WO2022094078A1 - Compositions utiles dans le traitement du syndrome de rett - Google Patents

Compositions utiles dans le traitement du syndrome de rett Download PDF

Info

Publication number
WO2022094078A1
WO2022094078A1 PCT/US2021/057047 US2021057047W WO2022094078A1 WO 2022094078 A1 WO2022094078 A1 WO 2022094078A1 US 2021057047 W US2021057047 W US 2021057047W WO 2022094078 A1 WO2022094078 A1 WO 2022094078A1
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
seq
aav
mecp2
certain embodiments
Prior art date
Application number
PCT/US2021/057047
Other languages
English (en)
Inventor
James M. Wilson
Ralf Schmid
Original Assignee
The Trustees Of The University Of Pennsylvania
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by The Trustees Of The University Of Pennsylvania filed Critical The Trustees Of The University Of Pennsylvania
Publication of WO2022094078A1 publication Critical patent/WO2022094078A1/fr

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86—Viral vectors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • A61K48/0058—Nucleic acids adapted for tissue specific expression, e.g. having tissue specific promoters as part of a contruct
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00—Structure or type of the nucleic acid
    • C12N2310/10—Type of nucleic acid
    • C12N2310/14—Type of nucleic acid interfering N.A.
    • C12N2310/141—MicroRNAs, miRNAs
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011—Details
    • C12N2750/14011—Parvoviridae
    • C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141—Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00—Nucleic acids vectors
    • C12N2800/22—Vectors comprising a coding region that has been codon optimised for expression in a respective host
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00—Vector systems having a special element relevant for transcription
    • C12N2830/008—Vector systems having a special element relevant for transcription cell type or tissue specific enhancer/promoter combination
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00—Vector systems having a special element relevant for transcription
    • C12N2830/42—Vector systems having a special element relevant for transcription being an intron or intervening sequence for splicing and/or stability of RNA
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00—Vector systems having a special element relevant for transcription
    • C12N2830/48—Vector systems having a special element relevant for transcription regulating transport or export of RNA, e.g. RRE, PRE, WPRE, CTE
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2830/00—Vector systems having a special element relevant for transcription
    • C12N2830/50—Vector systems having a special element relevant for transcription regulating RNA stability, not being an intron, e.g. poly A signal

Definitions

  • Rett syndrome is a severe neurodevelopmental disorder ( ⁇ 1: 10,000 live female births) resulting from loss-of-function mutations in the X-linked gene encoding methyl-CpG-binding protein 2 (MECP2) (Amir, R. E. et al. (1999). Rett syndrome is caused by mutations in X-linked MECP2, encoding methyl-CpG-binding protein 2. Nat Genet 23, 185-188, doi: 10. 1038/13810).
  • MECP2 gene therapy has been pursued as an alternative approach to pharmacological therapy attempts.
  • An MECP2 expression cassette with endogenous regulatory elements from the mouse Mecp2 genomic locus packaged into AAV9 and delivered by neonatal intraventricular injection significantly increased the life span and general well-being of a male Rett syndrome model.
  • efficacy to correct behavior benchmarks to levels seen in wildtype littermates was limited (Sinnett, S. E. et al. (2017). Improved MECP2 Gene Therapy Extends the Survival of MeCP2-Null Mice without Apparent Toxicity after Intracistemal Delivery. Mol Ther Methods Clin Dev 5, 106-115, doi: 10. 1016/j.omtm.2017.04.006; and Gadalla, K. K.
  • rAAV Rett Syndrome
  • the rAAV carries a vector genome comprising inverted terminal repeats (ITR) and a nucleic acid sequence encoding a functional human methyl-CpG-binding protein 2 (hMECP2) under the control of regulatory sequences which direct the hMECP2 expression in a target cell, wherein the vector genome further comprises dorsal root ganglion (drg)- specific miRNA target sequences.
  • ITR inverted terminal repeats
  • hMECP2 functional human methyl-CpG-binding protein 2
  • a recombinant adeno-associated virus useful for treating.
  • the rAAV comprises: (a) an AAV capsid; and (b) a vector genome packaged in the AAV capsid of (a), wherein the vector genome comprises inverted terminal repeats (ITRs) and a nucleic acid sequence encoding a functional human methyl-CpG binding protein 2 (hMECP2) under control of regulatory sequences which direct the hMECP2 expression in central nervous system cells, wherein the regulatory sequences comprise a Ubiquitin C (UbC) promoter, wherein the vector genome further comprises at least eight tandem repeats comprising at least a first, at least second, at least third, at least fourth, at least fifth, at least sixth, at least seventh and at least eighth miRNA target sequence, which may be the same or different, and target miR183 or miR182, and wherein the hMECP2- coding sequence is SEQ ID NO: 3 or a sequence at least about 95% identical
  • the regulatory sequences further comprise one or more of a Kozak sequence, an intron, an enhancer, a TATA signal and a polyadenylation (polyA) signal sequence, optionally wherein the regulatory sequences further comprise and WPRE element.
  • the at least eight tandem repeats comprise at least four tandem repeats of dorsal root ganglion (drg)-specific miRNA 182 target sequences and at least four tandem repeats of drg-specific miRNA 183 target sequences.
  • drg dorsal root ganglion
  • FIG. 1 provides a schematic diagram of a plasmid for producing an rAAV comprising an AAV.hSyn.hMECP2co.SV40 vector genome having nucleic acid sequence of SEQ ID NO: 23, comprising expression cassette having nucleic acid sequence of SEQ ID NO: 1.
  • FIGs. 2A to 2B provide a schematic diagram of a plasmid for producing an rAAV comprising an AAV.hSyn.hMECP2co.miRl 83. SV40 vector genome and show successful expression of hMECP2 .
  • FIG. 2A provides a schematic diagram of plasmid comprising an AAV.hSyn.hMECP2co.miR183.SV40 vector genome having nucleic acid sequence of SEQ ID NO: 15, comprising expression cassette having nucleic acid sequence of SEQ ID NO: 6.
  • FIG 2B provides a Western Blot showing that MECP2 expression in mouse brain is not affected by the miR183 in expression cassette, when rAAV was administered with an IV injection of 5 x 10 n GC/mouse to a Mecp2-ko mouse cortex at 3 weeks.
  • FIG. 3 provides a schematic diagram of a plasmid for producing an rAAV comprising an AAV.CB7.CI.hMECP2.rBG vector genome having nucleic acid sequence of SEQ ID NO: 24, comprising expression cassette having nucleic acid sequence of SEQ ID NO: 4.
  • FIGs. 4A to 4E show successful expression of hMECP2 in Mecp2-ko mice via the AAV-PHP.B.hSyn-MECP2co vector.
  • FIG. 4A provides a representative image showing cell nuclei in brain cortex of a Mecp2-ko mouse via DAPI staining.
  • FIG. 4B shows that no MECP2 protein was detected in the same microscopic field in FIG. 4A.
  • FIG. 4C is an overlay of the images of FIGs. 4A and 4B.
  • FIG. 4D is a representative image showing MECP2 expression in brain cortex of a wildtype mouse.
  • FIG. 4E is a representative image showing MECP2 expression in brain cortex of a Mecp2-ko mouse treated via the AAV- PHP.B.hSyn-MECP2co vector. See, Example 2 for more details. Scale bar, 100 pm.
  • FIGs. 5A to 5C provide Kaplan-Meier survival plots (FIG. 5A) and body weights (FIGs. 5B and 5C) of Mecp2-ko mice (HEMI or KO) treated with 3 x 10 10 GC/mouse, 1 x 10 11 GC/mouse, 2.5 x 10 11 GC/mouse, and 5 x 10 11 GC/mouse of the AAV-PHP.B.hSyn- MECP2co vector. Wildtype littermates and Mecp2- o mice administrated with only PBS served as controls. See, Example 2 for more details.
  • FIGs. 6A to 6F show behavior correction and quantification of MECP2 expression in Mecp2-ko mice (HEMI) treated with AAV-PHP.B.hSyn-MECP2co vector. Wildtype littermates and Mecp2-ko mice administrated with only PBS served as controls where applicable.
  • FIG. 6A and FIG. 6B provide ambulatory activity level and rearing activity level tested in the Open Field Assay respectively; while FIG. 6C and FIG. 6D provide time spent in Open Zone and frequency of entering Open Zone tested in the Elevated Zero Maze respectively (rAAV administered at 1 x 10 11 GC/mouse, 2.5 x 10 11 GC/mouse, and 5 x 10 11 GC/mouse).
  • FIG. 6F show a representative percentage of neurons semi- automatically quantified from triple-stained immunofluorescent images and plotted as % MECP2+/NeuN+ cell at different treatment doses (FIG. 6E, Cerebral Cortex; FIG. 6F, Hippocampus). See, Example 2 for more details.
  • FIGs. 7A to 7C show behavior correction of Mecp2-ko mice (HEMI) treated with 1 x 10 11 GC/mouse, and 2.5 x 10 11 GC/mouse of the AAV-PHP.B.hSyn-MECP2co vector. Wildtype littermates and Mecp2-ko mice administrated with only PBS served as controls where applicable.
  • FIG. 7A provides latency to fall tested using rotarod
  • FIG. 7B shows marbles buried
  • FIG. 7C shows spontaneous alteration index tested using the Y-maze. See, Example 2 for more details.
  • FIGs. 8A to 8B provide representative images of dorsal white matter of juvenile mice post treatment and blots with relative overexpression of MECP2.
  • FIG. 8A to 8B provide representative images of dorsal white matter of juvenile mice post treatment and blots with relative overexpression of MECP2.
  • FIG. 8A provides representative images of Luxol® Fast staining of dorsal white matter of juvenile wt mice treated with an increasing dose of AAV.hSyn.hMECP2 (Group 1, 3 x 10 9 GC/mouse; Group 2, 1 x IO 10 GC/mouse; Group 3, 5 x IO 10 GC/mouse; Group 4, 1 x 10 11 GC/mouse; Group 5, 5 x 10 11 GC/mouse; Group 6, 1 x 10 12 GC/mouse; and Group 7, 5 x 10 12 GC/mouse).
  • FIG. 8B provides with a graph of relative overexpression of MECP2 in WT brains after AAV vector injection at different doses (as quantified from Western blots). See, Example 2 for more details.
  • FIG. 9 shows cells and MECP2 positive cells in pyramidal layer of hippocampus, grey matter of spinal cord, and dorsal root ganglion cells (DRG) of wild type mice with or without the vector treatment.
  • FIGs. 10A to 10C provide ambulatory activity (FIG. 10A), rearing activity (FIG. 10B) tested in Open Filed Assay and latency to fall tested using a rotarod (FIG. 10C) on adult wt mice treated with 1 x 10 12 GC/mouse AAV.hSyn.hMECP2 or only PBS. See, Example 2 for more details.
  • FIG. 11 provides representative images showing axonopathy in dorsal white matter tracts observed in rhesus macaques treated with AAVhu68.MECP vectors. See, Example 3 for more details.
  • FIG. 12 shows mild to moderate loss of myelin in Spinal White Matter Tracts in the tested groups. See, Example 3 for more details.
  • FIGs. 13A to 13D provide vector biodistribution across various tissues.
  • FIG. 13A shows biodistribution of the AAVhu68.MeP426.MECP2.RDHl. Staffer vector.
  • FIG. 13B shows biodistribution of the AAVhu68.MeP426.MECP2-myc.RDHl. Staffer vector.
  • FIG. 13C shows biodistribution of the AAVhu68sc.mMeP546.SVI.MeCP2el.SpA vector.
  • FIG. 13D shows biodistribution of the AAVhu68.CB7.CI.MECP2.rBG vector. See Example 3 for more details.
  • FIG. 14 shows successful expression of hMECP2 in both brain cortex and dorsal root ganglia of spinal cord in Group 2 using anti-myc antibodies. See, Example 3 for more details.
  • FIG. 15 shows successful expression of hMECP2 in both brain cortex and dorsal root ganglia of spinal cord in Groups 2 and 4 using anti-MECP2 antibodies. See, Example 3 for more details.
  • FIGs. 16A to 16C provide biodistribution across various tissues of the AAVhu68.hSyn.MECP2co.SV40 vector administrated at different doses (FIG. 16A, 3 x 10 13 GC/NHP; FIG. 16B, 1 x 10 13 GC/NHP; and FIG. 16C, 3 x 10 12 GC/NHP). See, Example 3 for more details.
  • FIG. 17 provides relative expression of hMECP2 across various tissues achieved by the AAVhu68.hSyn.MECP2co.SV40 vector. See, Example 3 for more details.
  • FIGs. 18A to 18C show reduction in axonopathy in non-human primates (NHP) with DRG de-targeting via miR183.
  • FIG. 18A provides with representative images of MECP2 expression in DRG cells (in-situ hybridization, MECP2 shown in red, nuclei shown in blue).
  • FIG. 18B spinal cord
  • FIG. 19 provides a Western blot showing that treatment with AAV-MECP2 vector led to robust expression of MECP2 in Mecp2-ko brains.
  • FIG 20 shows a Kaplan-Meier survival plot WT and MECP2-KO mice administered PBS (served as control), MECP2 KO mice treated with AAVrh9I.UbC.MECP2co.miRI82(4x).miRI83(4x).rBG at a dose of 2.5 x IO 10 GC (2.5el0 gc) and 5 x IO 10 GC (5el0 gc).
  • FIG. 21 shows a plot of body weights of WT and MECP2-KO mice administered PBS (served as control), MECP2 KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at a dose of 2.5 x IO 10 GC (2.5el0 gc) and 5 x IO 10 GC (5el0 gc).
  • FIG. 22 shows a plot of phenotypic score of WT and MECP2-KO mice administered PBS (served as control), MECP2 KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at a dose of 2.5 x IO 10 GC (2.5el0 gc) and 5 x IO 10 GC (5eI0 gc).
  • FIGs. 23 A to 23F show the results of behavior testing performed at day 60 in WT and MECP2-KO mice treated with AAVrh9I.UbC.MECP2co.miRI82(4x).miRI83(4x).rBG at a dose of 5 x IO 10 GC (5el0 gc).
  • FIG. 23A shows ambulatory activity plotted in 5-minute bins.
  • FIG. 23B shows total ambulatory activity.
  • FIG. 23C shows central zone activity plotted in 5-minute bins.
  • FIG. 23D shows total central zone activity.
  • FIG. 23E shows rearing activity plotted in 5-minute bins.
  • FIG. 23F shows total rearing activity.
  • FIG. 23A shows ambulatory activity plotted in 5-minute bins.
  • FIG. 23B shows total ambulatory activity.
  • FIG. 23C shows central zone activity plotted in 5-minute bins.
  • FIG. 23D shows total central zone activity.
  • FIG. 23E shows rearing activity plotted in 5-minute bin
  • FIG. 24 shows the results of rotarod test performed at day 60 in WT and MECP2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at a dose of 5 x IO 10 GC (5el0 gc); plotted as a latency to fall over seconds.
  • FIG. 25 shows the results of marble burying test performed at day 60 in WT and MECP2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at a dose of 5 x 10 10 GC (5el0 gc); plotted as %marble buried.
  • FIG. 26 shows the results of nest building test performed at day 60 in WT and MECP2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at a dose of 5 x 10 10 GC (5el0 gc); plotted as nesting score.
  • FIG. 1 shows a schematic diagram of a plasmid for producing an rAAV comprising an AAV.
  • UbC.MECP2co.miR182(4x).miR183(4x).rBG vector genome having nucleic acid sequence of SEQ ID NO: 39, comprising expression cassette having nucleic acid sequence of SEQ ID NO: 37.
  • FIGs. 28A and 28B show representative immunofluorescence images from cortex (68 days after injection with 3 x 10 10 GC), showing abundant MECP2 expression that is colocalizing the neuronal marker NeuN (neuronal marker).
  • FIG. 28A shows a representative immunofluorescent image of cortex stained for expression of NeuN (neuronal marker).
  • FIG. 28B shows a representative immunofluorescent image of cortex stained for expression of MECP2.
  • FIG. 29A shows a plot of body weight of WT and Mecp2-ko mice administered PBS (served as control), MECP2 KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3e 10), and 6 x 10 10 GC (6el0).
  • FIG. 29B shows a Kaplan-Meier survival plot WT and Mecp2-KO mice administered PBS (served as control), Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at a dose of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3e 10) and 6 x 10 10 GC (6e 10).
  • FIG. 29C shows a plot of phenotypic score (0 stands for no symptoms, 5 stands for severe Rett-like symptoms) of WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3e 10) and 6 x 10 10 GC (6e 10).
  • 29D shows results of the evaluation at D40 (day 40) for abnormal breathing (apneas) by whole-body plethysmography in WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x IO 10 GC (2el0), 3 x IO 10 GC (3e 10) and 6 x IO 10 GC (6el0).
  • FIG. 29E shows a plot of motor function evaluation at D60 (day 60) on a rotarod in WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3e 10) and 6 x 10 10 GC (6el0).
  • FIG. 30A shows plotted ambulatory activity in WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3e 10) and 6 x 10 10 GC (6el0).
  • FIG. 30B shows plotted ambulatory activity in center in WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3e 10) and 6 x 10 10 GC (6el0).
  • FIG 30C shows plotted rearing activity in WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3e 10) and 6 x 10 10 GC (6el0).
  • FIG. 31 A shows a representative image of RNAscope in-situ hybridization (ISH) of cortical brain section in native control NHP.
