monoclonal antibody 23E12.
  • TrkA receptor it not only can specifically target and bind to TrkA receptor, block the binding of NGF and TrkA, effectively inhibit pain, basically without the characteristics of antibody-dependent cell-mediated cytotoxicity (ADCC) , but also has lower immunogenicity and better pharmacokinetic parameters than the human-mouse chimeric anti-TrkA monoclonal antibody 23E12.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • the aforementioned use may further include at least one of the following additional technical features:
  • the medicament is used to treat or prevent neuropathic pain, inflammatory pain, cancer-related pain, fracture-related pain, surgery-related pain, inflammatory lung disease, interstitial cystitis, painful bladder syndrome, inflammatory bowel disease, inflammatory skin disease, Raynaud’s syndrome, idiopathic pulmonary fibrosis, scar (hypertrophy, keloid type and other forms) , sclerosis, endocardial myocardial fibrosis, atrial fibrosis, bone marrow fibrosis, progressive massive fibrosis (lung) , renal-derived systemic fibrosis, scleroderma, systemic sclerosis, joint fibrosis, ocular fibrosis, non-small cell lung cancer, papillary thyroid cancer, glioblastoma multiforme, colorectal cancer, melanoma, bile duct cancer or sarcoma, acute myeloid leukemia, large cell neuroendocrine cancer, neuroblasto
  • the present invention provides a method of treating or preventing a disease caused by abnormal expression of NGF, abnormal expression of TrkA, or abnormal activity of TrkA in a subject comprising administering to the subject a therapeutically effective amount of the aforementioned antibody, the aforementioned nucleic acid molecule, the aforementioned expression vector, the aforementioned recombinant cell, or the aforementioned pharmaceutical composition.
  • the disease caused by abnormal expression of NGF, abnormal expression of TrkA, or abnormal activity of TrkA includes neuropathic pain, inflammatory pain, cancer-related pain, fracture-related pain, surgery-related pain, inflammatory lung disease, interstitial cystitis, painful bladder syndrome, inflammatory bowel disease, inflammatory skin disease, Raynaud’s syndrome, idiopathic pulmonary fibrosis, scar (hypertrophy, keloid type and other forms) , sclerosis, endocardial myocardial fibrosis, atrial fibrosis, bone marrow fibrosis, progressive massive fibrosis (lung) , renal-derived systemic fibrosis, scleroderma, systemic sclerosis, joint fibrosis, ocular fibrosis, non-small cell lung cancer, papillary thyroid cancer, glioblastoma multiforme, colorectal cancer, melanoma, bile duct cancer or sarcoma, acute my
  • the present invention provides the aforementioned antibody, the aforementioned nucleic acid molecule, the aforementioned expression vector, the aforementioned recombinant cell, or the aforementioned pharmaceutical composition for use in treating or preventing a disease caused by abnormal expression of NGF, abnormal expression of TrkA, or abnormal activity of TrkA in a subject.
  • the present invention provides the aforementioned antibody, the aforementioned nucleic acid molecule, the aforementioned expression vector, the aforementioned recombinant cell, or the aforementioned pharmaceutical composition for use in treating or preventing a disease caused by abnormal expression of NGF, abnormal expression of TrkA, or abnormal activity of TrkA in a subject, wherein the disease caused by abnormal expression of NGF, abnormal expression of TrkA, or abnormal activity of TrkA includes neuropathic pain, inflammatory pain, cancer-related pain, fracture-related pain, surgery-related pain, inflammatory lung disease, interstitial cystitis, painful bladder syndrome, inflammatory bowel disease, inflammatory skin disease, Raynaud’s syndrome, idiopathic pulmonary fibrosis, scar (hypertrophy, keloid type and other forms) , sclerosis, endocardial myocardial fibrosis, atrial fibrosis, bone marrow fibrosis, progressive massive fibrosis (lung) , renal-derived
  • the present invention provides a kit for detecting TrkA.
  • the kit includes any one of the aforementioned antibodies.
  • the aforementioned TrkA antibody can specifically target and bind to TrkA.
  • the kit according to the embodiment of the present invention can realize the specific detection of TrkA.
  • a fluorescent detection device can be used to realize the localization or real-time detection of TrkA.
  • the present invention provides use of the aforementioned antibody, the aforementioned nucleic acid molecule, the aforementioned expression vector or the aforementioned recombinant cell in the preparation of a kit for detecting TrkA or diagnosing a TrkA-related disease.
  • the present invention provides a method of detecting TrkA or diagnosing a TrkA-related disease in a subject using a kit comprising the aforementioned antibody, the aforementioned nucleic acid molecule, the aforementioned expression vector or the aforementioned recombinant cell.
  • the present invention provides the aforementioned antibody, the aforementioned nucleic acid molecule, the aforementioned expression vector or the aforementioned recombinant cell for use in the preparation of a kit for detecting TrkA or diagnosing a TrkA-related disease.
  • Figure 1 is a diagram showing the results of the purity of monomer of humanized antibodies evaluated by the SEC-HPLC purity detection method according to an embodiment of the present invention
  • Figure 2 is a diagram showing the experimental results of the binding ability of humanized antibodies and Human-TrKA detected by flow cytometry according to an embodiment of the present invention
  • Figure 3 is a diagram showing the experimental results of the binding ability of humanized antibodies and Mouse-TrKA detected by flow cytometry according to an embodiment of the present invention
  • Figure 4 is a diagram showing the results of the inhibitory effect of humanized antibodies on the binding of Human-NGF and Human-TrKA detected by flow cytometry according to an embodiment of the present invention
  • Figure 5 is a diagram showing the results of the inhibitory effect of humanized antibodies on the binding of Mouse-NGF and Mouse-TrKA detected by flow cytometry according to an embodiment of the present invention
  • Figure 6A-6D are diagrams showing the results of the specificity of the binding of humanized antibodies to the target Human-TrKA detected by flow cytometry according to an embodiment of the present invention
  • Figure 7 is a diagram showing the results of ADA of humanized antibodies in mice evaluated by the ELISA method according to an embodiment of the present invention.