  • FIG. 3 IB shows a representative image of RNAscope in-situ hybridization (ISH) of cortical brain section in NHP 1 treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG via intra-cistema magna (ICM) injection at dose of 3 x 10 13 GC (3e 13).
  • ISH RNAscope in-situ hybridization
  • ICM intra-cistema magna
  • FIG. 32A shows quantification of bulk tissue, including brain tissue, analyzed for vector transduction (GC/diploid genome).
  • FIG. 32B shows quantification of bulk tissue for MECP2 transgene expression in various tissues.
  • FIG. 33 shows quantification of vector transduction (VG, vector genome) and MECP2 transgene (Tg, MECP2 transgene mRNA) expression on a single-neuron basis for motor cortex in 3 NHPs.
  • VG vector genome
  • Tg MECP2 transgene mRNA
  • FIGs. 34A and 34B and table below show comparison between different DRG- detargeting approaches including in naive (untreated NHP), NHP treated with no miRNA, NHP treated with AAV comprising 4 tandem repeats of miR183, or in NHP treated with AAV comprising 4 tandem repeats of miR182 and 4 tandem repeats of miR183.
  • FIG. 34A shows severity scores (5 stands for maximum severity) assigned by veterinary pathologist blinded to treatment status in dorsal root ganglia tissue.
  • FIG. 34B shows severity scores (5 stands for maximum severity) assigned by veterinary pathologist blinded to treatment status in spinal cord (SpC) tissue.
  • compositions and methods for treating Rett Syndrome are provided herein.
  • An effective amount of a recombinant adeno-associated virus (rAAV) having an AAV capsid (e.g., AAVrh91, AAVhu68 or AAV-PHP.B) and packaged therein a vector genome encoding a functional human methyl-CpG binding protein 2 (hMECP2) and further comprising DRG-detargeting miRNA sequence is delivered to a subject in need.
  • a therapeutic, recombinant, and replicationdefective adeno-associated virus which is useful for treating Rett Syndrome (RTT) in a subject in need thereof.
  • the rAAV carries a vector genome comprising inverted terminal repeats (ITR) and a nucleic acid sequence encoding a functional human methyl-CpG-binding protein 2 (hMECP2) under the control of regulatory sequences which direct the hMECP2 expression in a target cell.
  • the rAAV further comprises an AAV capsid in which the vector genome is packaged, for example an AAVhu68 capsid or an AAV-PHP.B capsid.
  • the hMECP2-coding sequence is about 95% to 100% identical to SEQ ID NO: 3. Additionally or alternatively, the function hMECP2 protein has an amino acid sequence of SEQ ID NO: 2. In certain embodiments, the hMECP2-coding sequence is SEQ ID NO: 3. In certain embodiments, the vector genome further comprises at least two tandem repeats of dorsal root ganglion (drg)-specific miRNA target sequences. In certain embodiments, the vector genome has a sequence of nucleotide (nt) 1 to nt 2728 of SEQ ID NO: 1 or nt 1 to nt 2802 of SEQ ID NO: 6. In certain embodiments, the rAAV or a composition comprising the rAAV is administrable to a subject in need thereof to ameliorate symptoms of Rett Syndrome and or to delay progression of Rett Syndrome.
  • drg dorsal root ganglion
  • a production system useful for producing the rAAV is provided.
  • cells were cultured which comprises a nucleic acid sequence encoding an AAV capsid protein, a vector genome as described herein and sufficient AAV rep functions and helper functions to permit packaging of the vector genome into the AAV capsid.
  • the AAV capsid is a Clade F capsid, e.g., AAVhu68, AAV9, or AAV-PHP.B.
  • a vector which is useful for treating Rett Syndrome (RTT) in a subject in need thereof.
  • the vector carries a nucleic acid sequence encoding a functional human methyl-CpG-binding protein 2 (hMECP2) under the control of regulatory sequences which direct the hMECP2 expression in a target cell.
  • hMECP2-coding sequence is about 95% to 100% identical to SEQ ID NO: 3.
  • the function hMECP2 protein has an amino acid sequence of SEQ ID NO: 2.
  • the hMECP2-coding sequence is SEQ ID NO: 3.
  • the vector further carries at least two tandem repeats of dorsal root ganglion (drg)-specific miRNA target sequences.
  • the vector or a composition comprising the vector is administrable to a subject in need thereof to ameliorate symptoms of Rett Syndrome and or to delay progression of Rett Syndrome.
  • a method of treating a subject having Rett Syndrome, or ameliorating symptoms of Rett Syndrome, or delaying progression of Rett Syndrome comprises administrating an effective amount of a rAAV or a vector as described herein to a subject in need thereof.
  • the vector or rAAV is administrable to a patient via an intra-cistema magna injection (ICM).
  • ICM intra-cistema magna injection
  • a vector or a composition is provided which is administrable to a patient having Rett Syndrome who is 18 years of age or younger.
  • a vector or a composition is provided which is administered to a patient having Rett Syndrome who is 18 years of age or older.
  • Methyl-CpG Binding Protein 2 (MECP2, MeCP2 or MeCp2) is a chromosomal protein that binds to methylated DNA and then interacts with other proteins (for example, histone deacetylase, the corepressor SIN3A, or the transcription factor CREB 1) to form a complex that turns off a gene or to act as a transcriptional activator.
  • proteins for example, histone deacetylase, the corepressor SIN3A, or the transcription factor CREB 1
  • hMECP2 Isoform A also known as hMECP2Beta or hMECP2- e2(P51608-1, SEQ ID NO: 8)
  • Isoform B also known as hMECP2alpha or hMECP2-el (P51608-2, SEQ ID NO: 2).
  • MECP2 and hMECP2 may be used interchangeably when referring to a human MECP2 protein.
  • a functional hMECP2 protein refers to an isoform, a natural variant, a variant, a polymorph, or a truncation of a MECP2 protein which is not associated with Rett Syndrome and/or delivery or expression of which may ameliorate symptoms or delay progression of Rett Syndrome in an animal model or a patient.
  • the functional hMECP2 protein has an amino acid sequence of SEQ ID NO: 2 or an amino acid sequence at least about 90 % (e.g., at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto. In certain embodiments, the functional hMECP2 protein has an amino acid sequence of SEQ ID NO: 2 or an amino acid sequence at least about 78% to at least about 80% identical thereto.
  • the functional hMECP2 protein has an amino acid sequence of SEQ ID NO: 8 or an amino acid sequence at least about 90 % (e.g., at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto.
  • the functional hMECP2 protein has an amino acid sequence of NCBI Reference Sequences NP_001303266. 1 (SEQ ID NO: 19), NP_004983. 1 (SEQ ID NO:20), or NP_001104262. 1 (SEQ ID NO: 21).
  • the functional hMECP2 is a truncated hMECP2 which comprises a methyl-CpG binding domain (MBD) having the sequence and a NCoR/SMRT Interaction Domain (NID).
  • MBD methyl-CpG binding domain
  • NID NCoR/SMRT Interaction Domain
  • a functional hMECP2 protein ameliorates symptoms or delays progression of Rett Syndrome in an RTT animal model.
  • RTT animal model is a Mecp2-ko mouse.
  • the RTT animal model is a male hemizygous Mecp2-ko mouse.
  • the RTT symptoms or progression may be evaluated using various assays/methods, including but not limited to, a survival plot (e.g., Kaplan-Meier survival plot), monitoring body weights, and observing behavior changes (for example, by Open Field Assay, Elevated Zone Maze, Y Maze, Marble Burying Assay, and rotarod assay).
  • administration or expression of a functional hMECP2 protein in an RTT animal model leads to amelioration of RTT symptoms or delay in RTT progression shown by an assay result which is at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 100%, or more than 100% of that obtained in a corresponding wildtype animal.
  • administration or expression of a functional hMECP2 protein in an RTT animal model leads to amelioration of RTT symptoms or delay in RTT progression shown by an improved assay result which is at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 100%, or more than 100% of that obtained from a corresponding non-treated RTT animal.
  • An illustration is detailed in Example 2.
  • hMECP2 coding sequence a nucleic acid sequence encoding a functional hMECP2 protein, termed as hMECP2 coding sequence or MECP2 coding sequence.
  • the hMECP2 coding sequence is selected from SEQ ID NO: 3 (referred to as MECP2 or MECP2co) or NCBI Reference Sequences NM_001110792. 1 (referred to as MECP2 or MECP2el; SEQ ID NO: 18) encoding for amino acid sequence NP_001104262. 1 (SEQ ID NO: 21), NM_001316337.
  • the hMECP2 coding sequence is a modified or engineered (hMECP2 or hMECP2co).
  • the modified or engineered (hMECP2 or hMECP2co) shares less than about 70% (e.g., about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identity to the NCBI Reference Sequences.
  • the hMECP2 coding sequence is SEQ ID NO: 3 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%) identical thereto.
  • the coding sequence having the recited identity to SEQ ID NO: 3 encodes an amino acid of SEQ ID NO: 2.
  • the coding sequence having the recited identity to SEQ ID NO: 3 does not encode the protein of SEQ ID NO: 16. In certain embodiments, the nucleic acid sequence having the recited identity to SEQ ID NO: 3 does not encode the protein to SEQ ID NO: 17. In certain embodiments, the nucleic acid sequence having the recited identity to SEQ ID NO: 3 does not encode SEQ ID NO: 18.
  • the hMECP2 coding sequence is SEQ ID NO: 18 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%) identical thereto, which encodes the amino acid sequence of SEQ ID NO: 21.
  • a nucleic acid sequence at least about 70% (e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%) identical thereto, which encodes the amino acid sequence of
  • the hMECP2 coding sequence is SEQ ID NO: 16 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%) identical thereto, which encodes the amino acid sequence of SEQ ID NO: 19.
  • the hMECP2 coding sequence is SEQ ID NO: 17 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%) identical thereto, which encodes the amino acid sequence of SEQ ID NO: 20.
  • a nucleic acid sequence at least about 70% (e.g., at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or at least about 99.9%) identical thereto, which encodes the amino acid sequence of
  • nucleic acid can be RNA, DNA, or a modification thereof, and can be single or double stranded, and can be selected, for example, from a group including: nucleic acid encoding a protein of interest, oligonucleotides, nucleic acid analogues, for example peptide-nucleic acid (PNA), pseudocomplementary PNA (pc-PNA), locked nucleic acid (LNA) etc.
  • PNA peptide-nucleic acid
  • pc-PNA pseudocomplementary PNA
  • LNA locked nucleic acid
  • nucleic acid sequences include, for example, but are not limited to, nucleic acid sequence encoding proteins, for example that act as transcriptional repressors, antisense molecules, ribozymes, small inhibitory nucleic acid sequences, for example but are not limited to RNAi, shRNAi, siRNA, micro RNAi (mRNAi ), antisense oligonucleotides etc.
  • percent (%) identity , sequence identity , percent sequence identity , or “percent identical” in the context of nucleic acid sequences refers to the residues in the two sequences which are the same when aligned for correspondence.
  • the length of sequence identity comparison may be over the full-length of the genome, the full-length of a gene coding sequence, or a fragment of at least about 500 to 5000 nucleotides, is desired. However, identity among smaller fragments, e.g., of at least about nine nucleotides, usually at least about 20 to 24 nucleotides, at least about 28 to 32 nucleotides, at least about 36 or more nucleotides, may also be desired.
  • Percent identity may be readily determined for amino acid sequences over the full- length of a protein, polypeptide, about 32 amino acids, about 330 amino acids, or a peptide fragment thereof or the corresponding nucleic acid sequence coding sequences.
  • a suitable amino acid fragment may be at least about 8 amino acids in length, and may be up to about 700 amino acids.
  • identity”, “homology”, or “similarity” is determined in reference to “aligned” sequences. “Aligned” sequences or “alignments” refer to multiple nucleic acid sequences or protein (amino acids) sequences, often containing corrections for missing or additional bases or amino acids as compared to a reference sequence.
  • Sequence alignment programs are available for amino acid sequences, e.g., the “Clustal X”, “Clustal Omega” “MAP”, “PIMA”, “MSA”, “BLOCKMAKER”, “MEME”, and “Match-Box” programs. Generally, any of these programs are used at default settings, although one of skill in the art can alter these settings as needed. Alternatively, one of skill in the art can utilize another algorithm or computer program which provides at least the level of identity or alignment as that provided by the referenced algorithms and programs. See, e.g., J. D. Thomson et al, Nucl. Acids. Res., “A comprehensive comparison of multiple sequence alignments”, 27(13):2682-2690 (1999).
  • nucleic acid sequences are also available for nucleic acid sequences. Examples of such programs include, “Clustal W”, “Clustal Omega”, “CAP Sequence Assembly”, “BLAST”, “MAP”, and “MEME”, which are accessible through Web Servers on the internet. Other sources for such programs are known to those of skill in the art. Alternatively, Vector NTI utilities are also used. There are also a number of algorithms known in the art that can be used to measure nucleotide sequence identity, including those contained in the programs described above. As another example, polynucleotide sequences can be compared using FastaTM, a program in GCG Version 6.1. FastaTM provides alignments and percent sequence identity of the regions of the best overlap between the query and search sequences. For instance, percent sequence identity between nucleic acid sequences can be determined using FastaTM with its default parameters (a word size of 6 and the NOPAM factor for the scoring matrix) as provided in GCG Version 6. 1, herein incorporated by reference.
  • MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of cognitive disability in females. Males who have the genetic mutation that causes Rett syndrome are affected in devastating ways. Most of them die before birth or in early infancy. See, e.g. , ninds.nih.gov/Disorders/Patient-Caregiver-Education/Fact-Sheets/Rett-Syndrome- F act-Sheet and omim.org/entry /312750.
  • “Patient” or “subject”, as used herein interchangeably, means a male or female mammalian animal, including a human, a veterinary or farm animal, a domestic animal or pet, and animals normally used for clinical research.
  • the subject of these methods and compositions is a human patient.
  • the subject of these methods and compositions is a male or female human.
  • the subject of these methods and compositions is diagnosed with Rett Syndrome and/or with symptoms of Rett Syndrome.
  • Stage I called early onset, typically begins between 6 and 18 months of age
  • Stage II or the rapid destructive stage, usually begins between ages
  • the subject is a human less than 18 years old (e.g., less than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 month(s) old, or less than about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 12, 13, 14, 15, 16, 17, 18 year(s) old). Additionally or alternatively, the subject is a newborn or a human more than 1 month old (e.g., more than about 2, 3, 4, 5, 6, 7, 8, 9, 10,
  • I I month(s) old or more than about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 12, 13, 14, 15, 16, 17, 18 year(s) old).
  • the patient is about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 month/ s) old, or about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.5, 11, 12, 13, 14, 15, 16, 17, 18 year(s) old.
  • the patient is a toddler, e.g., 18 months to 3 years of age.
  • the patient is from 3 years to 6 years of age, from 3 years to 12 years of age, from 3 years to 18 years of age, from 3 years to 30 years of age. In certain embodiments, patients are 18 years of age or older, or are older than 18 years of age.
  • Symptoms of Rett Syndrome may include, but are not limited to the following: normal early growth and development followed by a slowing of development, loss of muscle tone (hypotonia), difficulty feeding, and jerkiness in limb movements, loss of purposeful use of the hands, distinctive hand movements, problems crawling or walking, diminished eye contact, autistic-like behaviors, walking on the toes, sleep problems, a widebased gait, teeth grinding and difficulty chewing, slowed growth, seizures, cognitive disabilities, and breathing difficulties while awake such as hyperventilation, apnea (breath holding), and air swallowing, Apraxia (the inability to perform motor functions, including eye gaze and speech), delays in gross motor skills such as sitting or crawling, slowed brain and head growth, compulsive hand movements such as wringing and washing, problems with walking, seizures, and intellectual disability.
  • normal early growth and development followed by a slowing of development, loss of muscle tone (hypotonia), difficulty feeding, and jerkiness in limb movements, loss of purpose
  • the terms “increase” “decrease” “reduce” “ameliorate” “improve” “delay” or any grammatical variation thereof, or any similar terms indication a change means a variation of about 5-fold, about 2-fold, about 1-fold, about 90%, about 80%, about 70%, about 60%, about 50%, about 40%, about 30%, about 20%, about 10%, about 5 % compared to the corresponding reference (e.g., untreated control or a subject in normal condition without RTT), unless otherwise specified.
  • the patient receives medications controlling some signs and symptoms associated with the RTT, such as seizures, muscle stiffness, or problems with breathing, sleep, the gastrointestinal tract or the heart.
  • an immunosuppressive co-therapy may be used in a subject in need.
  • Immunosuppressants for such co-therapy include, but are not limited to, a glucocorticoid, steroids, antimetabolites, T-cell inhibitors, a macrolide (e.g., a rapamycin or rapalog), and cytostatic agents including an alkylating agent, an anti-metabolite, a cytotoxic antibiotic, an antibody, or an agent active on immunophilin.
  • the immune suppressant may include a nitrogen mustard, nitrosourea, platinum compound, methotrexate, azathioprine, mercaptopurine, fluorouracil, dactinomycin, an anthracycline, mitomycin C, bleomycin, mithramycin, IL-2 receptor- (CD25-) or CD3-directed antibodies, anti-IL-2 antibodies, ciclosporin, tacrolimus, sirolimus, IFN-P, IFN-y, an opioid, or TNF-a (tumor necrosis factoralpha) binding agent.
  • the immunosuppressive therapy may be started 0, 1, 2, 3, 4, 5, 6, 7, or more days prior to or after the gene therapy administration.
  • Such immunosuppressive therapy may involve administration of one, two or more drugs (e.g., glucocorticoids, prednelisone, micophenolate mofetil (MMF) and/or sirolimus (i.e., rapamycin)).
  • drugs e.g., glucocorticoids, prednelisone, micophenolate mofetil (MMF) and/or sirolimus (i.e., rapamycin
  • Such immunosuppressive drugs may be administrated to a subject in need once, twice or for more times at the same dose or an adjusted dose.
  • Such therapy may involve co-administration of two or more drugs, the (e.g., prednelisone, micophenolate mofetil (MMF) and/or sirolimus (i.e., rapamycin)) on the same day.
  • One or more of these drugs may be continued after gene therapy administration, at the same dose or an adjusted dose.
  • Such therapy may be for about 1 week
  • nucleic acid sequence comprising the hMECP2 coding sequence under control of regulatory sequences which direct the hMECP2 expression in a target cell, also termed as an expression cassette.
  • an “expression cassette” refers to a nucleic acid molecule which comprises a biologically useful nucleic acid sequence (e.g., a gene cDNA encoding a protein, enzyme or other useful gene product, mRNA, etc.) and regulatory sequences operably linked thereto which direct or modulate transcription, translation, and/or expression of the nucleic acid sequence and its gene product.
  • a biologically useful nucleic acid sequence e.g., a gene cDNA encoding a protein, enzyme or other useful gene product, mRNA, etc.
  • regulatory sequences operably linked thereto which direct or modulate transcription, translation, and/or expression of the nucleic acid sequence and its gene product.
  • “operably linked” sequences include both regulatory sequences that are contiguous or non-contiguous with the nucleic acid sequence and regulatory sequences that act in cis or trans with nucleic acid sequence.
  • Such regulatory sequences typically include, e.g., one or more of a promoter, an enhancer, an intron, a Kozak sequence, a polyadenylation sequence, and a TATA signal.
  • the expression cassette may contain regulatory sequences upstream (5 ’ to) of the gene sequence, e.g., one or more of a promoter, an enhancer, an intron, etc, and one or more of an enhancer, or regulatory sequences downstream (3’ to) a gene sequence, e.g., 3’ untranslated region (‘3 UTR) comprising a polyadenylation site, among other elements.
  • regulatory sequences upstream (5 ’ to) of the gene sequence e.g., one or more of a promoter, an enhancer, an intron, etc, and one or more of an enhancer, or regulatory sequences downstream (3’ to) a gene sequence, e.g., 3’ untranslated region (‘3 UTR) comprising a polyadenylation site, among other elements.
  • the regulatory sequences are operably linked to the nucleic acid sequence of a gene product, wherein the regulatory sequences are separated from nucleic acid sequence of a gene product by an intervening nucleic acid sequences, i.e., 5 ’-untranslated regions (5 UTR).
  • the expression cassette comprises nucleic acid sequence of one or more of gene products.
  • the expression cassette can be a monocistronic or a bicistronic expression cassette.
  • the term “transgene” refers to one or more DNA sequences from an exogenous source which are inserted into a target cell.
  • such an expression cassette for generating a viral vector contains the coding sequence for the gene product described herein flanked by packaging signals of the viral genome and other expression control sequences such as those described herein.
  • a vector genome may contain two or more expression cassettes.
  • the expression cassette comprises a hMECP2 coding sequence and may include other regulatory sequences therefor.
  • the regulatory sequences necessary are operably linked to the hMECP2 coding sequence in a manner which permits its transcription, translation and/or expression in target cell.
  • the promoter is a tissue-specific promoter, e.g., a CNS- specific or neuron-specific promoter.
  • the promoter is a human synapsin promoter (also termed hSyn or Syn herein).
  • an additional or alternative neuron-specific promoter sequence may be selected from neuron-specific enolase (NSE) promoter (Andersen et al., (1993) Cell. Mol. Neurobiol., 13:503 15), neurofilament light chain gene promoter (Piccioli et al., (1991) Proc. Natl. Acad. Sci.
  • the human Synaspin promoter has the sequence of (e.g., nt 1 to nt 466 of SEQ ID NO: 1, or SEQ ID NO: 22).
  • a chicken beta actin promoter with a cytomegalovirus enhancer (CB7) promoter may be selected.
  • Such a CB7 promoter may have a sequence of, e.g., nt 1 to nt 666 of SEQ ID NO:4, or SEQ ID NO: 12.
  • a human elongation initiation factor 1 alpha promoter may be selected.
  • EFla promoter may have a sequence of, e.g., SEQ ID NO: 13.
  • a human ubiquitin C (UbC) promoter SEQ ID NO: 41
  • a MeP426 promoter or a MEP546 promoter for expression of hMECP2.
  • other promoters, or an additional promoter may be selected.
  • the regulatory sequences direct hMECP2 expression in central nervous system cells.
  • the target cell may be a central nervous system cell.
  • the target cell is one or more of an excitatory neuron, an inhibitory neuron, a glial cell, a cortex cell, a frontal cortex cell, a cerebral cortex cell, a spinal cord cell.
  • the target cell is a peripheral nervous system (PNS) cell, for example a retina cell.
  • PNS peripheral nervous system
  • a target cell such as a monocyte, a B lymphocyte, a T lymphocyte, a NK cell, a lymph node cell, a tonsil cell, a bone marrow mesenchymal cell, a stem cell, a bone marrow stem cell, a heart cell, an epithelium cell, a esophagus cell, a stomach cell, a fetal cut cell, a colon cell, a rectum cell, a liver cell, a kindly cell, a lung cell, a salivary gland cell, a thyroid cell, an adrenal cell, a breast cell, a pancreas cell, an islet of Langerhans cell, a gallbladder cell, a prostate cell, a urinary bladder cell, a skin cell, a uterus cell, a cervix cell, a testis cell, or any other cell which expresses a functional MECP2 protein in a subject without RTT.
  • a monocyte such as a monocyte,
  • an additional or alternative promoter sequence may be included as part of the expression control sequences (regulatory sequences), e.g., located between the selected 5’ ITR sequence and the coding sequence.
  • Constitutive promoters, regulatable promoters [see, e.g., WO 2011/126808 and WO 2013/04943], tissue specific promoters, or a promoter responsive to physiologic cues may be utilized in the vectors described herein.
  • the promoter(s) can be selected from different sources, e.g., human cytomegalovirus (CMV) immediate-early enhancer/promoter, the SV40 early enhancer/promoter, the JC polymovirus promoter, myelin basic protein (MBP) or glial fibrillary acidic protein (GFAP) promoters, herpes simplex virus (HSV-1) latency associated promoter (LAP), rouse sarcoma virus (RSV) long terminal repeat (LTR) promoter, neuronspecific promoter (RNSE), platelet derived growth factor (PDGF) promoter, hSYN, melaninconcentrating hormone (MCH) promoter, CBA, matrix metalloprotein promoter (MPP), and the chicken beta-actin promoter.
  • CMV human cytomegalovirus
  • MBP myelin basic protein
  • GFAP glial fibrillary acidic protein
  • HSV-1 herpes simplex virus
  • LAP rouse sar
  • a vector may contain one or more other appropriate transcription initiation sequences, transcription termination sequences, enhancer sequences, efficient RNA processing signals such as splicing and polyadenylation (poly A) signals; sequences that stabilize cytoplasmic mRNA for example WPRE; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance secretion of the encoded product.
  • a suitable enhancer is the CMV enhancer.
  • Other suitable enhancers include those that are appropriate for desired target tissue indications.
  • the regulatory sequences comprise one or more expression enhancers.
  • the regulatory sequences contain two or more expression enhancers.
  • an enhancer may include a CMV immediate early enhancer. This enhancer may be present in two copies which are located adjacent to one another. Alternatively, the dual copies of the enhancer may be separated by one or more sequences.
  • the expression cassette further contains an intron, e.g., the chicken beta-actin intron.
  • the intron is a chimeric intron (CI)- a hybrid intron consisting of a human beta-globin splice donor and immunoglobulin G (IgG) splice acceptor elements.
  • suitable introns include those known in the art, e.g., such as are described in WO 2011/126808.
  • polyA sequences examples include, e.g., Rabbit globin poly A (rabbit beta-globin polyA; rBG), SV40, SV50, bovine growth hormone (bGH), human growth hormone, and synthetic polyAs.
  • one or more sequences may be selected to stabilize mRNA.
  • An example of such a sequence is a modified WPRE sequence, which may be engineered upstream of the polyA sequence and downstream of the coding sequence (see, e.g., MA Zanta-Boussif, et al, Gene Therapy (2009) 16: 605-619). In certain embodiments, no WPRE sequence is present.
  • the expression cassette refers to nucleic acid molecule of SEQ ID NO: 1 and encoding for hMECP2 amino acid sequence of SEQ ID NO: 2. In certain embodiments, the expression cassette refers to nucleic acid molecule of SEQ ID NO: 4 and encoding for hMECP2 amino acid sequence of SEQ ID NO: 2.
  • another non-AAV coding sequence may be included, e.g., a peptide, polypeptide, protein, functional RNA molecule (e.g., miRNA, miRNA inhibitor) or other gene product, of interest.
  • Useful gene products may include miRNAs. miRNAs and other small interfering nucleic acids regulate gene expression via target RNA transcript cleavage/degradation or translational repression of the target messenger RNA (mRNA). miRNAs are natively expressed, typically as final 19-25 non-iranslated RNA products. miRNAs exhibit their activity through sequence-specific interactions with the 3' untranslated regions (UTR) of target mRNA .
  • miRNAs form hairpin precursors which are subsequently processed into a miRNA duplex, and further into a ‘"mature” single stranded miRNA molecule.
  • This mature miRNA guides a multiprotein complex, miRISC, which identifies target site, e.g., m the 3' UTR regions, of target mRNAs based upon their complementarity' to the mature miRNA.
  • an “miRNA target sequence” is a sequence located on the DNA positive strand (5’ to 3’) and is at least partially complementary to a miRNA sequence, including the miRNA seed sequence.
  • the miRNA target sequence is exogenous to the untranslated region of the encoded transgene product and is designed to be specifically targeted by miRNA in cells in which repression of transgene expression is desired.
  • miR183 cluster target sequence refers to a target sequence that responds to one or members of the miR183 cluster (alternatively termed family), including miRs-183, -96 and - 182 (as described by Dambal, S. et al. Nucleic Acids Res 43:7173-7188, 2015, which is incorporated herein by reference).
  • the messenger RNA (mRNA) for the transgene is present in a cell type to which the expression cassette containing the miRNA is delivered, such that specific binding of the miRNA to the 3’ UTR miRNA target sequences results in mRNA silencing and cleavage, thereby reducing or eliminating transgene expression only in the cells that express the miRNA.
  • the miRNA target sequence is at least 7 nucleotides to about 28 nucleotides in length, at least 8 nucleotides to about 28 nucleotides in length, 7 nucleotides to 28 nucleotides, 8 nucleotides to 18 nucleotides, 12 nucleotides to 28 nucleotides in length, about 20 to about 26 nucleotides, about 22 nucleotides, about 24 nucleotides, or about 26 nucleotides, and contains at least one consecutive region (e.g., 7 or 8 nucleotides) which is complementary to the miRNA seed sequence.
  • at least one consecutive region e.g., 7 or 8 nucleotides
  • the target sequence comprises a sequence with exact complementarity (100%) or partial complementarity to the miRNA seed sequence with some mismatches. In certain embodiments, the target sequence comprises at least 7 to 8 nucleotides which are 100% complementary to the miRNA seed sequence. In certain embodiments, the target sequence consists of a sequence which is 100% complementary to the miRNA seed sequence. In certain embodiments, the target sequence contains multiple copies (e.g., two, three, four or more copies) of the sequence which is 100% complementary to the seed sequence. In certain embodiments, the region of 100% complementarity comprises at least 30% of the length of the target sequence. In certain embodiments, the remainder of the target sequence has at least about 80% to about 99% complementarity to the miRNA. In certain embodiments, in an expression cassette containing a DNA positive strand, the miRNA target sequence is the reverse complement of the miRNA.
  • the miRNA target sequence for the at least first and/or at least second miRNA target sequence for the expression cassette mRNA or DNA positive strand is selected from (i) AGTGAATTCTACCAGTGCCATA (miR183, SEQ ID NO: 7); (ii) AGCAAAAATGTGCTAGTGCCAAA (miR-96, SEQ ID NO: 9), (iii) AGTGTGAGTTCTACCATTGCCAAA (miR182, SEQ ID NO: 10). In other embodiments, AGGGATTCCTGGGAAAACTGGAC (SEQ ID NO: 11) is selected.
  • the vector genome or expression cassette contains at least one miRNA target sequence that is a miR-183 target sequence.
  • the vector genome or expression cassette contains an miR-183 target sequence that includes AGTGAATTCTACCAGTGCCATA (SEQ ID NO:7), where the sequence complementary to the miR-183 seed sequence is underlined.
  • the vector genome or expression cassette contains more than one copy (e.g., two or three copies) of a sequence that is 100% complementary to the miR-183 seed sequence.
  • the vector genome or expression cassette contains 4 copies of a sequence that is 100% complementary to the miR-183 seed sequence.
  • a miR-183 target sequence is about 7 nucleotides to about 28 nucleotides in length and includes at least one region that is at least 100% complementary to the miR-183 seed sequence.
  • a miR-183 target sequence contains a sequence with partial complementarity to SEQ ID NO: 7 and, thus, when aligned to SEQ ID NO: 7, there are one or more mismatches.
  • a miR-183 target sequence comprises a sequence having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mismatches when aligned to SEQ ID NO: 7, where the mismatches may be non-contiguous.
  • a miR- 183 target sequence includes a region of 100% complementarity which also comprises at least 30% of the length of the miR-183 target sequence. In certain embodiments, the region of 100% complementarity includes a sequence with 100% complementarity to the miR-183 seed sequence. In certain embodiments, the remainder of a miR-183 target sequence has at least about 80% to about 99% complementarity to miR-183.
  • the expression cassette or vector genome includes a miR-183 target sequence that comprises a truncated SEQ ID NO: 1, i.e., a sequence that lacks at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides at either or both the 5’ or 3’ ends of SEQ ID NO: 1. In certain embodiments, the expression cassette or vector genome comprises a transgene and one miR-183 target sequence. In yet other embodiments, the expression cassette or vector genome comprises at least two, three or four miR- 183 target sequences.
  • the vector genome or expression cassette contains at least one miRNA target sequence that is a miR- 182 target sequence. In certain embodiments, the vector genome or expression cassette contains an miR- 182 target sequence that includes AGTGTGAGTTCTACCATTGCCAAA (SEQ ID NO: 10). In certain embodiments, the vector genome or expression cassette contains more than one copy (e.g., two or three copies) of a sequence that is 100% complementary to the miR- 182 seed sequence. In certain embodiments, a miR- 182 target sequence is about 7 nucleotides to about 28 nucleotides in length and includes at least one region that is at least 100% complementary to the miR- 182 seed sequence.
  • a miR- 182 target sequence contains a sequence with partial complementarity to SEQ ID NO: 10 and, thus, when aligned to SEQ ID NO: 10, there are one or more mismatches.
  • a miR- 183 target sequence comprises a sequence having at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mismatches when aligned to SEQ ID NO: 10, where the mismatches may be non-contiguous.
  • a miR-182 target sequence includes a region of 100% complementarity which also comprises at least 30% of the length of the miR-182 target sequence. In certain embodiments, the region of 100% complementarity includes a sequence with 100% complementarity to the miR-182 seed sequence.
  • the remainder of a miR-182 target sequence has at least about 80% to about 99% complementarity to miR-182.
  • the expression cassette or vector genome includes a miR-182 target sequence that comprises a truncated SEQ ID NO: 10, i.e., a sequence that lacks at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides at either or both the 5’ or 3’ ends of SEQ ID NO: 10.
  • the expression cassette or vector genome comprises a transgene and one miR- 182 target sequence.
  • the expression cassette or vector genome comprises at least two, three or four miR- 182 target sequences.
  • tandem repeats is used herein to refer to the presence of two or more consecutive miRNA target sequences. These miRNA target sequences may be continuous, i.e., located directly after one another such that the 3’ end of one is directly upstream of the 5’ end of the next with no intervening sequences, or vice versa. In another embodiment, two or more of the miRNA target sequences are separated by a short spacer sequence.
  • spacer is any selected nucleic acid sequence, e.g., of 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 nucleotides in length which is located between two or more consecutive miRNA target sequences.
  • the spacer is 1 to 8 nucleotides in length, 2 to 7 nucleotides in length, 3 to 6 nucleotides in length, four nucleotides in length, 4 to 9 nucleotides, 3 to 7 nucleotides, or values which are longer.
  • a spacer is a non-coding sequence.
  • the spacer may be of four (4) nucleotides.
  • the spacer is GGAT.
  • the spacer is six (6) nucleotides.
  • the spacer is CACGTG or GCATGC.
  • the tandem repeats contain two, three, four or more of the same miRNA target sequence. In certain embodiments, the tandem repeats contain at least two different miRNA target sequences, at least three different miRNA target sequences, or at least four different miRNA target sequences, etc. In certain embodiments, the tandem repeats may contain two or three of the same miRNA target sequence and a fourth miRNA target sequence which is different.
  • a 3’ UTR may contain a tandem repeat immediately downstream of the transgene, UTR sequences, and two or more tandem repeats closer to the 3’ end of the UTR.