  • Figure 8 is a diagram showing the results of pharmacokinetics of humanized antibodies in mice evaluated by the ELISA method according to an embodiment of the present invention.
  • Figure 9 is a diagram showing the results of ADCC activity of humanized antibodies detected by the luciferase reporter gene system according to an embodiment of the present invention.
  • Figure 10 is a diagram showing the results of in vivo analgesic activity of humanized antibodies evaluated by a complete Freund's adjuvant-induced inflammatory pain model according to an embodiment of the present invention
  • Figure 11 is a diagram showing the results of the CDC activity of humanized antibodies detected by NIH-3T3-TrkA cell model according to an embodiment of the present invention.
  • Figure 12 is a diagram showing the results of the in vitro activity of humanized antibodies evaluated by the NIH-3T3-TrkA cell model according to an embodiment of the present invention.
  • the term "antibody” is an immunoglobulin molecule capable of binding to a specific antigen. It consists of two light chains with a lighter molecular weight and two heavy chains with a heavier molecular weight. The heavy (H) and light (L) chains are linked by disulfide bonds to form a tetrapeptide chain molecule. Among them, the amino acid sequence of the amino terminal (N-terminal) of the peptide chain changes greatly, which is called the variable region (V region) . The carboxyl terminal (C-terminal) is relatively stable with little change, which is called the constant region (C region) . The constant region of the antibody can mediate the binding of the immunoglobulin to host tissues or factors. The host tissues or factors include various cells of the immune system (for example, effector cells) and the first component of the classical complement system (Clq) . The V regions of the L and H chains are referred to as VL and VH, respectively.
  • variable region the amino acid composition and arrangement order of certain regions have a higher degree of variation, which is called the hypervariable region (Hypervariable region, HVR) .
  • Hypervariable region is where antigen and antibody binds, so it is also called complementarity-determining region (CDR) . They are interspersed in more conserved regions of the called framework regions (FR) .
  • FR framework regions
  • Each VH and VL can be composed of three CDRs and four FR regions, which can be arranged in the following order from the amino terminus to the carboxy terminus: FR1, CDR1, FR2, CDR2, FR3, CDR3, and FR4.
  • the present invention utilizes the extracellular segment of TrkA to obtain anti-TrkA Fab (antigen-binding fragment) antibody fragments with high specificity and high affinity through immunization.
  • the antibody fragment can specifically bind to the TrkA antigen, which can target the treatment of diseases such as pain or tumors.
  • the present invention provides a humanized antibody or antigen-binding fragment, wherein the humanized antibody or antigen-binding fragment thereof comprises a heavy chain variable region with the amino acid sequence shown in any one of SEQ ID NO: 2-8, and a light chain variable region with the amino acid sequence shown in any one of SEQ ID NO: 10-13.
  • the inventors can obtain the CDR region of the heavy chain variable region sequence and the CDR region of the light chain variable region sequence through the antibody sequence alignment database (NCBI, IMGT) .
  • the heavy chain variable region sequence of the antibody or antigen-binding fragment comprises conservative amino acid substitutions compared to the amino acid sequence shown in SEQ ID NO: 2-8.
  • the light chain variable region sequence of the antibody or antigen-binding fragment comprises conservative amino acid substitutions compared to the amino acid sequence shown in SEQ ID NO: 10-13.
  • Antigen-binding fragment refers to an antibody fragment that retains the ability to specifically bind to an antigen (ROR2) .
  • antigen-binding fragments include, but are not limited to, at least one of Fv fragments, disulfide bond-stabilized Fv fragments (dsFv) , Fab fragments, (Fab) 2 fragments, scFv-Fc fusion proteins, scFv-Fv fusion proteins, Fv-Fc fusion proteins, multispecific antibodies formed from antigen-binding fragments, single domain antibodies, domain antibodies, bivalent domain antibodies, or minimal recognition units.
  • Constant amino acid substitution refers to the substitution of an amino acid with a residue that is biologically, chemically or structurally similar to another amino acid. Of course, these conservative amino acid substitutions will not change the biological function of the antibody or antigen-binding fragment.
  • these conservative amino acid substitutions can occur on amino acids other than the CDR regions in the heavy chain variable region and the light chain variable region.
  • Biological similarity means that the substitution does not destroy the TrkA antibody or biological activity with the TrkA antigen.
  • Structural similarity refers to that amino acids have side chains of similar length, such as alanine, glycine, or serine, or side chains of similar size.
  • Chemical similarity means that amino acids have the same charge or are both hydrophilic or hydrophobic. For example, the hydrophobic residues isoleucine, valine, leucine or methionine are substituted with each other.
  • polar amino acids can be substituted for each other, such as lysine is substituted with arginine, aspartic acid is substituted with glutamic acid, asparagine is substituted with glutamine, threonine is substituted with serine, etc.
  • murine antibody usually refers to that the B cells derived from immunized mice are fused with myeloma cells, and then the mouse hybrid fusion cells that can proliferate immortally and secrete antibodies are screened, and then the antibody is screened, prepared and purified.
  • chimeric antibody refers to an antibody obtained by combining non-human genetic material with human genetic material.
  • Chimeric antibody or chimeric anti-TrkA antibody herein includes antibodies in which the variable region sequence is derived from one species and the constant region sequence is derived from another species.
  • the variable region sequence is derived from a mouse antibody and the constant region sequence is derived from a human antibody.
  • humanized antibody refers to an antibody that is derived from a non-human species but whose protein sequence has been modified to increase its similarity to human naturally-occurring antibodies.