  • the 5’ UTR may contain one, two or more miRNA target sequences.
  • the 3’ may contain tandem repeats and the 5’ UTR may contain at least one miRNA target sequence.
  • the expression cassette contains two, three, four or more tandem repeats which start within about 0 to 20 nucleotides of the stop codon for the transgene. In other embodiments, the expression cassette contains the miRNA tandem repeats at least 100 to about 4000 nucleotides from the stop codon for the transgene.
  • the expression cassette comprising an open reading frame (ORF) sequence (e.g., ORF comprising hMECP2 coding sequence operably linked to regulatory control sequences), and DRG-detargeting sequences.
  • ORF open reading frame
  • the DRG-detargeting sequences are located 5’ to the coding sequence. In certain embodiments, the DRG-detargeting sequences are located 3’ to the coding sequence.
  • the expression cassette refers to nucleic acid molecule of SEQ ID NOs: 6, 29, 33, or 37. In certain embodiments, the expression cassette refers to nucleic acid molecule of SEQ ID NO: 6, encoding for hMECP2 having an amino acid sequence of SEQ ID NO: 2, and comprising 4 tandem repeats of miRNA183 (miR183; SEQ ID NO: 7). In certain embodiments, the expression cassette refers to nucleic acid molecule of SEQ ID NO: 29, encoding for hMECP2 having an amino acid sequence of SEQ ID NO: 30 (or SEQ ID NO: 2), and comprising 4 tandem repeats of miRNA183 (miR183; SEQ ID NO: 7).
  • the expression cassette refers to nucleic acid molecule of SEQ ID NO: 33, encoding for hMECP2 having an amino acid sequence of SEQ ID NO: 34 (or SEQ ID NO: 2), and comprising 4 tandem repeats of miRNA182 (miR182; SEQ ID NO: 10).
  • the expression cassette refers to nucleic acid molecule of SEQ ID NO: 37, encoding for hMECP2 having an amino acid sequence of SEQ ID NO: 38 (or SEQ ID NO: 2), and comprising 4 tandem repeats of miRNA182 (miR182; SEQ ID NO: 10) and 4 tandem repeats of miRNAI83 (miR183; SEQ ID NO: 7).
  • the expression cassette comprises Ubiquitin C promoter - optionally Kozak sequence - hMECP2 coding sequence - at least four copies of miRNAI82 - at least 4 copies of miRI83 - rabbit beta-globin polyA.
  • the expression cassette comprises nucleic acid sequence of SEQ ID NO: 37.
  • the vector genome further comprises at least one, at least two, at least three or preferably at least four tandem repeats of dorsal root ganglion (drg)- specific miRNA target sequences.
  • drg dorsal root ganglion
  • the target miRNA sequences may be selected from SEQ ID NO: 7 SEQ ID NO: 9, SEQ ID NO: 10, and/or SEQ ID NO: 11.
  • the vector genome has a sequence of SEQ ID NO: 23, SEQ ID NO: 15, SEQ ID NO: 31, SEQ IDN NO: 35, SEQ ID NO: 39 and/or SEQ ID NO: 24 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto, which further comprises at least one, at least two, at least three and or at least four miRNA drg detargeting sequence.
  • the vector genome comprises the sequence of SEQ ID NO: 3 or a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99 to at least 100% identical thereto, which further comprises at least one miRNA drg detargeting sequence, at least two, at least three and or at least 4. In certain embodiments, the vector genome comprises at least five, at least six, at least 7 or at least 8 miRNA drg detargeting sequences. In certain embodiments, the miR sequences are a combination of miR182 and miR183 sequences, such as, e.g., in the vector genome of SEQ ID NO: 37 and SEQ ID NO: 39.
  • the target miRNA sequences may be selected from SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 10, and/or SEQ ID NO: 11.
  • the vector genome comprises the sequence of SEQ ID NO: 39 or a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99 to at least 100% identical thereto, comprising combination of miR 182 and miR183.
  • the expression cassette or the vector genome comprises at least eight miRNA drg de-targeting sequences. In certain embodiments, the expression cassette or the vector genome comprises at least eight miRNA drg de-targeting sequences comprise miR182 and miR 183. In certain embodiments, the expression cassette or the vector genome comprises at least eight miRNA drg de-targeting sequences, wherein the at least first, at least second, at least third, and at least fourth miRNA is miR182 sequence, and at least fifth, at least sixth, at least seventh, and at least eighth miRNA is miR183 sequence.
  • the expression cassette or the vector genome comprises at least 8 miRNA drg de-targeting sequences, wherein the at least first, at least second, at least third, and at least fourth miRNA is miR183 sequence, and at least fifth, at least sixth, at least seventh, and at least eighth miRNA is miR182 sequence.
  • the invention provides a nucleic acid molecule having an expression cassette which comprises an MECP coding sequence as defined herein, four miR182 sequences, four miR183 sequences, and other suitable regulatory sequences operably linked to the MECP coding sequence.
  • the regulatory sequences comprise a UbC promoter.
  • the regulatory sequences comprise one or more intron(s), one or more enhancer(s), and a polyA.
  • the vector genome comprises a 5’ AAV ITR, the expression cassette and a 3’ AAV ITR.
  • the expression cassette comprises nucleic acid sequence of SEQ ID NO: 1 or a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99 to at least 100% identical thereto.
  • the expression cassette comprises nucleic acid sequence of SEQ ID NO: 4 or a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99 to at least 100% identical thereto.
  • the expression cassette comprises nucleic acid sequence of SEQ ID NO: 6 or a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99 to at least 100% identical thereto.
  • the expression cassette comprises nucleic acid sequence of SEQ ID NO: 29 or a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99 to at least 100% identical thereto.
  • the expression cassette comprises nucleic acid sequence of SEQ ID NO: 33 or a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99 to at least 100% identical thereto.
  • the expression cassette comprises nucleic acid sequence of SEQ ID NO: 37 or a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99 to at least 100% identical thereto.
  • a recombinant adeno-associated virus useful for treating Rett Syndrome.
  • the rAAV comprises (a) an AAV capsid; and (b) a vector genome packaged in the AAV capsid of (a).
  • the AAV capsid selected targets the cells to be treated.
  • the capsid is from Clade F.
  • another AAV capsid source may be selected.
  • the AAV capsid is AAVhu68 capsid.
  • the AAV capsid is AAVrh91 capsid.
  • the vector genome comprises inverted terminal repeats (ITR) and a nucleic acid sequence encoding a functional human methyl-CpG binding protein 2 (hMECP2) under control of regulatory sequences which direct the hMECP2 expression.
  • the hMECP2-coding sequence is at least about 95% identical to SEQ ID NO: 3.
  • the hMECP-coding sequence is less than 80% identical to any one ofhMECP transcript variants 1 to 3 (NM_001316337. 1 (SEQ ID NO: 16), NM_004992.3 (SEQ ID NO: 17) and NM_001110792.1 (SEQ ID NO: 18)).
  • the functional hMECP2 has an amino acid sequence of SEQ ID NO: 2.
  • the regulatory sequences direct hMECP2 expression in central nervous system cells.
  • the regulatory sequences comprise a CNS-specific promoter, e.g., human Synaspin promoter (hSyn), a constitutive promoter, e.g., CB7, Ubiquitin C (UbC), CBh or a regulatable promoter.
  • the regulatory elements comprise one or more of a Kozak sequence, a polyadenylation sequence, an intron, an enhancer, and a TATA signal.
  • the vector genome is SEQ ID NOs: 15, 23, or 24 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto.
  • the vector genome further comprises dorsal root ganglion (drg)-detargeting miRNA target sequences as described herein.
  • the vector genome is SEQ ID NOs: 31, 35, or 39 or a nucleic acid sequence at least about 70% (e.g., at least about 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 99.9%) identical thereto.
  • the Clade F AAV capsid is selected from an AAVhu68 capsid (nucleic acid sequence of SEQ ID NOs: 42 and 43 encoding for an amino acid sequence of SEQ ID NO: 44), an AAV9 capsid (nucleic acid sequence of SEQ ID NO: 45 encoding for amino acid sequence of SEQ ID NO: 46), an AAVhu32 capsid, or an AAVhu31 capsid. Nucleic acid sequences encoding a suitable capsid may be utilized in the production of the AAV.hMECP2 recombinant AAV (rAAV) carrying the vector genome.
  • rAAV recombinant AAV
  • AAVhu68 Additional details relating to AAVhu68 are provided in WO 2018/160582, and US 2015/0079038, each of which is incorporated herein by reference in its entirety. See, also, US Provisional Patent Application No. 63/093,275, filed October 28, 2020, which is incorporated herein by reference.
  • the Clade F vectors described herein are well suited for delivery of the vector genome comprising the hMECP2 coding sequence to cells within the central nervous system, including brain, hippocampus, motor cortex, cerebellum, and motor neurons. These vectors may be used for targeting other cells within the central nervous system (CNS) and certain other tissues and cells outside the CNS.
  • CNS central nervous system
  • a Clade A capsid (e.g., AAV1, AAVrh91) may be selected.
  • the Clade A AAV capsid is selected, wherein the AAV capsid is AAVrh91 capsid (nucleic acid sequence of SEQ ID NOs: 25 and 1 encoding for an amino acid sequence of SEQ ID NO: 26).
  • Still other AAV or other parvovirus capsids may be selected.
  • the AAV capsid for the compositions and methods described herein is chosen based on the target cell.
  • the AAV capsid transduces a CNS cell and/or a PNS cell.
  • the AAV capsid is selected from a cy02 capsid, a rh43 capsid, an AAV8 capsid, a rhOl capsid, an AAV9 capsid, an rh8 capsid, a rhlO capsid, a bbOl capsid, a hu37 capsid, a rh02 capsid, a rh20 capsid, a rh39 capsid, a rh64 capsid, an AAV6 capsid, an AAV1 capsid, a hu44 capsid, a hu48 capsid, a cy05 capsid a hul 1 capsid, a
  • the AAV capsid is a Clade F capsid, such as AAV9 capsid, AAVhu68 capsid, AAV-PHP.B capsid, hu31 capsid, hu32 capsid, or a variation thereof. See, e.g., WO 2005/033321 published April 14, 2015, WO 2018/160582, and US 2015/0079038, each of which is incorporated herein by reference in its entirety.
  • the AAV capsid is a Clade F capsid, e.g., AAVhu95 or AAVhu96. See also, US Provisional Patent Application No.
  • the AAV capsid is a non-clade F capsid, for example a Clade A, B, C, D, or E capsid.
  • the non-Clade F capsid is an AAV 1 or a variation thereof.
  • the AAV capsid transduces a target cell other than the nervous system cells.
  • the AAV capsid is a Clade A capsid (e.g., AAV1, AAV6, AAVrh91), a Clade B capsid (e.g., AAV 2), a Clade C capsid (e.g., hu53), a Clade D capsid (e.g., AAV7), or a Clade E capsid (e.g., rhlO).
  • the AAV capsid is a Clade A capsid, such as AAVrh91 capsid (nucleic acid sequence of SEQ ID NOs: 25 and l, encoding for an amino acid sequence of SEQ ID NO: 26).
  • the term “clade” as it relates to groups of AAV refers to a group of AAV which are phylogenetically related to one another as determined using a Neighbor- Joining algorithm by a bootstrap value of at least 75% (of at least 1000 replicates) and a Poisson correction distance measurement of no more than 0.05, based on alignment of the AAV vpl amino acid sequence.
  • the Neighbor-Joining algorithm has been described in the literature. See, e.g., M. Nei and S. Kumar, Molecular Evolution and Phylogenetics (Oxford University Press, New York (2000). Computer programs are available that can be used to implement this algorithm. For example, the MEGA v2.
  • a rAAV which has an AAV capsid which targets the desired cells and a vector genome which comprises, at a minimum, AAV ITRs required to package the vector genome into the capsid, a hMECP2 coding sequence and regulatory sequences which direct expression therefor.
  • the vector genome is a single-stranded AAV vector genome.
  • a rAAV vector may be utilized in the invention which contains self-complementary (sc) AAV vector genome.
  • the AAV sequences of the vector typically comprise the cis-acting 5' and 3' inverted terminal repeat (ITR) sequences (See, e.g., B. J. Carter, in “Handbook of Parvoviruses”, ed., P. Tijsser, CRC Press, pp. 155 168 (1990)).
  • the ITR sequences are about 145 base pairs (bp) in length.
  • substantially the entire sequences encoding the ITRs are used in the molecule, although some degree of minor modification of these sequences is permissible.
  • the ability to modify these ITR sequences is within the skill of the art. (See, e.g., texts such as Sambrook et al, “Molecular Cloning.
  • An example of such a molecule employed in the present invention is a “cis- acting” plasmid containing the transgene, in which the selected transgene sequence and associated regulatory elements are flanked by the 5' and 3' AAV ITR sequences.
  • the ITRs are from an AAV different than that supplying a capsid.
  • the ITR sequences are from AAV2.
  • a shortened version of the 5’ ITR, termed AITR has been described in which the D-sequence and terminal resolution site (trs) are deleted.
  • the vector genome (e.g., of a plasmid) includes a shortened AAV2 ITR of 130 base pairs, wherein the external A elements is deleted.
  • the shortened ITR may revert back to the wild-type length of 145 base pairs during vector DNA amplification using the internal A element as a template and packaging into the capsid to form the viral particle.
  • the full-length AAV 5’ and 3’ ITRs are used.
  • ITRs from other AAV sources may be selected. Where the source of the ITRs is from AAV2 and the AAV capsid is from another AAV source, the resulting vector may be termed pseudotyped.
  • other configurations of these elements may be suitable.
  • vector genomes are constructed which comprise a 5 ’ AAV ITR - promoter - optional enhancer - optional intron - hMECP2 coding sequence - polyA - 3’ ITR.
  • an enhancer may be located downstream of the hMECP2 coding sequence.
  • the vector genome further comprises an drg detargeting sequence, such as miR183 and/or miR182 as described herein.
  • two, three, four or more copies of such drg detargeting (also referenced to as DRG-detargeting) sequences may be present in the vector genome (e.g., in the 3’ untranslated region (UTR) between the hMECP2 stop codon(s) and the polyA) as describe in the specification.
  • two, three, four or more copies of such drg detargeting sequences may be present in the vector genome (e.g., in the 5’ untranslated region (UTR) between the promoter and start codon for MECP2 coding sequence) as describe in the specification.
  • eight of such drg de-targeting sequences may be present in the vector genome.
  • the eight drg detargeting sequences comprise at least one, at least two, at least three and/or at least four copies of miR182, and at least one, at least two, at least three and/or at least four copies of miR183.
  • the rAAV is a single-stranded AAV.
  • the rAAV is a self-complementary AAV.
  • the ITRs are from AAV2.
  • more than one promoter is present.
  • the promoter is Synapsin (hSyn).
  • the promoter is CB7.
  • the promoter is Ubiquitin C (UbC) promoter.
  • the promoter is neuron-specific enolase (NSE) promoter. In certain embodiments, the promoter is neurofilament light chain gene promoter. In certain embodiments, the promoter is neuron-specific vgf gene promoter. In certain embodiments, the enhancer is present in the vector genome. In certain embodiments, more than one enhancer is present. In certain embodiments, the enhancer is alpha mic/bik enhancer. In certain embodiments, an intron is present in the vector genome. In certain embodiments, the intron is a chicken-beta actin intron. In certain embodiments, the enhancer and intron are present.
  • NSE neuron-specific enolase
  • the promoter is neurofilament light chain gene promoter. In certain embodiments, the promoter is neuron-specific vgf gene promoter.
  • the enhancer is present in the vector genome. In certain embodiments, more than one enhancer is present. In certain embodiments, the enhancer is alpha mic/bik enhancer. In certain embodiments,
  • the intron is a chimeric intron (CI)- a hybrid intron consisting of a human beta-globin splice donor and immunoglobulin G (IgG) splice acceptor elements.
  • the polyA is an SV40 poly A (i.e., a polyadenylation (PolyA) signal derived from Simian Virus 40 (SV40) late genes).
  • the polyA is a rabbit beta-globin (RBG) poly A.
  • the vector genome comprises a 5’ AAV ITR - hSyn promoter - hMECP2 coding sequence - poly A - 3’ ITR.
  • the vector genome comprises a 5 ’ AAV ITR - CB7 promoter - hMECP2 coding sequence - RBG poly A - 3 ’ ITR. In certain embodiments the vector genome comprises, at a minimum a 5’ AAV ITR - Ubiquitin C promoter - hMECP2 coding sequence - one, two, three, four or more miR183 sequences - RBG poly A - 3’ ITR. In certain embodiments the vector genome comprises, at a minimum a 5 ’ AAV ITR - Ubiquitin C promoter - hMECP2 coding sequence - one, two, three, four or more miR182 sequences - RBG poly A - 3 ’ ITR.
  • the vector genome comprises, at a minimum a 5 ’ AAV ITR - Ubiquitin C promoter - hMECP2 coding sequence - one, two, three, four or more miR182 sequences - one, two, three, four or more miR183 - RBG poly A - 3’ ITR.
  • an enhancer may be located downstream of the hMECP2 coding sequence.
  • the vector genome further comprises an drg detargeting sequence, such as miR183 or miR182 as described herein.
  • two, three, four or more copies of such drg detargeting sequences may be present in the vector genome (e.g., in the 3’ untranslated region (UTR) between the hMECP2 stop codon(s) and the polyA) as describe in the specification.
  • two, three, four or more copies of such drg-detargeting sequences may be present in the vector genome (e.g., in the 5’ untranslated region (UTR)).
  • the rAAV is a single-stranded AAV.
  • the rAAV is a self-complementary AAV.
  • the term “vector genome” refers to a nucleic acid molecule which is packaged in a viral capsid, for example, an AAV capsid, and is capable of being delivered to a host cell or a cell in a patient.
  • the vector genome comprises terminal repeat sequences (e.g., AAV inverted terminal repeat sequences (ITRs) necessary for packaging the vector genome into the capsid at the extreme 5’ and 3’ end and containing therebetween an expression cassette comprising the MECP2 gene as described herein operably linked to sequences which direct expression thereof.
  • terminal repeat sequences e.g., AAV inverted terminal repeat sequences (ITRs) necessary for packaging the vector genome into the capsid at the extreme 5’ and 3’ end and containing therebetween an expression cassette comprising the MECP2 gene as described herein operably linked to sequences which direct expression thereof.
  • a vector genome or a rAAV comprising the vector genome is illustrated herein as AAV 5’ ITR - promoter (optional) - Kozak (optional) - intron (optional) - MECP2 coding sequence (e.g., hMECP2, hMECP2co, MECP2, MECP2co) - miRNA (optional 0-4+) - polyA(optional) - Staffer (optional) - AAV 3 ’ ITR.
  • AAV 5 ITR - promoter (optional) - Kozak (optional) - intron (optional) - MECP2 coding sequence (e.g., hMECP2, hMECP2co, MECP2, MECP2co) - miRNA (optional 0-4+) - polyA(optional) - Staffer (optional) - AAV 3 ’ ITR.
  • a rAAV is illustrated herein as AAV 5’ ITR - promoter (optional) - Kozak (optional) - intron (optional) - MECP2 coding sequence - miRNA (optionally, 0-4+) - polyA (optional) - Staffer (optional) - AAV 3’ ITR.
  • a rAAV is illustrated herein as AAV 5’ ITR - promoter (optional) - Kozak (optional) - intron (optional) - MECP2 coding sequence - miRNA-X (optionally, 0-4+) - miRNA-Y (optionally, 0-4+) - polyA (optional) - Staffer (optional) - AAV 3’ ITR.
  • a rAAV is illustrated herein as AAV 5’ ITR - promoter (optional) - Kozak (optional) - intron (optional) - miRNA (optionally, 0-4+) - MECP2 coding sequence - polyA (optional) - Staffer (optional) - AAV 3’ ITR.
  • an rAAV production system useful for producing a rAAV as described herein.
  • the production system comprises a cell culture comprising (a) a nucleic acid sequence encoding an AAV capsid protein; (b) the vector genome; and (c) sufficient AAV rep functions and helper functions to permit packaging of the vector genome into the AAV capsid.
  • the vector genome comprises nucleic acid sequence of SEQ ID NOs: 15, 23, 24, 31, 35, or 39 .
  • the cell culture is a human embryonic kidney 293 cell culture.
  • the AAV rep is from a different AAV.
  • the AAV rep is from AAV2.
  • the AAV rep coding sequence and cap genes are on the same nucleic acid molecule, wherein there is optionally a spacer between the rep sequence and cap gene.
  • the spacer is atgacttaaaccaggt (SEQ ID NO: 14).
  • the vector genomes can be carried on any suitable vector, e.g., a plasmid, which is delivered to a packaging host cell.
  • a suitable vector e.g., a plasmid
  • the plasmids useful in this invention may be engineered such that they are suitable for replication and packaging in vitro in prokaryotic cells, insect cells, mammalian cells, among others. Suitable transfection techniques and packaging host cells are known and/or can be readily designed by one of skill in the art.
  • the selected genetic element may be delivered to an AAV packaging cell by any suitable method, including transfection, electroporation, liposome delivery, membrane fusion techniques, high velocity DNA-coated pellets, viral infection and protoplast fusion.
  • Stable AAV packaging cells can also be made.
  • the methods used to make such constructs are known to those with skill in nucleic acid manipulation and include genetic engineering, recombinant engineering, and synthetic techniques. See, e.g., Molecular Cloning: A Laboratory Manual, ed. Green and Sambrook, Cold Spring Harbor Press, Cold Spring Harbor, NY (2012).
  • AAV intermediate or “AAV vector intermediate” refers to an assembled rAAV capsid which lacks the desired genomic sequences packaged therein. These may also be termed an “empty” capsid. Such a capsid may contain no detectable genomic sequences of an expression cassette, or only partially packaged genomic sequences which are insufficient to achieve expression of the gene product. These empty capsids are non-functional to transfer the gene of interest to a host cell.
  • the recombinant adeno-associated virus (AAV) described herein may be generated using techniques which are known. See, e.g., WO 2003/042397; WO 2005/033321, WO 2006/110689; US 7588772 B2.
  • Such a method involves culturing a host cell which contains a nucleic acid sequence encoding an AAV capsid protein; a functional rep gene; an expression cassette composed of, at a minimum, AAV inverted terminal repeats (ITRs) and a transgene; and sufficient helper functions to permit packaging of the expression cassette into the AAV capsid protein.
  • ITRs AAV inverted terminal repeats
  • a production cell culture useful for producing a recombinant AAV contains a nucleic acid which expresses the AAV capsid protein in the host cell, a nucleic acid molecule suitable for packaging into the AAV capsid, e.g., a vector genome which contains AAV ITRs and a non-AAV nucleic acid sequence encoding a gene operably linked to regulatory sequences which direct expression of the gene in a host cell; and sufficient AAV rep functions and adenovirus helper functions to permit packaging of the vector genome into the recombinant AAV capsid.
  • the cell culture is composed of mammalian cells (e.g., human embryonic kidney 293 cells, among others) or insect cells (e.g., Spodoptera frugiperda (Sf9) cells).
  • mammalian cells e.g., human embryonic kidney 293 cells, among others
  • insect cells e.g., Spodoptera frugiperda (Sf9) cells.
  • baculovirus provides the helper functions necessary for packaging the vector genome into the recombinant AAV capsid.
  • the rep functions are provided by an AAV which crosscomplements the capsid.
  • at least parts of the rep functions are from AAVhu68B.
  • the rep protein is a heterologous rep protein other than AAVhu68rep, for example but not limited to, AAV1 rep protein, AAV2 rep protein, AAV3 rep protein, AAV4 rep protein, AAV5 rep protein, AAV6 rep protein, AAV7 rep protein, AAV8 rep protein; or rep 78, rep 68, rep 52, rep 40, rep68/78 and rep40/52; or a fragment thereof; or another source. Any of these AAVhu68 or mutant AAV capsid sequences may be under the control of exogenous regulatory control sequences which direct expression thereof in a host cell.
  • cells are manufactured in a suitable cell culture (e.g., HEK 293 or Sf9) or suspension.
  • Methods for manufacturing the gene therapy vectors described herein include methods well known in the art such as generation of plasmid DNA used for production of the gene therapy vectors, generation of the vectors, and purification of the vectors.
  • the gene therapy vector is an AAV vector and the plasmids generated are an AAV cis-plasmid encoding the AAV vector genome and the gene of interest, an AAV trans-plasmid containing AAV rep and cap genes, and an adenovirus helper plasmid.
  • the vector generation process can include method steps such as initiation of cell culture, passage of cells, seeding of cells, transfection of cells with the plasmid DNA, post-transfection medium exchange to serum free medium, and the harvest of vectorcontaining cells and culture media.
  • the harvested vector-containing cells and culture media are referred to herein as crude cell harvest.
  • the gene therapy vectors are introduced into insect cells by infection with baculovirus-based vectors.
  • Zhang et al., 2009 Adenovirus-adeno- associated virus hybrid for large-scale recombinant adeno-associated virus production, Human Gene Therapy 20:922-929, the contents of each of which is incorporated herein by reference in its entirety.
  • the crude cell harvest may thereafter be subject method steps such as concentration of the vector harvest, diafdtration of the vector harvest, microfluidization of the vector harvest, nuclease digestion of the vector harvest, filtration of microfluidized intermediate, crude purification by chromatography, crude purification by ultracentrifugation, buffer exchange by tangential flow filtration, and/or formulation and filtration to prepare bulk vector.
  • a two-step affinity chromatography purification at high salt concentration followed anion exchange resin chromatography are used to purify the vector drug product and to remove empty capsids.
  • GC genome copies
  • the number of particles (pt) per 20 pL loaded is then multiplied by 50 to give particles (pt) /mL.
  • Pt/mL divided by GC/mL gives the ratio of particles to genome copies (pt/GC).
  • Pt/mL-GC/mL gives empty pt/mL.
  • Empty pt/mL divided by pt/mL and x 100 gives the percentage of empty particles.
  • the methods include subjecting the treated AAV stock to SDS- polyacrylamide gel electrophoresis, consisting of any gel capable of separating the three capsid proteins, for example, a gradient gel containing 3-8% Tris-acetate in the buffer, then running the gel until sample material is separated, and blotting the gel onto nylon or nitrocellulose membranes, preferably nylon.
  • Anti-AAV capsid antibodies are then used as the primary antibodies that bind to denatured capsid proteins, preferably an anti-AAV capsid monoclonal antibody, most preferably the Bl anti-AAV-2 monoclonal antibody (Wobus et al., J. Virol. (2000) 74:9281-9293).
  • a secondary antibody is then used, one that binds to the primary antibody and contains a means for detecting binding with the primary antibody, more preferably an anti-IgG antibody containing a detection molecule covalently bound to it, most preferably a sheep anti-mouse IgG antibody covalently linked to horseradish peroxidase.
  • a method for detecting binding is used to semi-quantitatively determine binding between the primary and secondary antibodies, preferably a detection method capable of detecting radioactive isotope emissions, electromagnetic radiation, colorimetric changes, or most preferably a chemiluminescence detection kit.
  • a detection method capable of detecting radioactive isotope emissions, electromagnetic radiation, colorimetric changes, or most preferably a chemiluminescence detection kit.
  • samples from column fractions can be taken and heated in SDS-PAGE loading buffer containing reducing agent (e.g., DTT), and capsid proteins were resolved on pre-cast gradient polyacrylamide gels (e.g., Novex).
  • Silver staining may be performed using SilverXpress (Invitrogen, CA) according to the manufacturer's instructions or other suitable staining method, i.e., SYPRO ruby or coomassie stains.
  • the concentration of AAV vector genomes (vg) in column fractions can be measured by quantitative real time PCR (Q-PCR).
  • Samples are diluted and digested with DNase I (or another suitable nuclease) to remove exogenous DNA. After inactivation of the nuclease, the samples are further diluted and amplified using primers and a TaqManTM fluorogenic probe specific for the DNA sequence between the primers. The number of cycles required to reach a defined level of fluorescence (threshold cycle, Ct) is measured for each sample on an Applied Biosystems Prism 7700 Sequence Detection System. Plasmid DNA containing identical sequences to that contained in the AAV vector is employed to generate a standard curve in the Q-PCR reaction. The cycle threshold (Ct) values obtained from the samples are used to determine vector genome titer by normalizing it to the Ct value of the plasmid standard curve. Endpoint assays based on the digital PCR can also be used.
  • DNase I or another suitable
  • an optimized q-PCR method which utilizes a broad spectrum serine protease, e.g., proteinase K (such as is commercially available from Qiagen). More particularly, the optimized qPCR genome titer assay is similar to a standard assay, except that after the DNase I digestion, samples are diluted with proteinase K buffer and treated with proteinase K followed by heat inactivation. Suitably samples are diluted with proteinase K buffer in an amount equal to the sample size.
  • the proteinase K buffer may be concentrated to 2-fold or higher. Typically, proteinase K treatment is about 0.2 mg/mL, but may be varied from 0. 1 mg/mL to about 1 mg/mL.
  • the treatment step is generally conducted at about 55 °C for about 15 minutes, but may be performed at a lower temperature (e.g., about 37 °C to about 50 °C) over a longer time period (e.g., about 20 minutes to about 30 minutes), or a higher temperature (e.g., up to about 60 °C) for a shorter time period (e.g., about 5 to 10 minutes).
  • heat inactivation is generally at about 95 °C for about 15 minutes, but the temperature may be lowered (e.g., about 70 to about 90 °C) and the time extended (e.g., about 20 minutes to about 30 minutes). Samples are then diluted (e.g., 1000- fold) and subjected to TaqMan analysis as described in the standard assay.
  • droplet digital PCR may be used.
  • ddPCR droplet digital PCR
  • methods for determining single-stranded and self-complementary AAV vector genome titers by ddPCR have been described. See, e.g., M. Lock et al, Hu Gene Therapy Methods, Hum Gene Ther Methods. 2014 Apr;25(2): 115-25. doi: 10. 1089/hgtb.2013. 131. Epub 2014 Feb 14.
  • the method for separating rAAVhu68 particles having packaged genomic sequences from genome-deficient AAVhu68 intermediates involves subjecting a suspension comprising recombinant AAVhu68 viral particles and AAVhu68 capsid intermediates to fast performance liquid chromatography, wherein the AAVhu68 viral particles and AAVhu68 intermediates are bound to a strong anion exchange resin equilibrated at a pH of about 10.2, and subjected to a salt gradient while monitoring eluate for ultraviolet absorbance at about 260 nanometers (nm) and about 280 nm.
  • the pH may be in the range of about 10.0 to 10.4.
  • the AAVhu68 full capsids are collected from a fraction which is eluted when the ratio of A260/A280 reaches an inflection point.
  • the diafiltered product may be applied to a Capture SelectTM Poros- AAV2/9 affinity resin (Life Technologies) that efficiently captures the AAV2/hu68 serotype. Under these ionic conditions, a significant percentage of residual cellular DNA and proteins flow through the column, while AAV particles are efficiently captured.
  • the rAAV.hMECP2 is suspended in a suitable physiologically compatible composition (e.g., a buffered saline).
  • a suitable physiologically compatible composition e.g., a buffered saline
  • This composition may be frozen for storage, later thawed and optionally diluted with a suitable diluent.
  • the vector may be prepared as a composition which is suitable for delivery to a patient without proceeding through the freezing and thawing steps.
  • NAb titer a measurement of how much neutralizing antibody (e.g., anti-AAV Nab) is produced which neutralizes the physiologic effect of its targeted epitope (e.g., an AAV).
  • Anti-AAV NAb titers may be measured as described in, e.g., Calcedo, R., et al., Worldwide Epidemiology of Neutralizing Antibodies to Adeno-Associated Viruses. Journal of Infectious Diseases, 2009. 199(3): p. 381-390, which is incorporated by reference herein.
  • sc refers to self-complementary.
  • Self-complementary AAV refers a construct in which a coding region carried by a recombinant AAV nucleic acid sequence has been designed to form an infra-molecular double-stranded DNA template.
  • dsDNA double stranded DNA
  • a “replication-defective virus” or “viral vector” refers to a synthetic or artificial viral particle in which an expression cassette containing a gene of interest is packaged in a viral capsid or envelope, where any viral genomic sequences also packaged within the viral capsid or envelope are replication-deficient; i.e., they cannot generate progeny virions but retain the ability to infect target cells.
  • the genome of the viral vector does not include genes encoding the enzymes required to replicate (the genome can be engineered to be "gutless" - containing only the gene of interest flanked by the signals required for amplification and packaging of the artificial genome), but these genes may be supplied during production. Therefore, it is deemed safe for use in gene therapy since replication and infection by progeny virions cannot occur except in the presence of the viral enzyme required for replication.
  • rAAV particles are referred to as DNase resistant.
  • DNase endonuclease
  • other endo- and exo- nucleases may also be used in the purification steps described herein, to remove contaminating nucleic acids.
  • Such nucleases may be selected to degrade single stranded DNA and/or double-stranded DNA, and RNA.
  • Such steps may contain a single nuclease, or mixtures of nucleases directed to different targets, and may be endonucleases or exonucleases.
  • nuclease-resistant indicates that the AAV capsid has fully assembled around the expression cassette which is designed to deliver a gene to a host cell and protects these packaged genomic sequences from degradation (digestion) during nuclease incubation steps designed to remove contaminating nucleic acids which may be present from the production process.
  • the expression cassette comprises a nucleic acid sequence encoding a functional human methyl-CpG binding protein 2 (hMECP2) under control of regulatory sequences which direct the hMECP2 expression.
  • hMECP2 human methyl-CpG binding protein 2
  • the hMECP2-coding sequence encodes a hMECP sequence of [SEQ ID NO: 2; MAAAAAAAPSGGGGGGEEERLEEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGK HEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPT LPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDF DFTVTGRGSPSRREQKPPKKPKSPKAPGTGRGRGRPKGSGTTRPKAATSEGVQVKR VLEKSPGKLLVKMPFQTSPGGKAEGGGATTSTQVMVIKRPGRKRKAEADPQAIPKK RGRKPGSVVAAAAAEAKKKAVKESSIRSVQETVLPIKKRKTRETVSIEVKEVVKPLL VSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASSPPKKEHHHHHHHS
  • the vector is a viral vector selected from a recombinant parvovirus, a recombinant lentivirus, a recombinant retrovirus, or a recombinant adenovirus; or a non-viral vector selected from naked DNA, naked RNA, an inorganic particle, a lipid particle, a polymer-based vector, or a chitosan-based formulation.
  • the selected vector may be delivered by any suitable method, including transfection, electroporation, liposome delivery, membrane fusion techniques, high velocity DNA-coated pellets, viral infection and protoplast fusion.