  • a humanized antibody refers to a molecule having an antigen binding site that is essentially derived from an immunoglobulin of a non-human species, wherein the remaining immunoglobulin structure of the molecule is based on the structure and/or sequence of a human immunoglobulin.
  • the antigen binding site may comprise a complete variable domain fused to a constant domain or only a complementarity determining region (CDR) grafted to an appropriate framework region in the variable domain.
  • CDR complementarity determining region
  • the antigen binding site can be wild-type or modified by one or more amino acid substitutions, for example, modifications are made to be more similar to human immunoglobulins.
  • Some forms of humanized antibodies retain all CDR sequences (e.g., a humanized mouse antibody that contains all six CDRs from a mouse antibody) . Other forms have one or more CDRs that have changed relative to the original antibody.
  • the present invention provides a humanized anti-TrkA antibody.
  • the antibody has a heavy chain with the amino acid sequence shown in any one of SEQ ID NO: 17-23 and a light chain with the amino acid sequence shown in any one of SEQ ID NO: 24-27.
  • the present invention provides a humanized anti-TrkA single chain antibody.
  • the single-chain antibody comprises a heavy chain variable region with the amino acid sequence shown in any one of SEQ ID NO: 2-8 and a light chain variable region with the amino acid sequence shown in any one of SEQ ID NO: 10-13, wherein the C-terminus of the heavy chain variable region is connected to the N-terminus of the light chain variable region through a connecting peptide linker, or the C-terminus of the light chain variable region is connected to the N-terminus of the heavy chain variable region through a connecting peptide linker.
  • Nucleic acid molecule Nucleic acid molecule, expression vector, recombinant cell
  • nucleic acid molecules expressing these antibodies can be connected to different vectors and then expressed in different cells to obtain corresponding antibodies.
  • the present invention also provides an isolated nucleic acid molecule, which encodes the antibody or antigen-binding fragment described above.
  • the isolated nucleic acid molecule comprises the nucleotide sequence shown in any one of SEQ ID NO: 30-36 or has the nucleotide sequence shown in any one of SEQ ID NO: 37-40.
  • the isolated nucleic acid molecule comprises at least more than 90%homology with the nucleotide sequence shown in SEQ ID NO: 30-36, preferably has more than 95%homology, and more preferably comprises more than 98%and 99%homology.
  • the isolated polynucleotide comprises at least more than 90%homology with the nucleotide sequence shown in SEQ ID NO: 37-40, preferably comprises more than 95%homology, and more preferably comprises more than 98%and 99%homology.
  • sequences that comprise homology with the nucleotide sequences shown in SEQ ID NO: 30 ⁇ 36 or SEQ ID NO: 37 ⁇ 40 can express amino acid sequences similar to SEQ ID NO: 17 ⁇ 23 or SEQ ID NO: 24 ⁇ 27, so that they can specifically bind to the TrkA antigen to achieve the targeting function of the antibody.
  • the isolated nucleic acid molecule comprises the heavy chain nucleotide sequence shown in SEQ ID NO: 30 ⁇ 36 and the light chain nucleotide sequence shown in SEQ ID NO: 37 ⁇ 40. These nucleotide sequences are optimized for species and are more easily expressed in mammalian cells.
  • the present invention also provides an expression vector, which contains the aforementioned isolated nucleic acid molecule.
  • the polynucleotide can be directly or indirectly connected to control elements on the vector, as long as these control elements can control the translation and expression of the polynucleotide.
  • these control elements can come directly from the vector itself, or they can be exogenous, that is, not from the vector itself.
  • the polynucleotide may be operably linked to the control element.
  • “Operably linked” herein refers to the connection of a exogenous gene to a vector, so that control elements in the vector, such as transcription control sequences and translation control sequences, can exert its expected function of regulating the transcription and translation of exogenous genes.
  • control elements in the vector such as transcription control sequences and translation control sequences
  • the polynucleotides used to encode the heavy and light chains of the antibodies can be inserted into different vectors independently, and they are usually inserted into the same vector.
  • Commonly used vectors can be, for example, plasmids, phages, and the like. For example, plasmid-X plasmid.
  • the invention also provides a recombinant cell, which contains the expression vector.
  • the expression vector can be introduced into mammalian cells, constructed to obtain recombinant cells, and then these recombinant cells can be used to express the humanized antibodies or antigen-binding fragments provided by the present invention. By culturing the recombinant cells, corresponding antibodies can be obtained.
  • These usable mammalian cells may be, for example, CHO cells and the like.
  • the invention also provides a pharmaceutical composition, which comprises the antibody or antigen-binding fragment described above and a pharmaceutically acceptable carrier.
  • the anti-TrkA humanized antibodies provided herein can be incorporated into a pharmaceutical composition suitable for administration to a subject.
  • these pharmaceutical compositions include the anti-TrkA humanized antibodies provided herein as well as a pharmaceutically acceptable carrier.
  • a “pharmaceutically acceptable carrier” may include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and delayed absorption agents, and the like that are physiologically compatible. Specific examples may be one or more of water, saline, phosphate buffered saline, glucose, glycerol, ethanol, and the like, and combinations thereof.
  • compositions include isotonic agents, such as sugars, polyalcohols (such as mannitol, sorbitol) , or sodium chloride.
  • pharmaceutically acceptable carriers may also include minor amounts of auxiliary substances, such as wetting or emulsifying agents, preservatives or buffering agents, to extend the shelf life or efficacy of the antibody.
  • the antibodies of the invention can be incorporated into pharmaceutical compositions suitable for parenteral administration (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular) .
  • parenteral administration e.g., intravenous, subcutaneous, intraperitoneal, intramuscular