  • a “replication-defective virus” or “viral vector” refers to a synthetic or artificial viral particle in which an expression cassette containing a gene of interest is packaged in a viral capsid or envelope, where any viral genomic sequences also packaged within the viral capsid or envelope are replication-deficient; i.e., they cannot generate progeny virions but retain the ability to infect target cells.
  • the genome of the viral vector does not include genes encoding the enzymes required to replicate (the genome can be engineered to be “gutless” - containing only the transgene of interest flanked by the signals required for amplification and packaging of the artificial genome), but these genes may be supplied during production.
  • replication-defective viruses may be adeno-associated viruses (AAV), adenoviruses, lentiviruses (integrating or nonintegrating), or another suitable virus source.
  • AAV adeno-associated viruses
  • adenoviruses adenoviruses
  • lentiviruses integrating or nonintegrating
  • an “AAV9 capsid” is a self-assembled AAV capsid composed of multiple AAV9 vp proteins.
  • the AAV9 vp proteins are typically expressed as alternative splice variants encoded by a nucleic acid sequence of SEQ ID NO: 45 which encodes the vpl amino acid sequence of GenBank accession: AAS99264. See, also US 7906111 and WO 2005/033321.
  • other Clade F sequences may be selected. See, e.g., WO2016/049230, US 8,927,514, US 2015/0344911, and US 8,734,809.
  • a rAAVhu68 has a rAAVhu68 capsid produced in a production system expressing capsids from an AAVhu68 nucleic acid sequence which encodes the vp 1 amino acid sequence of SEQ ID NO: 44, and optionally additional nucleic acid sequences, e.g., encoding a vp3 protein free of the vpl and/or vp2 -unique regions.
  • the rAAVhu68 resulting from production using a single nucleic acid sequence vp 1 produces the heterogeneous populations of vpl proteins, vp2 proteins and vp3 proteins.
  • the AAVhu68 capsid contains subpopulations within the vp 1 proteins, within the vp2 proteins and within the vp3 proteins which have modifications from the predicted amino acid residues in SEQ ID NO: 44.
  • These subpopulations include, at a minimum, deamidated asparagine (N or Asn) residues.
  • asparagines in asparagine - glycine pairs are highly deamidated.
  • a nucleic acid sequence encoding the AAVhu68 amino acid sequence is provided in SEQ ID NO: 42 and the encoded amino acid sequence is provided in SEQ ID NO: 44.
  • a nucleic acid sequence encoding the AAVhu68 amino acid sequence is provided in SEQ ID NO: 43 and the encoded amino acid sequence is provided in SEQ ID NO: 44.
  • heterogeneous refers to a population consisting of elements that are not the same, for example, having vpl, vp2 or vp3 monomers (proteins) with different modified amino acid sequences.
  • SEQ ID NO: 44 provides the encoded amino acid sequence of the AAVhu68 vpl protein.
  • heterogeneous as used in connection with vpl, vp2 and vp3 proteins (alternatively termed isoforms), refers to differences in the amino acid sequence of the vpl, vp2 and vp3 proteins within a capsid.
  • the AAV capsid contains subpopulations within the vpl proteins, within the vp2 proteins and within the vp3 proteins which have modifications from the predicted amino acid residues. These subpopulations include, at a minimum, certain deamidated asparagine (N or Asn) residues.
  • certain subpopulations comprise at least one, two, three or four highly deamidated asparagines (N) positions in asparagine - glycine pairs and optionally further comprising other deamidated amino acids, wherein the deamidation results in an amino acid change and other optional modifications.
  • a “subpopulation” of vp proteins refers to a group of vp proteins which has at least one defined characteristic in common and which consists of at least one group member to less than all members of the reference group, unless otherwise specified.
  • a “subpopulation” of vpl proteins is at least one (1) vpl protein and less than all vpl proteins in an assembled AAV capsid, unless otherwise specified.
  • a “subpopulation” of vp3 proteins may be one (1) vp3 protein to less than all vp3 proteins in an assembled AAV capsid, unless otherwise specified.
  • vpl proteins may be a subpopulation of vp proteins; vp2 proteins may be a separate subpopulation of vp proteins, and vp3 are yet a further subpopulation of vp proteins in an assembled AAV capsid.
  • vpl, vp2 and vp3 proteins may contain subpopulations having different modifications, e.g., at least one, two, three or four highly deamidated asparagines, e.g., at asparagine - glycine pairs.
  • a rAAVrh91 has a rAAVrh91 capsid produced in a production system expressing capsids from an AAVrh91 nucleic acid sequence which encodes the vpl amino acid sequence of SEQ ID NO: 26, and optionally additional nucleic acid sequences, e.g., encoding a vp3 protein free of the vpl and/or vp2 -unique regions.
  • the rAAVrh91 resulting from production using a single nucleic acid sequence vp 1 produces the heterogeneous populations of vpl proteins, vp2 proteins and vp3 proteins.
  • the AAVrh91 capsid contains subpopulations within the vpl proteins, within the vp2 proteins and within the vp3 proteins which have modifications from the predicted amino acid residues in SEQ ID NO: 26.
  • a nucleic acid sequence encoding the AAVrh91 amino acid sequence is provided in SEQ ID NO: 25 and the encoded amino acid sequence is provided in SEQ ID NO: 26.
  • a nucleic acid sequence encoding the AAVrh91 amino acid sequence is provided in SEQ ID NO: 1 and the encoded amino acid sequence is provided in SEQ ID NO: 28.
  • composition comprising an rAAV or a vector as described herein and an aqueous suspension media.
  • the suspension is formulated for intravenous delivery, intrathecal administration, or intracerebroventricular administration.
  • compositions containing at least one rAAV stock and an optional carrier, excipient and/or preservative are provided herein.
  • a “stock” of rAAV refers to a population of rAAV. Despite heterogeneity in their capsid proteins due to deamidation, rAAV in a stock are expected to share an identical vector genome.
  • a stock can include rAAV having capsids with, for example, heterogeneous deamidation patterns characteristic of the selected AAV capsid proteins and a selected production system. The stock may be produced from a single production system or pooled from multiple runs of the production system. A variety of production systems, including but not limited to those described herein, may be selected.
  • carrier includes any and all solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like.
  • carrier includes any and all solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like.
  • Supplemental active ingredients can also be incorporated into the compositions.
  • phannaceutically-acceptable refers to molecular entities and compositions that do not produce an allergic or similar untoward reaction when administered to a host.
  • Delivery vehicles such as liposomes, nanocapsules, microparticles, microspheres, lipid particles, vesicles, and the like, may be used for the introduction of the compositions of the present invention into suitable host cells.
  • the rAAV vector delivered vector genomes may be formulated for delivery either encapsulated in a lipid particle, a liposome, a vesicle, a nanosphere, or a nanoparticle or the like.
  • a composition in one embodiment, includes a final formulation suitable for delivery to a subject, e.g., is an aqueous liquid suspension buffered to a physiologically compatible pH and salt concentration.
  • a final formulation suitable for delivery to a subject e.g., is an aqueous liquid suspension buffered to a physiologically compatible pH and salt concentration.
  • one or more surfactants are present in the formulation.
  • the composition may be transported as a concentrate which is diluted for administration to a subject.
  • the composition may be lyophilized and reconstituted at the time of administration.
  • a suitable surfactant, or combination of surfactants may be selected from among non-ionic surfactants that are nontoxic.
  • a difunctional block copolymer surfactant terminating in primary hydroxyl groups is selected, e.g., such as Pluronic® F68 [BASF], also known as Poloxamer 188, which has a neutral pH, has an average molecular weight of 8400.
  • Poloxamers may be selected, i.e., nonionic triblock copolymers composed of a central hydrophobic chain of polyoxypropylene (polypropylene oxide)) flanked by two hydrophilic chains of polyoxyethylene (polyethylene oxide)), SOLUTOL HS 15 (Macrogol-15 Hydroxystearate), LABRASOL (Polyoxy capryllic glyceride), polyoxy 10 oleyl ether, TWEEN (polyoxyethylene sorbitan fatty acid esters), ethanol and polyethylene glycol.
  • the formulation contains a poloxamer.
  • Poloxamer 188 is selected.
  • the surfactant may be present in an amount up to about 0.0005 % to about 0.001% (based on weight ratio, w/w %) of the suspension. In another embodiment, the surfactant may be present in an amount up to about 0.0005 % to about 0.001% (based on volume ratio, v/v %) of the suspension. In yet another embodiment, the surfactant may be present in an amount up to about 0.0005 % to about 0.001% of the suspension, wherein n % indicates n gram per 100 mL of the suspension.
  • the composition includes a carrier, diluent, excipient and/or adjuvant.
  • Suitable carriers may be readily selected by one of skill in the art in view of the indication for which the transfer virus is directed.
  • one suitable carrier includes saline, which may be formulated with a variety of buffering solutions (e.g., phosphate buffered saline).
  • Other exemplary carriers include sterile saline, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, and water.
  • the buffer/carrier should include a component that prevents the rAAV, from sticking to the infusion tubing but does not interfere with the rAAV binding activity in vivo.
  • a suitable surfactant, or combination of surfactants may be selected from among non-ionic surfactants that are nontoxic.
  • a difunctional block copolymer surfactant terminating in primary hydroxyl groups is selected, e.g., such as Poloxamer 188 (also known under the commercial names Pluronic® F68 [BASF], Lutrol® F68, Synperonic® F68, Kolliphor® P188) which has a neutral pH, has an average molecular weight of 8400.
  • Poloxamers may be selected, i.e., nonionic triblock copolymers composed of a central hydrophobic chain of polyoxypropylene (polypropylene oxide)) flanked by two hydrophilic chains of polyoxyethylene (polyethylene oxide)), SOLUTOL HS 15 (Macrogol- 15 Hydroxystearate), LABRASOL (Polyoxy capryllic glyceride), polyoxy -oleyl ether, TWEEN (polyoxyethylene sorbitan fatty acid esters), ethanol and polyethylene glycol.
  • the formulation contains a poloxamer.
  • copolymers are commonly named with the letter "P" (for poloxamer) followed by three digits: the first two digits x 100 give the approximate molecular mass of the poly oxypropylene core, and the last digit x 10 gives the percentage polyoxyethylene content.
  • Poloxamer 188 is selected.
  • the surfactant may be present in an amount up to about 0.0005 % to about 0.001% of the suspension.
  • the composition containing the rAAV.hMECP2 is delivered at a pH in the range of 6.8 to 8, or 7.2 to 7.8, or 7.5 to 8.
  • a pH above 7.5 may be desired, e.g., 7.5 to 8, or 7.8.
  • the formulation may contain a buffered saline aqueous solution not comprising sodium bicarbonate.
  • a buffered saline aqueous solution comprising one or more of sodium phosphate, sodium chloride, potassium chloride, calcium chloride, magnesium chloride and mixtures thereof, in water, such as a Harvard’s buffer.
  • the aqueous solution may further contain Kolliphor® P188, a poloxamer which is commercially available from BASF which was formerly sold under the trade name Lutrol® F68.
  • the aqueous solution may have a pH of 7.2.
  • the formulation may contain a buffered saline aqueous solution comprising 1 mM Sodium Phosphate (NaiPOr). 150 mM sodium chloride (NaCl), 3mM potassium chloride (KC1), 1.4 mM calcium chloride (CaCh), 0.8 mM magnesium chloride (MgCh), and 0.001% poloxamer (e.g., Kolliphor®) 188, pH 7.2. See, e.g., harvardapparatus.com/harvard-apparatus-perfusion-fluid.html.
  • Harvard’s buffer is preferred due to better pH stability observed with Harvard’s buffer.
  • the formulation buffer is artificial CSF with Pluronic F68.
  • the formulation may contain one or more permeation enhancers.
  • suitable permeation enhancers may include, e.g., mannitol, sodium glycocholate, sodium taurocholate, sodium deoxycholate, sodium salicylate, sodium caprylate, sodium caprate, sodium lauryl sulfate, polyoxyethylene-9-laurel ether, or EDTA.
  • compositions of the invention may contain, in addition to the rAAV and carrier(s), other conventional pharmaceutical ingredients, such as preservatives, or chemical stabilizers.
  • suitable exemplary preservatives include chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide, propyl gallate, the parabens, ethyl vanillin, glycerin, phenol, and parachlorophenol.
  • Suitable chemical stabilizers include gelatin and albumin.
  • compositions according to the present invention may comprise a pharmaceutically acceptable carrier, such as defined above.
  • the compositions described herein comprise an effective amount of one or more AAV suspended in a pharmaceutically suitable carrier and/or admixed with suitable excipients designed for delivery to the subject via injection, osmotic pump, intrathecal catheter, or for delivery by another device or route.
  • the composition is formulated for intrathecal delivery.
  • the composition is formulated for intravenous (iv) delivery.
  • a method of treating Rett Syndrome comprising administrating an effective amount of an rAAV or a vector as described herein to a subject in need thereof.
  • an “effective amount” herein is the amount which achieves amelioration of RTT symptoms and/or delayed RTT progression.
  • the vectors are administered in sufficient amounts to transfect the cells and to provide sufficient levels of gene transfer and expression to provide a therapeutic benefit without undue adverse effects, or with medically acceptable physiological effects, which can be determined by those skilled in the medical arts.
  • Conventional and pharmaceutically acceptable routes of administration include, but are not limited to, direct delivery to a desired organ (e.g., brain, CSF, the liver (optionally via the hepatic artery), lung, heart, eye, kidney,), oral, inhalation, intranasal, intrathecal, intratracheal, intraarterial, intraocular, intravenous, intramuscular, subcutaneous, intradermal, intraparenchymal, intracerebroventricular, intrathecal, ICM, lumbar puncture and other parenteral routes of administration. Routes of administration may be combined, if desired. In certain embodiments, Ommaya Reservoir is used for administration.
  • Dosages of the viral vector depend primarily on factors such as the condition being treated, the age, weight and health of the patient, and can thus vary among patients.
  • a therapeutically effective human dosage of the viral vector is generally in the range of from about 25 to about 1000 microliters to about 100 mL of solution containing concentrations of from about 1 x 10 9 to 1 x 10 16 vector genome copies.
  • a volume of about 1 mL to about 15 mL, or about 2.5 mL to about 10 mL, or about 5 mL suspension is delivered.
  • a volume of about 1, about 2, about 3, about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, or about 15 mL suspension is delivered.
  • a dose of about 8.9 x 10 12 to 2.7 x 10 14 GC total is administered in this volume.
  • a dose of about 1.1 xlO 10 GC/g brain mass to about 3.3 x 10 11 GC/g brain mass is administered in this volume.
  • the dosage is adjusted to balance the therapeutic benefit against any side effects and such dosages may vary depending upon the therapeutic application for which the recombinant vector is employed.
  • the levels of expression of the transgene product can be monitored to determine the frequency of dosage resulting in viral vectors, preferably AAV vectors containing the minigene.
  • dosage regimens similar to those described for therapeutic purposes may be utilized for immunization using the compositions of the invention.
  • the replication-defective virus compositions can be formulated in dosage units to contain an amount of replication-defective virus that is in the range of about 1.0 x 10 9 GC to about 1.0 x 10 16 GC (to treat a subject) including all integers or fractional amounts within the range, and preferably 1.0 x 10 12 GC to 1.0 x 10 14 GC for a human patient.
  • the compositions are formulated to contain at least IxlO 9 , 2xl0 9 , 3xl0 9 , 4xl0 9 , 5xl0 9 , 6xl0 9 , 7xl0 9 , 8xl0 9 , or 9xlO 9 GC per dose including all integers or fractional amounts within the range.
  • compositions are formulated to contain at least IxlO 10 , 2xlO 10 , 3xl0 10 , 4xlO 10 , 5xl0 10 , 6xlO 10 , 7xlO 10 , 8xl0 10 , or 9xlO 10 GC per dose including all integers or fractional amounts within the range.
  • the compositions are formulated to contain at least IxlO 11 , 2xlO n , 3xl0 n , 4xlO n , 5xl0 n , 6xlO n , 7xlO n , 8xl0 n , or 9xlO n GC per dose including all integers or fractional amounts within the range.
  • compositions are formulated to contain at least IxlO 12 , 2x10 , 3x10 , 4x10 , 5xl0 12 , 6xl0 12 , 7xl0 12 , 8xl0 12 , or 9xl0 12 GC per dose including all integers or fractional amounts within the range.
  • compositions are formulated to contain at least IxlO 13 , 2xl0 13 , 3xl0 13 , 4xl0 13 , 5xl0 13 , 6xl0 13 , 7xl0 13 , 8xl0 13 , or 9xl0 13 GC per dose including all integers or fractional amounts within the range.
  • compositions are formulated to contain at least IxlO 14 , 2xl0 14 , 3xl0 14 , 4xl0 14 , 5xl0 14 , 6xl0 14 , 7xl0 14 , 8xl0 14 , or 9xl0 14 GC per dose including all integers or fractional amounts within the range.
  • the compositions are formulated to contain at least IxlO 15 , 2xl0 15 , 3xl0 15 , 4xl0 15 , 5xl0 15 , 6xl0 15 , 7xl0 15 , 8xl0 15 , or 9xl0 15 GC per dose including all integers or fractional amounts within the range.
  • the dose can range from IxlO 10 to about IxlO 15 GC per kg body weight including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 9 , 2xl0 9 , 3xl0 9 , 4xl0 9 , 5xl0 9 , 6xl0 9 , 7xl0 9 , 8xl0 9 , or 9xl0 9 GC per kg body weight including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 10 , 2xlO 10 , 3xlO 10 , 4xlO 10 , 5xlO 10 , 6xlO 10 , 7xlO 10 , 8xlO 10 , or 9xlO 10 GC per kg body weight including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 11 , 2xlO n , 3xl0 n , 4xlO n , 5xl0 n , 6xlO n , 7xlO n , 8xl0 n , or 9xlO n GC per kg body weight including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 12 , 2xl0 12 , 3xl0 12 , 4xl0 12 , 5xl0 12 , 6xl0 12 , 7xl0 12 , 8xl0 12 , or 9xl0 12 GC per kg body weight including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 13 , 2xl0 13 , 3xl0 13 , 4xl0 13 , 5xl0 13 , 6xl0 13 , 7xl0 13 , 8xl0 13 , or 9xl0 13 GC per kg body weight including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 14 , 2xl0 14 , 3xl0 14 , 4xl0 14 , 5xl0 14 , 6xl0 14 , 7xl0 14 , 8xl0 14 , or 9xl0 14 GC per kg body weight including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 15 , 2xl0 15 , 3xl0 15 , 4xl0 15 , 5xl0 15 , 6xl0 15 , 7xl0 15 , 8xl0 15 , or 9xl0 15 GC per kg body weight including all integers or fractional amounts within the range.
  • the dose can range from IxlO 10 to about IxlO 15 GC per gram (g) brain mass including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 9 , 2xl0 9 , 3x10 , 4x10 , 5x10 , 6x10 , 7x10 , 8x10 , or 9xl0 9 GC per gram (g) brain mass including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 10 , 2xlO 10 , 3xl0 10 , 4xlO 10 , 5xl0 10 , 6xlO 10 , 7xlO 10 , 8xl0 10 , or 9x10 10 GC per gram (g) brain mass including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 11 , 2xlO n , 3xl0 n , 4xlO n , 5xl0 n , 6xlO n , 7xlO n , 8xl0 n , or 9xlO n GC per gram (g) brain mass including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 12 , 2xl0 12 , 3xl0 12 , 4xl0 12 , 5xl0 12 , 6xl0 12 , 7xl0 12 , 8xl0 12 , or 9xl0 12 GC per gram (g) brain mass including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 13 , 2xl0 13 , 3xl0 13 , 4xl0 13 , 5xl0 13 , 6xl0 13 , 7xl0 13 , 8xl0 13 , or 9xl0 13 GC per gram (g) brain mass including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 14 , 2xl0 14 , 3xl0 14 , 4xl0 14 , 5xl0 14 , 6xl0 14 , 7xl0 14 , 8xl0 14 , or 9xl0 14 GC per gram (g) brain mass including all integers or fractional amounts within the range.
  • the effective amount of the vector is about IxlO 15 , 2xl0 15 , 3xl0 15 , 4xl0 15 , 5xl0 15 , 6xl0 15 , 7xl0 15 , 8xl0 15 , or 9xl0 15 GC per gram (g) brain mass including all integers or fractional amounts within the range.
  • the above doses may be administered in a variety of volumes of carrier, excipient or buffer formulation, ranging from about 25 to about 1000 microliters, or higher volumes, including all numbers within the range, depending on the size of the area to be treated, the viral titer used, the route of administration, and the desired effect of the method.
  • the volume of carrier, excipient or buffer is at least about 25 pL.
  • the volume is about 50 pL.
  • the volume is about 75 pL.
  • the volume is about 100 pL.
  • the volume is about 125 pL.
  • the volume is about 150 pL.
  • the volume is about 175 pL.
  • the volume is about 200 pL. In another embodiment, the volume is about 225 pL. In yet another embodiment, the volume is about 250 pL. In yet another embodiment, the volume is about 275 pL. In yet another embodiment, the volume is about 300 pL. In yet another embodiment, the volume is about 325 pL. In another embodiment, the volume is about 350 pL. In another embodiment, the volume is about 375 pL. In another embodiment, the volume is about 400 pL. In another embodiment, the volume is about 450 pL. In another embodiment, the volume is about 500 pL. In another embodiment, the volume is about 550 pL. In another embodiment, the volume is about 600 pL. In another embodiment, the volume is about 650 pL. In another embodiment, the volume is about 700 pL. In another embodiment, the volume is between about 700 and 1000 pL.
  • the dose may be in the range of about 1 x 10 9 GC/g brain mass to about 1 x 10 12 GC/g brain mass. In certain embodiments, the dose may be in the range of about 1 x 10 10 GC/g brain mass to about 3 x 10 11 GC/g brain mass. In certain embodiments, the dose may be in the range of about 1 x 10 10 GC/g brain mass to about 2.5 x 10 11 GC/g brain mass. In certain embodiments, the dose may be in the range of about 5 x 10 10 GC/g brain mass.
  • the viral constructs may be delivered in doses of from at least about least IxlO 9 GC to about 1 x 10 15 , or about 1 x 10 11 to 5 x 10 13 GC.
  • Suitable volumes for delivery of these doses and concentrations may be determined by one of skill in the art. For example, volumes of about 1 pL to 150 mL may be selected, with the higher volumes being selected for adults. Typically, for newborn infants a suitable volume is about 0.5 mL to about 10 mL, for older infants, about 0.5 mL to about 15 mL may be selected. For toddlers, a volume of about 0.5 mL to about 20 mL may be selected. For children, volumes of up to about 30 mL may be selected.
  • volume up to about 50 mL may be selected.
  • a patient may receive an intrathecal administration in a volume of about 5 mL to about 15 mL are selected, or about 7.5 mL to about 10 mL.
  • Other suitable volumes and dosages may be determined. The dosage may be adjusted to balance the therapeutic benefit against any side effects and such dosages may vary depending upon the therapeutic application for which the recombinant vector is employed.
  • the above-described recombinant vectors may be delivered to host cells according to published methods.
  • the rAAV preferably suspended in a physiologically compatible carrier, may be administered to a human or non-human mammalian patient.
  • the rAAV is suitably suspended in an aqueous solution containing saline, a surfactant, and a physiologically compatible salt or mixture of salts.
  • the formulation is adjusted to a physiologically acceptable pH, e.g., in the range of pH 6 to 9, or pH 6.5 to 7.5, pH 7.0 to 7.7, or pH 7.2 to 7.8.
  • pH of the cerebrospinal fluid is about 7.28 to about 7.32
  • a pH within this range may be desired; whereas for intravenous delivery, a pH of about 6.8 to about 7.2 may be desired.
  • other pHs within the broadest ranges and these subranges may be selected for other route of delivery.
  • Intrathecal delivery refers to a route of administration for drugs via an injection into the spinal canal, more specifically into the subarachnoid space so that it reaches the cerebrospinal fluid (CSF).
  • Intrathecal delivery may include lumbar puncture, intraventricular (including intracerebroventricular (ICV)), suboccipital/intracistemal, and/or Cl -2 puncture.
  • material may be introduced for diffusion throughout the subarachnoid space by means of lumbar puncture.
  • injection may be into the cistema magna.
  • a rAAV, vector, or composition as described herein is administrated to a subject in need via the intrathecal administration.
  • the intrathecal administration is performed as described in US Patent Publication No. 2018-0339065 Al, published November 29, 2019, which is incorporated herein by reference in its entirety.
  • tracistemal delivery or “intracistemal administration” refer to a route of administration for drugs directly into the cerebrospinal fluid of the cistema magna cerebellomedularis, more specifically via a suboccipital puncture or by direct injection into the cistema magna or via permanently positioned tube.
  • treatment of the composition described herein has minimal to mild asymptomatic degeneration of DRG sensory neurons in animals and/or in human patients, well-tolerated with respect to sensory nerve toxicity and subclinical sensory neuron lesions.
  • the vectors provided herein may be administered intrathecally via the method and/or the device provided in this section and described in WO 2018/160582, which is incorporated by reference herein. Alternatively, other devices and methods may be selected.
  • the method comprises the steps of CT-guided suboccipital injection via spinal needle into the cisterna magna of a patient.
  • CT Computed Tomography
  • the term Computed Tomography (CT) refers to radiography in which a three-dimensional image of a body structure is constructed by computer from a series of plane cross-sectional images made along an axis.
  • CT Computed Tomography
  • the apparatus is described in US Patent Publication No.
  • RNA Ribonucleic acid
  • expression is used herein in its broadest meaning and comprises the production of RNA or of RNA and protein.
  • expression or “translation” relates in particular to the production of peptides or proteins. Expression may be transient or may be stable.
  • a refers to one or more, for example, “an enhancer”, is understood to represent one or more enhancer(s).
  • the terms “a” (or “an”), “one or more,” and “at least one” is used interchangeably herein.
  • the term “about” when used to modify a numerical value means a variation of ⁇ 10% ( ⁇ 10%, e.g., ⁇ 1, ⁇ 2, ⁇ 3, ⁇ 4, ⁇ 5, ⁇ 6, ⁇ 7, ⁇ 8, ⁇ 9, ⁇ 10, or values therebetween) from the reference given, unless otherwise specified.
  • a gene therapy was developed to restore MECP2 expression which has been identified as causative gene defect.
  • An MECP2 expression cassette is transferred into brain neurons using AAV gene therapy technology. The injection of the therapeutic article is delivered via cerebrospinal fluid (CSF), using the cistema magna as access point, or intravenously.
  • CSF cerebrospinal fluid
  • a MECP2 expression cassette highly optimized for expression in humans was used in combination with an AAV capsid with highly improved central nervous system (CNS) transduction.
  • CNS central nervous system
  • the amino acid sequence for the main human isoform of MECP2 (Methyl-CpG-binding protein 2, isoform alpha, UniProt ID P51608-2) was reverse translated into a DNA sequence and then further engineered.
  • the engineered MECP2 sequence (SEQ ID NO 3, i.e., nt 484 to nt 1983 of SEQ ID NO: 1 and nt 484 to nt 1983 of SEQ ID NO: 6, which is also termed as hMECP2co or MECP2co as used herein) was cloned into an AAV expression plasmid under the control of the human synapsin promoter (Thiel, G., Greengard, P. & Siidhof, T. C.
  • MECP2co the MECP2 coding sequence
  • ITR AAV2 inverted terminal repeats
  • rBG rabbit globulin poly A sequence
  • DRG dorsal root ganglia
  • the above plasmid was modified to contain four repeats of the miR183 binding site (agtgaattctaccagtgccata, SEQ ID NO: 7) directly after the MCEP2 coding sequence and before the SV40 poly A sequence (FIG. 2A; SEQ ID NO: 15).
  • AAV MECP2 vectors are produced using triple transfection using a trans plasmid encoding capsid PHP.B (Deverman, B. E. et al.
  • AAV9 capsid AAVhu68 capsid
  • AAV.hMECP2co vectors were used in the experiments as described below (SEQ ID NO of vector genome): (a) AAV-hSyn-hMECP2co-miR183-SV40 (SEQ ID NO: 15; comprising the expression cassette of SEQ ID NO: 6);
  • AAV-hSyn-hMECP2co-SV40 (SEQ ID NO: 23; comprising the expression cassette of SEQ ID NO: 1);
  • AAV-UbC-hMecp2co-miR183-rBG (SEQ ID NO: 31; comprising the expression cassette of SEQ ID NO: 29);
  • AAV-UbC-hMECP2co-miR182-rBG (SEQ ID NO: 35; comprising the expression cassette of SEQ ID NO: 33);
  • AAV-UbC-hMECP2co-miR182-miR183-rBG (SEQ ID NO: 39; comprising the expression cassette of SEQ ID NO: 37).
  • an AAV vector carrying a wildtype MECP2 gene (SEQ ID NO: 18) was constructed (AAV-CB7-CI-MECP2el-rBG (SEQ ID NO: 24; comprising the expression cassette of SEQ ID NO: 4)) and used in the experiments below, wherever specified.
  • Mecp2-ko mice were obtained from Jackson Laboratories (B6. 129P2(C)-Mecp2tmI. IBird/J, strain # 003890) and crossed heterozygous female ko mice with wildtype (wt) C57B16 males to obtain male Mecp2-ko mice (Hemizygote, HEMI, also noted as ko mice) and male wt litter mates.
  • mice received AAV.hMECP2co vector or vehicle control (sterile phospho-buffered saline, PBS) at 18-21 days of age by retro-orbital injections of 1 x I0 11 to 5 x I0 11 genome copies (GC or gc) in a total volume of lOOul per mouse.
  • Mouse were housed mixed in regard of genotype and injection product, weighed and observed at least twice a week, and aged to three months. Most Mecp2-ko mice that had received vehicle control died or reached a humane endpoint for euthanasia before reaching the 3-month timepoint whereas AAV.hMECP2co-treated and wt mice survived and were fit for undergoing a battery of behavior testing.
  • Data analysis Data was graphed and analyzed using GraphPad Prims software. Video files were recorded in mp4 format at 20fps and analyzed using EthoVision XT software (version 14, Noldus Information Technology).
  • AAV vector for MECP2 gene therapy (AAV.hMECP2co) was developed.
  • the DNA sequences of MECP2 were engineered for expression of hMECP2 of the amino acid sequence of SEQ ID NO: 2.
  • the expression is driven by the human synapsin promoter, which has extensively documented to selectively express in CNS neurons. Additionally examined, the expression is driven by human Ubiquitin C promoter or a chicken beta-actin promoter.
  • a successful expression of MECP2 via the AAV-PHP.B.hSyn.MECP2co vector was observed in mouse brain.
  • the AAV-PHP.B.hSyn.MECP2co vector was injected to Mecp2-ko mice intravenously (iv) for maximal brain transduction.
  • Mouse brains were then harvested and processed for immunofluorescence staining using anti-MECP2 antibody as described in the Materials and Methods. Representative images are provided in FIGs. TATE and the result show that a widespread expression of hMECP2 was achieved in the cortex of the Mecp2-ko mice treated by the AAV-PHP.B.hSyn.MECP2co vector (FIG.
  • AAV-PHP.B.hSyn.MECP2co vector (3 x IO 10 GC/mouse, noted as 3el0 AAV; 1 x 10 11 GC/mouse, noted as lei 1 AAV; and 2.5 x 10 11 GC/mouse, noted as 2.5el 1 AAV, and 5 x 10 11 GC/mouse, noted as 5el 1 AAV ) in FIG. 5A, as described in the Materials and Methods.
  • PBS phosphate-buffered saline
  • WT or WT + PBS male wild type littermates
  • Mecp2-ko mice treated with PBS severed as a negative control male Mecp2-ko mice treated with PBS severed as a negative control
  • KO, ko+PBS or KO+PBS or HEMI+PBS Percentages of survived mice in the tested groups were plotted in FIG.
  • the ko mice treated with three doses (1 x 10 11 , 2.5 x 10 11 and 5 x 10 11 GC/mouse) of the vector showed a steady increase in body weights, while starting from 6-9 weeks of age, the PBS-treated ko mice gradually lost instead of gained weights.
  • the PBS treated wild type mice displayed a bodyweight curve similar to those of the treated ko mice but with slightly heavier weights.
  • DRG de-targeting is incorporated in MECP2 expression cassette to allow for higher dose of the vector administrated.
  • the vector was delivered to juvenile subject at a dose of 2.3 x
  • the averaged percentage of the total ambulatory activity or the rearing activity acquired from the PBS-treated WT was set as 100% and the readings from the rest groups were then calculated accordingly and presented in FIGs. 6A and 6B.
  • the PBS treated ko mice showed an about 40% ambulatory activity and a less than 10% rearing activity.
  • Treatment via 1 x 10 11 GC of the vector increased the ambulatory activity to about 67%, and 2.5 x 10 11 GC of the vector further improved the percentage to about 85%.
  • the rearing activity was increased by 1 x 10 11 GC or 2.5 x 10 11 GC of the vector up to about 85% or about 60% respectively.
  • the highest dose tested (5 x 10 11 GC/mouse) demonstrated an about 60% ambulatory activity and an about 32% rearing activity, both of which are still higher than that of PBS treated ko mice.
  • a correlation analysis was performed of behavior outcome and number of the neurons transduced in the mouse brain post treatment.
  • Triple-stained immunofluorescence images (DAPI for nuclei, MECP2, and NeuN for Neurons) were used to semi-automatically quantify the number of neurons expressing MECP2 in the Mecp2-ko cerebral cortex (FIG. 6E) and hippocampus (FIG. 6F) after injections at different doses.
  • the obtained data was graphed as %MECP2+/NeuN+ cells. Animals treated with the doses of 6 x 10 10 GC/ mouse or below (3 x 10 10 GC/mouse) did not survive long enough and/or did not have enough mobility to proceed with behavior test.
  • MECP2+ In correlation only small number of neurons were observed to stain positive for expression of MECP2 (MECP2+).
  • MECP2+ neurons In cerebral cortex, 5.7% and 5.8% were MECP2+ neurons, respectively at doses 3 x 10 10 and 6 x 10 10 GC/mouse.
  • In cerebral cortex, 12.9%, 42.6%, and 75.3% were MECP2+ neurons, respectively at doses 1 x 10 11 , 2.5 x 10 11 , and 5 x 10 11 GC/mouse.