  • these pharmaceutical compositions can be prepared in various forms. Examples are liquid, semi-solid, and solid dosage forms, including, but not limited to, liquid solutions (e.g., injection solutions and infusion solutions) , dispersing or suspending agents, tablets, pills, powders, liposomes, and suppositories.
  • Typical pharmaceutical compositions are in the form of injection solutions or infusion solutions.
  • the antibodies can be administered by intravenous infusion or injection or intramuscular or subcutaneous injection.
  • the anti-TrkA humanized antibodies herein can also be made into kits or part of other diagnostic reagents as needed.
  • the present invention also provides a kit comprising the above-mentioned TrkA antibody.
  • the kit provided by the present invention can be used, for example, the kit can be used for immunoblotting, immunoprecipitation, etc., which involves detection using the specific binding properties of TrkA antigen and antibodies.
  • kits may include any one or more of the following: antagonists, anti- TrkA humanized antibodies or drug reference materials; protein purification columns; immunoglobulin affinity purification buffers; cell assay diluents; instructions or literature, etc.
  • Anti-TrkA humanized antibodies can be used for different types of diagnostic tests, such as the detection of various diseases or the presence of drugs, toxins or other proteins in vitro or in vivo. For example, it can be used to test related diseases by testing the serum or blood of the subject.
  • Such related diseases may include TrkA-related diseases such as pain, cancer, inflammation or inflammatory diseases, neurodegenerative diseases, Sjogren’s syndrome, endometriosis, diabetic peripheral neuropathy, prostatitis, pelvic pain syndrome, and diseases related to the unbalanced regulation of bone remodeling, and diseases caused by abnormal signal conduction of connective tissue growth factor, and the like.
  • the antibodies provided herein can also be used for radioimmunodetection and radioimmunotherapy of the above diseases.
  • the aforementioned pain, inflammation or inflammatory disease, neurodegenerative diseases, Sjogren’s syndrome, endometriosis, diabetic peripheral neuropathy, prostatitis, pelvic pain syndrome, diseases related to the regulation of bone remodeling imbalance and diseases caused by abnormal signaling of connective tissue growth factor include neuropathic pain, inflammatory pain, cancer-related pain, fracture-related pain, surgery-related pain, inflammatory lung disease, interstitial cystitis, painful bladder syndrome, inflammatory bowel disease, inflammatory skin disease, Raynaud’s syndrome, idiopathic pulmonary fibrosis, scar (hypertrophy, keloid type and other forms) , sclerosis, endocardial myocardial fibrosis, atrial fibrosis, bone marrow fibrosis, progressive massive fibrosis (lung) , renal-derived systemic fibrosis, scleroderma, systemic sclerosis, joint fibrosis, ocular fibrosis.
  • cancers or tumors can be any unregulated cell growth. Specifically, it may be non-small cell lung cancer, papillary thyroid cancer, glioblastoma multiforme, colorectal cancer, melanoma, bile duct cancer or sarcoma, acute myeloid leukemia, large cell neuroendocrine cancer, prostate cancer, neuroblastoma, pancreatic cancer, melanoma, head and neck squamous cell carcinoma or gastric cancer, etc.
  • the anti-TrkA humanized antibody provided by the present invention may be provided to a subject.
  • the present invention provides a method for treating the above-mentioned diseases, comprising administering an antibody or an antigen-binding fragment thereof provided by the present invention to a subject in need.
  • the immunogenicity analysis of the B cell epitope was carried out against the variable region of the murine anti-TrKA monoclonal antibody 23E12 by using the B cell epitope analysis software AbEpiMax, and the sequence of the antibody FR region with a strong B cell epitope was found.
  • H1L1-IgG4, H3L1-IgG4, H3L2-IgG4 A series of humanized antibody expression vectors (H1L1-IgG4, H3L1-IgG4, H3L2-IgG4) were constructed by molecular cloning, and the humanized antibody was expressed recombinantly in the CHO expression system.
  • Nucleotide sequences encoding a series of humanized monoclonal antibody light and heavy chains (H1L1-IgG4, H3L1-IgG4, H3L2-IgG4) were obtained by entrusting GenScript Biotechnology Co., Ltd. through chemical synthesis.
  • sequences were double digested, they were inserted between the same restriction sites of the eukaryotic expression vector to construct a series of humanized monoclonal antibody expression vectors (H1L1-IgG4, H3L1-IgG4, H3L2-IgG4) . Then a series of verified and correct expression vectors were extracted by Invitrogen plasmid extraction kit, linearized with restriction enzymes, purified and recovered, and then stored at -20°C.
  • the cells were collected for transfection when the density of the cells was about 8*10 5 cell/mL.
  • the transfected cells were about 1*10 7 cell, the vector was about 40 ⁇ g, and the transfection method is by electroporation (Bio-Rad, Gene pulser Xcell) .
  • the cells were cultured in 20mL CD CHO medium.
  • the cells were collected by centrifugation and resuspended in 20 mL CD CHO medium added with MSX to a final concentration of 50 ⁇ M.
  • the obtained mixed clones were passaged with CD CHO medium, and the density of the cells was about 0.2*10 6 cell/mL.
  • the survival rate of the cells was about 90%, the cell culture fluid was collected.
  • a series of humanized monoclonal antibodies were tested at the translation level.
  • the collected cell culture fluid was purified by a Protein A chromatography column, and the absorption peak was collected for mass spectrometry.
  • Mass spectrometry detected that a series of chimeric antibodies had a molecular weight of about 150KD, which was consistent with the theoretical molecular weight and was in the form of a dimer.
  • the collected samples were detected by 10%SDS-PAGE electrophoresis after reduction and non-reduction, respectively.
  • the reduced SDS-PAGE electrophoresis pattern showed two bands, about 25KD and 50KD, respectively.
  • the non-reduced SDS-PAGE electrophoresis pattern showed a single band, around 150KD.
  • the band size of the electrophoresis pattern was consistent with the theory.
  • the sample was dialyzed overnight at 4°C with a 0.01M PBS buffer of pH 7.0.
  • the humanized antibody H1L1-IgG4, H3L1-IgG4, H3L2-IgG4 samples and the chimeric antibody (H0L0-IgG4) samples were centrifuged. About 80 ⁇ g of the supernatant was taken and injected into HPLC for detection. The monomer peak area percentage of the humanized antibody was detected by SEC-HPLC. The higher the peak area percentage, the higher the purity of the monomer. The results were shown in Figure 1.
  • the results in the Figure 1 showed that the monomer peak area percentages of the humanized antibodies H1L1-IgG4, H3L1-IgG4, and H3L2-IgG4 were 99.847%, 99.738%, and 99.836%, respectively, and the monomer peak area percentage of the chimeric antibody H0L0-IgG4 was 99.621%. It showed that the humanized antibodies H1L1-IgG4, H3L1-IgG4, H3L2-IgG4 and the chimeric antibody H0L0-IgG4 had high monomer purity.
  • H1L1-IgG4, H3L1-IgG4, H3L2-IgG4 The humanized antibody (H1L1-IgG4, H3L1-IgG4, H3L2-IgG4) samples and the chimeric antibody (H0L0-IgG4) samples were diluted with PBS buffer to 11 concentration gradients (20 ⁇ g/mL, 10 ⁇ g/mL, 5 ⁇ g/mL, 2.5 ⁇ g/mL, 1.25 ⁇ g/mL, 0.625 ⁇ g/mL, 0.313 ⁇ g/mL, 0.156 ⁇ g/mL, 0.078 ⁇ g/mL, 0.039 ⁇ g/mL, 0.019 ⁇ g/mL) .
  • humanized antibodies H1L1-IgG4, H3L1-IgG4, H3L2-IgG4 and the chimeric antibody H0L0-IgG4 had strong binding abilities to Human-TrKA; compared with the chimeric antibody H0L0-IgG4, the affinity of humanized antibodies H1L1-IgG4, H3L1-IgG4, H3L2-IgG4 binding to Human-TrKA remained basically unchanged.
  • H1L1-IgG4, H3L1-IgG4, H3L2-IgG4 humanized antibody samples and the chimeric antibody (H0L0-IgG4) samples were diluted with PBS buffer to 11 concentration gradients (20 ⁇ g/mL, 10 ⁇ g/mL, 5 ⁇ g/mL, 2.5 ⁇ g/mL, 1.25 ⁇ g/mL, 0.625 ⁇ g/mL, 0.313 ⁇ g/mL, 0.156 ⁇ g/mL, 0.078 ⁇ g/mL, 0.039 ⁇ g/mL, 0.019 ⁇ g/mL) .
  • humanized antibodies H1L1-IgG4, H3L1-IgG4, H3L2-IgG4 and the chimeric antibody H0L0-IgG4 had strong binding abilities to Mouse-TrKA; compared with the chimeric antibody H0L0-IgG4, the affinity of humanized antibodies H1L1-IgG4, H3L1-IgG4, H3L2-IgG4 binding to Mouse-TrKA remained basically unchanged.
  • Example 8 The inhibitory effect of humanized antibodies on the binding of Human-NGF and Human-TrKA detected by flow cytometry
  • the IC50 of the humanized antibodies were 0.7963 ⁇ g/mL, 0.7405 ⁇ g/mL, 0.6653 ⁇ g/mL, respectively, and the IC50 of the chimeric antibody (H0L0-IgG4) was 0.8810 ⁇ g/mL; it could be seen that each humanized antibody (H1L1-IgG4, H3L1-IgG4, H3L2-IgG4) and chimeric antibody (H0L0-IgG4) could dose-dependently inhibit the binding of Human-NGF and Human-TrkA at the cellular level within a concentration range; compared with the chimeric antibody (H0L0-IgG4) , the inhibitory effect of humanized antibodies (H1L1-IgG4, H3L1-IgG4, H3L2-IgG4) on the binding of Human-NGF and Human-TrKA remained basically unchanged .
  • Example 9 The inhibitory effect of humanized antibodies on the binding of Mouse-NGF and Mouse-TrKA detected by flow cytometry
  • Mouse-NGF was biotinylated, and Mouse-NGF could bind to the extracellular region of Mouse-TrkA protein on HEK293T-MouseTrkA cells, and anti-TrkA monoclonal antibodies could also bind to the extracellular region of Mouse-TrkA protein on HEK293T-MouseTrkA cells.
  • the IC50 of the humanized antibodies were 0.3848 ⁇ g/mL, 0.2826 ⁇ g/mL, 0.2524 ⁇ g/mL, respectively, and the IC50 of the chimeric antibody (H0L0-IgG4) was 0.3959 ⁇ g/mL; it could be seen that each humanized antibody (H1L1-IgG4, H3L1-IgG4, H3L2-IgG4) and chimeric antibody (H0L0-IgG4) could dose-dependently inhibit the binding of Mouse-NGF and Mouse-TrkA at the cellular level within a concentration range; compared with the chimeric antibody (H0L0-IgG4) , the inhibitory effect of humanized antibodies (H1L1-IgG4, H3L1-IgG4, H3L2-IgG4) on the binding of Mouse-NGF and Mouse-TrKA remained basically unchanged .
  • TrkA receptor family belonged to receptor tyrosine kinases (RTKs) , including TrkA, TrkB, and TrkC, which had high homology.
  • TrkA was a receptor tyrosine kinase of nerve growth factor (NGF) that selectively bound to NGF and was a functional receptor for NGF.
  • NGF nerve growth factor
  • NGF nerve growth factor
  • mice were immunized with humanized antibodies (H1L1-IgG4, H3L1-IgG4, H3L2-IgG4) and chimeric antibody (H0L0-IgG4) respectively, and tail vein blood was collected on the 14th day after administration.
  • humanized antibodies H1L1-IgG4, H3L1-IgG4, H3L2-IgG4
  • chimeric antibody H0L0-IgG4
  • H1L1-IgG4, H3L1-IgG4, H3L2-IgG4) and chimeric antibody (H0L0-IgG4) were diluted to 1 ⁇ g/mL coated microplate with PBS, 100 ⁇ L of which was added to each well and reacted at 4 ⁇ overnight; the plate was washed 3 times with PBS solution, and blocked with 5%milk-PBS for 1hr at room temperature; then the plate was washed once with PBS solution; 5%Milk-PBS buffer was used to gradiently dilute mouse tail vein blood (1: 500, 1: 1000, 1: 5000, 1: 10000, 1: 50000) , and the mouse tail vein blood was placed at room temperature for 1hr, and then the pre-reacted tail vein blood was added to the microplate with 100 ⁇ L per well.
  • NC negative control
  • the mixture was reacted at room temperature for 1hr, then the plate was washed 3 times with PBS solution and patted dry.
  • 1 2000 diluted HRP-labeled goat anti-mouse IgG (Fc) secondary antibody was added, and reacted at room temperature for 1hr; the plate was washed 5 times with PBS solution and patted dry, then 100 ⁇ L of substrate color developing solution TMB was added, and reacted for 20 min under dark conditions at room temperature; then 50 ⁇ L of stop solution was added and the OD450 value was read on the microplate reader after mixing.
  • the results were shown in Figure 7 below. In the Figure 7, the OD450 value reflected the strength of the generated ADA. The larger the reading, the stronger the generated ADA.
  • mice Male ICR mice were randomly divided into 4 groups and 3 mice/group.
  • the chimeric antibody H0L0-IgG4 and humanized antibody H1L1-IgG4 were injected intravenously or subcutaneously at 1mg/kg. Blood was collected at 1, 6, 24, 72, 168, 336, 504, and 672h after administration, and plasma was separated (EDTA-K2 anticoagulation) . In the intravenous administration group, blood was collected for an additional 0.25h.
  • the indirect ECLA method was used to analyze the concentration of H0L0-IgG4 or H1L1-IgG4 in each sample. The pharmacokinetic parameters were calculated based on the plasma drug concentration.
  • the main PK parameter results were shown in Table 2, and the drug-time curve was shown in Figure 8.
  • Antibody-dependent cell-mediated cytotoxicity means that when IgG antibody specifically binds to antigenic determinants on the surface of target cells through the Fab segment, its Fc segment can bind to effector cells such as Fc ⁇ R killer cells (NK cells, monocytes-macrophages, neutrophils) to trigger the killing activity of effector cells, and directly kill target cells.
  • effector cells such as Fc ⁇ R killer cells (NK cells, monocytes-macrophages, neutrophils) to trigger the killing activity of effector cells, and directly kill target cells.
  • NK cells Fc ⁇ R killer cells
  • monocytes-macrophages monocytes-macrophages, neutrophils
  • the Fc segment of the test antibody bound to the antigen on the target cell HEK293T-HumanTrKA cell the Fc segment of the antibody bound to (Fc ⁇ RIIIA) on the surface of the effector cell Jurkat-NFAT-Luciferase-CD16 cell, causing activation of NFAT-related signaling pathways in Jurkat-NFAT-Luciferase-CD16 cells, which in turn led to an increase in expression level of luciferase.
  • the ADCC activity of humanized antibodies was evaluated by detecting the expression level of luciferase of effector cells Jurkat-NFAT-Luciferase-CD16 under the action of different concentrations (100 ⁇ g/mL, 20 ⁇ g/mL, 4 ⁇ g/mL, 0.8 ⁇ g/mL, 0.16 ⁇ g/mL, 0.032 ⁇ g/mL, 0.0064 ⁇ g/mL, 0.00128 ⁇ g/mL, 0.000256 ⁇ g/mL, 0.0000512 ⁇ g/mL) of humanized antibodies (H1L1-IgG4, H1L1-IgG1) .
  • the results were shown in the Figure 9 below.
  • Mean Value reflected the expression level of luciferase.
  • Example 14 Evaluation of in vivo analgesic activity of humanized antibodies by a complete Freund’s adjuvant-induced inflammation pain model
  • Complete Freund’s adjuvant-induced inflammatory pain model is a pain model that produces a pain model of chronic inflammatory pain stimulation similar to osteoarthritis and responses by injecting complete Freund’s adjuvant in the palms of mice.
  • the pain is measured by the mechanical pain test. The greater the intensity of the mechanical stimulus, the more resistant the animal is to pain.
  • 18-25g male C57BL/6 mice were selected, and 10 ⁇ L of CFA was injected into the center of the sole of the right hind foot of the mouse. After 24 hours of modeling, the mechanical hyperalgesia method was used to test, and the animals with the withdrawal threshold less than 0.5 gram force were screened out.
  • Tanezumab was an anti-NGF monoclonal antibody
  • MNAC13 was an anti-TrkA monoclonal antibody.
  • the solvent control group, Tanezumab, MNAC13, and H1L1-IgG4 dose groups were administered by subcutaneous injection, and the mechanical hyperalgesia test was performed after 42hr and 96hr respectively.
  • the naproxen dose group was administered intragastrically 2 hours before the test.
  • the results were shown in Figure 10.
  • the ordinate represented the intensity of mechanical stimulation.
  • the results showed that the positive control group naproxen was tested 2 hours after orally administration at a dose of 100 mg/kg and showed inhibition of mechanical hyperalgesia induced by C57BL/6 mouse CFA model; Tanezumab was tested 42 hours after subcutaneous administration at a dose of 2 mg/kg and showed inhibition of mechanical hyperalgesia induced by C57BL/6 mouse CFA model, while Tanezumab which was tested 96 hours after administration did not show such inhibition; MNAC13 was tested 42 and 96 hours after subcutaneous administration at a dose of 2 mg/kg, and none of them showed inhibition of mechanical hyperalgesia induced by C57BL/6 mouse CFA model.
  • H1L1-IgG4 was tested 96 hours after subcutaneous administration at a dose of 2 mg/kg and showed inhibition of mechanical hyperalgesia induced by the C57BL/6 mouse CFA model, while H1L1-IgG4 which was tested 42 hours after administration did not show such inhibition.
  • H1L1-IgG4 significantly inhibited the mechanical hyperalgesia induced by the C57BL/6 mouse CFA model after 96 hours of subcutaneous administration, and had the activity of relieving inflammatory pain.
  • Example 15 CDC activity of humanized antibodies detected by NIH-3T3-TrkA cell model
  • CDC Complement-dependent cytotoxicity
  • the cell viability of the target cell NIH-3T3-TrKA was detected by the CCK8 method under the action of different concentrations (16.67 ⁇ g/mL, 5.56 ⁇ g/mL, 1.85 ⁇ g/mL, 0.62 ⁇ g/ml, 0.21 ⁇ g/ml, 0.069 ⁇ g/ml, 0.023 ⁇ g/ml, 0.008 ⁇ g/ml, 0.003 ⁇ g/ml) of humanized antibody (H1L1-IgG4, H1L1-IgG1) and the negative control fusion protein Dulaglutide-IgG4, and the CDC activity of the humanized Anti-TrKA antibody was evaluated. The results were shown in Figure 11.
  • TrkA protein tyrosine phosphorylation on the NIH-3T3-TrkA cell membrane is up-regulated, and the downstream signaling pathway of TrkA is activated.
  • Humanized Anti-TrKA antibody can bind to the TrkA protein on the surface of NIH-3T3-TrkA cell membrane, inhibit NGF stimulation, and down-regulate the level of TrkA protein tyrosine phosphorylation.
  • the AlphaLISA method was used to detect the down-regulation of the level of TrkA protein tyrosine phosphorylation under the action of different concentrations (1000 ⁇ g/mL, 333.33 ⁇ g/mL, 111.11 ⁇ g/mL, 37.04 ⁇ g/mL, 12.35 ⁇ g/mL, 4.12 ⁇ g/mL, 1.37 ⁇ g/mL, 0.45 ⁇ g/mL, 0.15 ⁇ g/mL, 0.05 ⁇ g/mL, 0.017 ⁇ g/mL, 0.005 ⁇ g/mL) of humanized antibodies, and the in vitro activity of the tested antibody was evaluated.
  • concentrations 1000 ⁇ g/mL, 333.33 ⁇ g/mL, 111.11 ⁇ g/mL, 37.04 ⁇ g/mL, 12.35 ⁇ g/mL, 4.12 ⁇ g/mL, 1.37 ⁇ g/mL, 0.45 ⁇ g/mL, 0.15 ⁇ g/mL, 0.05 ⁇ g/mL, 0.017 ⁇ g/mL
  • the experimental results showed that the humanized Anti-TrKA antibody H1L1-IgG4 could inhibit the NGF-TrKA signaling pathway and down-regulate the level of TrkA protein tyrosine phosphorylation in a dose-dependent manner.
  • the IC50 value was 0.02072 ⁇ g/mL. It could be seen that the humanized Anti-TrKA antibody H1L1-IgG4 could inhibit the activation of the downstream signaling pathway of TrKA by NGF.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Biochemistry (AREA)
  • Urology & Nephrology (AREA)
  • Rheumatology (AREA)
  • Biophysics (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Biotechnology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Endocrinology (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Hematology (AREA)
  • Physics & Mathematics (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Pain & Pain Management (AREA)
  • Reproductive Health (AREA)
  • Plant Pathology (AREA)
  • Cell Biology (AREA)
PCT/CN2021/131343 2020-11-20 2021-11-18 Humanized anti-trka antibodies and uses thereof Ceased WO2022105814A1 (en)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US17/911,571 US20230357411A1 (en) 2020-11-20 2021-11-18 Humanized anti-trka antibodies and uses thereof
JP2022555685A JP7837873B2 (ja) 2020-11-20 2021-11-18 ヒト化抗TrkA抗体及びその使用
EP21893961.9A EP4247852A4 (en) 2020-11-20 2021-11-18 HUMANIZED ANTI-TRKA ANTIBODIES AND USES THEREOF
AU2021382828A AU2021382828A1 (en) 2020-11-20 2021-11-18 Humanized anti-TrkA antibodies and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
CN202011307482 2020-11-20
CN202011307482.7 2020-11-20

Publications (1)

Publication Number Publication Date
WO2022105814A1 true WO2022105814A1 (en) 2022-05-27

Family

ID=81595256

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/CN2021/131343 Ceased WO2022105814A1 (en) 2020-11-20 2021-11-18 Humanized anti-trka antibodies and uses thereof

Country Status (7)

Country Link
US (1) US20230357411A1 (https=)
EP (1) EP4247852A4 (https=)
JP (1) JP7837873B2 (https=)
CN (1) CN114516917B (https=)
AU (1) AU2021382828A1 (https=)
TW (1) TWI880048B (https=)
WO (1) WO2022105814A1 (https=)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN120360963B (zh) * 2025-04-23 2026-02-27 广州芬瑞生物科技有限公司 干细胞外泌体制备方法及该方法制备的外泌体在治疗男性勃起功能障碍中的用途

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110145941A1 (en) * 2008-02-04 2011-06-16 Lay Line Genomics S.P.A. Antibodies and derivatives thereof
US20130344068A1 (en) * 2010-12-01 2013-12-26 Leon F. Garcia-Martinez Methods of preventing inflammation and treating pain using anti-ngf compositions
CN104520330A (zh) * 2012-06-08 2015-04-15 格兰马克药品股份有限公司 具有氨基酸取代的人源化抗TrkA抗体
US20170362327A1 (en) * 2015-04-24 2017-12-21 Glenmark Pharmaceuticals S.A. Anti-trka antibodies with enhanced inhibitory properties and derivatives thereof for use in treating bone associated pain

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6833268B1 (en) 1999-06-10 2004-12-21 Abgenix, Inc. Transgenic animals for producing specific isotypes of human antibodies via non-cognate switch regions
AU7311501A (en) * 2000-06-29 2002-03-22 Quick Med Technologies Inc Cosmetic composition and method
ITRM20030601A1 (it) * 2003-12-24 2005-06-25 Lay Line Genomics Spa Metodo per l'umanizzazione di anticorpi e anticorpi umanizzati con esso ottenuti.
US20150183885A1 (en) * 2012-06-08 2015-07-02 Glenmark Pharmaceuticals S.A. Anti-trka antibodies with enhanced inhibitory properties and derivatives thereof
EP2674439B1 (en) * 2012-06-13 2017-02-01 Rottapharm Biotech S.r.l. Anti-TrkA antibodies, derivatives and uses thereof
WO2018166461A1 (en) 2017-03-14 2018-09-20 Sunshine Lake Pharma Co., Ltd. Dual-target fusion proteins comprising the fc portion of an immunoglobulin
EP3976657A4 (en) * 2019-05-30 2023-07-05 Sunshine Lake Pharma Co., Ltd. ANTI-TRKA ANTIBODIES AND USES THEREOF

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110145941A1 (en) * 2008-02-04 2011-06-16 Lay Line Genomics S.P.A. Antibodies and derivatives thereof
US20130344068A1 (en) * 2010-12-01 2013-12-26 Leon F. Garcia-Martinez Methods of preventing inflammation and treating pain using anti-ngf compositions
CN104520330A (zh) * 2012-06-08 2015-04-15 格兰马克药品股份有限公司 具有氨基酸取代的人源化抗TrkA抗体
US20170362327A1 (en) * 2015-04-24 2017-12-21 Glenmark Pharmaceuticals S.A. Anti-trka antibodies with enhanced inhibitory properties and derivatives thereof for use in treating bone associated pain

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
COVACEUSZACH S, CATTANEO A, LAMBA D: "Neutralization of NGF-TrkA receptor interaction by the novel antagonistic anti-TrkA monoclonal antibody MNAC13: a structural insight.", PROTEINS: STRUCTURE, FUNCTION, AND BIOINFORMATICS, vol. 58, no. 3, 15 February 2005 (2005-02-15), US , pages 717 - 727, XP002338675, ISSN: 0887-3585, DOI: 10.1002/prot.20366 *
See also references of EP4247852A4 *
UGOLINI GABRIELE ET AL: "The function neutralizing anti-TrkA antibody MNAC13 reduces inflammatory and neuropathic pain.", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 104, no. 8, 20 February 2007 (2007-02-20), pages 2985 - 2990, XP002523974, ISSN: 0027-8424, DOI: 10.1073/PNAS.0611253104 *
YASMINA NOUBIA ABDICHE, DAN STEPHEN MALASHOCK, JAUME PONS: "Probing the binding mechanism and affinity of tanezumab, a recombinant humanized anti-NGF monoclonal antibody, using a repertoire of biosensors", PROTEIN SCIENCE, vol. 17, no. 8, 1 August 2008 (2008-08-01), pages 1326 - 1335, XP055113671, ISSN: 09618368, DOI: 10.1110/ps.035402.108 *

Also Published As

Publication number Publication date
JP2023549300A (ja) 2023-11-24
AU2021382828A1 (en) 2022-10-06
EP4247852A1 (en) 2023-09-27
CN114516917B (zh) 2022-11-18
CN114516917A (zh) 2022-05-20
TWI880048B (zh) 2025-04-11
JP7837873B2 (ja) 2026-03-31
US20230357411A1 (en) 2023-11-09
TW202227500A (zh) 2022-07-16
EP4247852A4 (en) 2024-10-23

Similar Documents

Publication Publication Date Title
AU2020281378B2 (en) Anti-TrkA antibodies and uses thereof
CN101939337B (zh) 抗trka抗体及其衍生物
CN111032688A (zh) 用于延长的血清半衰期的工程化抗体fc变体
JP5818804B2 (ja) ヒトil−22raに対するヒト化抗体
KR20250166188A (ko) Tnfr2 결합 폴리펩타이드 및 이의 용도의 방법
WO2022105814A1 (en) Humanized anti-trka antibodies and uses thereof
WO2026021622A2 (zh) 靶向atrn蛋白的抗体或其抗原结合片段及其应用
KR20220016152A (ko) 항-gal9 결합분자 활성화
CN112912404B (zh) 包含ids的融合蛋白及其用途
CN115572330A (zh) 一种特异性抗体及其制备方法和应用
KR20250124805A (ko) Cd24에 대한 항체 및 이의 용도
WO2025256571A1 (zh) 靶向b7h7和cd3的双特异性抗体及其应用
KR20230142838A (ko) 항-vegf 항체 및 이의 용도
CN117886935A (zh) 抗csf-1r抗体及其应用
WO2026085874A1 (zh) Tl1a结合分子及其应用
CN118515756A (zh) 靶向atrn蛋白的抗体或其抗原结合片段及其应用
CN120399072A (zh) 靶向4-1bb构建体及其应用
HK40088797B (zh) 包含SIRPα突变体的融合蛋白
HK40088797A (zh) 包含SIRPα突变体的融合蛋白
KR20120130478A (ko) TNF?α 특이적 항체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21893961

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2022555685

Country of ref document: JP

ENP Entry into the national phase

Ref document number: 2021382828

Country of ref document: AU

Date of ref document: 20211118

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021893961

Country of ref document: EP

Effective date: 20230620