  • mice Motor coordination of the mice was also evaluated via rotarod test. Latency to fall measured by seconds of a mouse staying on a rotarod is shown in FIG. 7A. Compared to the PBS treated ko mice, the ko mice treated with 1 x 10 11 GC or 2.5 x 10 11 GC of the vector showed a significant improvement on staying on the rotarod and avoiding falling. Additionally, three trials were performed for each mouse. No improvement while repeating the rotarod test was observed in PBS treated ko mice. However, an increase in time on the rotarod was observed from PBS-freated wt mice as well as the vector treated ko mice.
  • Behavior trait of the mice was further tested via Marble Burying assay. An about 7 out of 12 marbles were at least half covered by bedding by the wt mice, while PBS treated ko mice only buried 1. An about 2, or an about 3 marbles were buried by ko mice treated with 1 x 10 11 GC or 2.5 x 10 11 GC of the vector, respectively, demonstrating a behavior correction toward wt phenotype.
  • Ymaze spontaneous alternation index may serve as an indicator for willingness to explore new environments.
  • treatment with 5 x 10 11 GC of the vector brought the index up to about 35%, while the indexes of ko mice treated with 1 x 10 11 GC or 2.5 x 10 11 GC of the vector were about 70% which is similar to if not higher than the wt one (about 58%).
  • Ko mice receiving only PBS moved very little and did not reach the threshold of at least 9 decisions per 5-minute interval, thus it was not possible to assess their performance in the Y Maze.
  • PHP.B.hSyn.MECP2co vector in juvenile ko mice shown as a more than 100-day survival or as comparisons to a wild-type (wt) control. These results indicate that behavior correction outcome depends on AAV-PHP.B.hSyn.MECP2co dose.
  • Additional AAV.hMECP2co vectors were constructed utilizing promoters with proven expression efficacy in NHP (for example, CBA or UbC promoter), but with the same hMECP2co nucleic acid sequence (AAV-UbC-hMecp2co-miR183-rBG, AAV-UbC- hMECP2co-miR182-rBG, AAV-UbC-hMECP2co-miR182-miR183-rBG). The vectors were also tested in juvenile mice and showed pharmaceutical efficacy.
  • Dose-dependency is established between number of neurons transduced and behavior correction.
  • the achieved per-cell expression levels are also compared to that of wt mouse and human brain.
  • Juvenile or adult wild type C57B16 mice were injected with the AAV- PHP.B.hSyn-hMECP2co vector i.v. at various doses in order to evaluate safety or toxicity of the vector.
  • AAV-PHP.B.hSyn- hMECP2co adversely affected behavior outcome (decreased activity) but did not cause overt motor defects (at 4x of the lowest therapeutic dose).
  • the AAV.hMECP2co vector was administrated i.v. to adult mice at a dose of 1 x 10 12 GC/mouse. This dose in adult mice is equivalent to 4 x 10 11 GC/ juvenile mouse since body weight of an adult mice (about 25g) is about 2.5 times of a juvenile (about 10g). Therefore, this tested dose (1 x 10 12 GC/adult mouse) is believed to be 4 times of the lowest therapeutic dose which is 1 x 10 11 GC/ juvenile mouse.
  • Open Field Assay was performed to evaluate activity level of the adult mice. It was showed that treatment via 1 x 10 12 GC/mouse of the vector led to an ambulatory /horizontal activity reduction by 28% (p ⁇ 0.0001, ANOVA, FIG. 10A) and a rearing/vertical activity reduction by 64% (p ⁇ 0.0001, ANOVA, FIG. 10B) compared to the control group treated by only PBS. Neuro-motor ability and coordination were investigated by rotarod tests. As shown in FIG. 10C, the vector-treated mice were more likely to fall from the rotarod compared to the PBS treated mice (p ⁇ 0.001, 2-way ANOVA). However, this result may be confounded by the lower activity shown in FIGs. 10A and 10B.
  • Non-human primate experiments Non-human primates (NHPs) for the species Macaca mulatta (rhesus macaques) were obtained from Covance Research Products, Inc. Quarantine and animal husbandry was performed according to Gene Therapy Program SOPs. In the month before AAV vector administration and throughout the study body weight, temperature, respiratory rate and heart rate were periodically monitored, and blood and CSF samples were obtained. Whole blood was used for cell counts and differentials, and a clinical blood chemistry panel. CSF samples were used for blood cell counts and differentials, and total protein quantification.
  • a leur access extension catheter was connected to the spinal needle to facilitate dosing of 1 ml lohexol (Trade Name: Omnipaque 180 mg/mL, General Electric Healthcare) contrast media.
  • a syringe containing the test article (volume equivalent to 1 mL plus the volume of syringe and linker dead space) was connected to the flexible linker and injected over 30 ⁇ 5 seconds. The needle was removed, and direct pressure was applied to the puncture site.
  • AAVhu68.hSyn.MECP2co vector has injected at a dose of 3 x 10 12 , 1 x 10 13 or 3 x 10 13 GC/NHP while AAVhu68.MECP2 vector was injected at a dose of 2 x 10 13 GC/NHP.
  • a neurological assessment was given to all macaques for detailed evaluation of neurological function. Briefly, evaluation included posture and gait assessment, cranial nerve assessment, proprioceptive assessment and spinal/nerve reflexes.
  • macaques were euthanized, and gross postmortem examination and necropsy was performed. 25 major tissues were harvested from each macaque in duplicate for either snap freezing or fixation in formalin.
  • DNA or RNA was purified from snap-frozen tissues and used for vector biodistribution or transgene expression analysis, respectively.
  • genome copies (GC or gc) per total DNA weight were determined using a TaqMan qPCR assay with probes directed again the polyA region of the transgene cassette and an internal standard.
  • total RNA was used to generate cDNA via first strand synthesis with polyT oligonucleotides, followed by TaqMan qPCR with probes specific for the transgene that did not cross-react with the endogenous rhesus MECP2 sequence.
  • the AAVhu68.hSyn-MECP2 (AAV-hSyn-hMECP2co-SV40 vector genome in AAVhu68 capsid) having the MECP coding sequence of SEQ ID NO: 3 (encoding hMECP of SEQ ID NO: 2) was tested in non-human primates. Rhesus macaques (age 5-7 years) were injected into the CSF via cistema magna access (ICM) with different doses. No adverse signs were observed during the 56 days in-live phase and blood chemistry tests were all normal. After necropsy, vector biodistribution was determined by qPCR and a dosedependent increase was found in all CNS tissues tested.
  • ICM cistema magna access
  • the AAV-hu68.hSyn-MECP2 vector showed a similar vector biodistribution compared to the other vectors, however, the vector was able to achieve much higher mRNA expression in all CNS tissues, which may make the vector better suited for efficacious Rett syndrome gene therapy.
  • the AAV.hMECP2 vectors were produced using the AAVhu68 capsid and listed in the table below.
  • Expression cassettes in the vectors combine different mouse Mecp2 promoter sequences with the wildtype human MECP2 coding sequence (noted as MECP2 or MECP2el; SEQ ID NO: 18).
  • the indicated vectors were delivered at a dose of 2 x 10 13 GC/NHP via intra- cistema magna (ICM) injection. The animals were then observed for 56 days after administration. Necropsy and pathology review were performed.
  • Axonopathy in dorsal white matter tracts characterized by dilated myelin sheaths with and without myelomacrophages and axonal fragmentation were investigated in Groups 1-4. As shown in FIG. 11, a minimal to moderate axonopathy was observed in Group 1 and 2, while a minimal to mild axonopathy was in Group 3 and a moderate to severe axonopathy in Group 4. Luxol Blue stain showed mild to moderate loss of myelin in Spinal White Matter Tracts of all tested groups. See, FIG. 12.
  • FIGs. 13A to 13D revealed vector biodistribution across tissues.
  • MECP2 expression was accessed by IHC with myc antibodies in Group 2 (MeP426-MECP2_myc) or with MECP2 antibodies in Groups 2 and 4. See, FIGs. 14 and 15. Successful expression were detected in both brain cortex and dorsal root ganglia of spinal cord. hMECP2 mRNA expression was measured. Relative quantification with a RT-qPCR probe that selectively amplifies hMECP2 showed different expression levels per group and tissue though vector distribution was similar across groups. See the table below.
  • AAVhu68.hSyn.MECP2co.SV40 (AAV-hSyn-hMECP2co-SV40 vector genome in AAVhu68 capsid) vector comprising an engineered hMECP2 coding sequence (SEQ ID NO: 3) driven by a hSyn promoter was produced and delivered to a NHP subject at 3 x 10 13 GC/NHP, 1 x 10 13 GC/NHP and 3 x 10 12 GC/NHP via ICM injection.
  • Vector biodistribution using each dose was investigated and the result is shown in FIGs. 16A to 16C.
  • Relative quantification with a RT-qPCR probe that selectively amplifies hMECP2 showed different expression levels per group and tissue (FIG. 17), though vector distribution was similar across groups. See, the table below.
  • Expression profile for hSyn promoter is established and then compared to CBA promoter using GFP as readout.
  • DRG de-targeting is incorporated in MECP2 expression cassette to allow for higher dose of the vector administrated.
  • the AAVhu68.hSyn.MECP2co.SV40 vector comprising an engineered hMECP2 coding sequence driven by a hSyn promoter, or the AAVhu68.hSyn.MECP2co.miRl 83 (SEQ ID NO: 15) (AAV-hSyn-hMECP2co-miR183- SV40 vector genome in AAVhu68 capsid), comprising an addition of miR183 sequences for DRG de-targeting, was delivered to a NHP subject at high dose of 1 x 10 14 GC/NHP via ICM injection.
  • In- situ hybridization with a probe specific to MECP2co showed that inclusion of the miR183 cassette drastically reduced the number of DRG cells that express MECP2co and the amount of RNA that is expressed (FIG. 18A). Additionally, pathologist scoring was performed of white matter tracks and DRG. For all tissue scores, there was a strong trend to or a significant decrease in severity in the NHP that had received the AAV vector with miR183 (FIG. 18B and FIG. 18C). Harvested tissues were also subjected to in situ hybridization assay, and quantified for DRG cell number and intensity.
  • EXAMPLE 4 Mouse therapeutic studies with AAV.rh91 Vector comprising 8 DRG- detargeting sequences
  • the amino acid sequence for the main human isoform of MECP2 (Methyl-CpG-binding protein 2, isoform alpha, UniProt ID P51608-2) was reverse translated into a DNA sequence.
  • the MECP2 coding sequence was further engineered, e.g., by considering codon frequencies found in the human genome, cryptic RNA splice sites and alternative reading frames.
  • the engineered MECP2 sequence was cloned into an AAV expression plasmid under the control of the Ubiquitin C promoter (UbC).
  • UbC Ubiquitin C promoter
  • the MECP2 coding sequence is preceded by a Kozak sequence, followed by the rabbit beta-globin (rBG) poly A sequence and framed by AAV2 inverted terminal repeats (ITR).
  • AAV MECP2 vector UbC.MECP2co.miR182(4x).miR183(4x).rBG, SEQ ID NO: 39 was produced at the University of Pennsylvania Vector Core, using capsid AAVrh91.
  • FIG. 27 shows a schematic diagram of a plasmid for producing an rAAV comprising an AAV.UbC.MECP2co.miR182(4x).miR183(4x).rBG vector genome having nucleic acid sequence of SEQ ID NO: 39, comprising expression cassette of SEQ ID NO: 37.
  • Mecp2-ko mice from Jackson Laboratories (B6.129P2(C)-Mecp2tml. lBird/J, strain # 003890) and crossed heterozygous female ko mice with wt C57B16 males to obtain male Mecp2-ko mice and male wt litter mates.
  • mice received AAV MECP2 (i.e., AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG) vector or vehicle control (sterile phospho-buffered saline) at 14-16 days of age by stereotaxic intracerebroventricular (ICV) injections of 2.5 x 10 10 (2.5el0) or 5 x 10 10 (5e 10) genome copies (GC or gc) in a total volume of 5 pl.
  • Mouse were housed mixed in regard of genotype and injection product, weighed and observed at least twice a week, and aged until reaching a humane endpoint.
  • Mecp2-ko mice that had received vehicle control or the lower dose reached a humane endpoint for euthanasia before aging to 60 days, whereas AAV-MECP2- treated and wt mice survived and were fit for undergoing a battery of behavior testing.
  • Phenotypic Scoring Mice were assessed weekly for the following parameters and received a qualitative score of 0 (symptom not present) to 2 (fully developed symptom). The phenotypic score was calculated by summing up the 6 individual test scores: 1) lack of mobility; 2) abnormal gait; 3) hunched boy posture; 4) whole body tremors; 5) hind limb clasping when picked up at tail base; 6) unkempt, ungroomed, dull appearance. Behavior T esting. Mice underwent one test per day. Testing tune of day, operator and environment was kept the same (60 dB white noise background and 1000 lumens incandescent indirect lighting). Mice were habituated in their home cages before each test for 30 minutes.
  • mice were placed into a 30cm x 30cm arena with a crossed infrared beam array (MedAssociates, Inc.). A single mouse was added in the middle of the cage and the number of beam brakes over the next 30 minutes was automatically recorded, separated into beam brakes close to the ground (general activity) and 3 inches above ground (rearing activity). Center activity was defined as beam crosses within at 20cm x 20cm centered square within the arena.
  • mice were place into a new cage with standard bedding and a 2” x 2” x 1/4” piece of cellulose nesting material. After 24 hours, mice were return to their home cage and the quality of manufactured nest was score on a scale from 1 to 5.
  • Mecp2-ko mice were injected by neonatal ICV with 5 x 10 10 GC (5el0 gc) of AAV vector (AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG) and brains were harvested 2 weeks later. At the same time, brains from wt littermates were harvested. Lysates were used for Western blotting with MECP2 antibodies. Treatment with AAV-MECP2 vector led to robust expression of MECP2 in Mecp2-ko brains (FIG. 19). For therapeutic studies, cohorts of juvenile mice (14-16 days old) were injected via stereotaxic ICV.
  • AAV vector AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG
  • KO mice treated with the 2.5 x IO 10 GC (2.5el0 gc) dose did not show increased survival (mOS 56 days).
  • KO mice treated with the 5 x IO 10 GC (5el0 gc) dose showed a significant survival benefit (mOS 70days, p ⁇ 0.01 in Log-rank test compared to control KO cohort).
  • Control KO mice and KO mice treated with 2.5 x IO 10 GC maintained a much lower yet increasing weight, compared to WT mice.
  • Mice treated with 5 x IO 10 GC (5el0 gc) AAV- MECP2 still had a lower weight compared to WT mice, but got closer and closer to WT weights over time.
  • Phenotypic scores were determined weekly after weaning (FIG. 22). WT mice did not show any typical symptoms of the Rett syndrome mouse model (0 score), which are captured by the scoring system. The score for KO mice and KO mice treated with 2.5 x 10 10 GC (2.5el0 gc) quickly increased. The score also increased for KO mice treated with 5 x 10 10 GC (5el0 gc) AAV MECP2 vector but stabilized after about 8 weeks.
  • FIGs. 23A-23F Behavior testing of WT mice vs. KO littermates treated with 5el0gc MECP2 AAV vector was performed at day 60 (FIGs. 23A-23F, 24-26).
  • treated KO mice performed at very similar levels to WT mice, suggesting an overall therapeutic benefit on movement (FIGs. 23A-23F).
  • ambulatory activity was similar and in total not statistically significant different (FIGs. 23A and 23B).
  • Center zone activity was trending slightly lower in treated KO mice, but not statistically significant (FIGs. 23C and 23D).
  • Rearing activity was trending slightly lower in treated KO mice, but not statistically significant (FIGs. 23E and 23F).
  • EXAMPLE 5 Mouse therapeutic studies with AAV.rh91 Vector comprising 8 DRG- detargetting sequences at various doses.
  • FIGs. 28A and 28B show representative immunofluorescence images from cortex (68 days after injection with 3 x IO 10 GC), showing abundant MECP2 expression that is co-localizing the neuronal marker NeuN (neuronal marker).
  • FIG. 28A shows a representative immunofluorescent image of cortex stained for expression of NeuN (neuronal marker).
  • FIG. 28B shows a representative immunofluorescent image of cortex stained for expression of MECP2.
  • FIG. 29A shows a plot of body weight of WT and Mecp2-ko mice administered PBS (served as control), MECP2 KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x IO 10 GC (2el0), 3 x IO 10 GC (3e 10), and 6 x IO 10 GC (6e 10).
  • PBS serving as control
  • MECP2 KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x IO 10 GC (2el0), 3 x IO 10 GC (3e 10), and 6 x IO 10 GC (6e 10).
  • 29B shows a Kaplan-Meier survival plot WT and Mecp2-KO mice administered PBS (served as control), Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at a dose of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3e 10) and 6 x 10 10 GC (6e 10).
  • FIG. 29C shows a plot of phenotypic score of WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3e 10) and 6 x 10 10 GC (6e 10).
  • the phenotypic scores (0 stands for no symptoms, 5 stands for severe Rett-like symptoms) for all treatment groups were elevated, but the phenotypic scores plateaued after about 10 weeks, whereas the score for untreated ko mice kept increasing.
  • FIG. 29D shows results of the evaluation at D40 (day 40) for abnormal breathing (apneas) by whole-body plethysmography in WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3el0) and 6 x 10 10 GC (6el0).
  • FIG. 29E shows a plot of motor function evaluation at D60 (day 60) on a rotarod in WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3el0) and 6 x 10 10 GC (6el0).
  • Treated mice showed a dose-dependent improvement of motor function, compared to untreated ko mice. It was noted that mice were agitated.
  • FIG. 30A shows plotted ambulatory activity in WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3el0) and 6 x 10 10 GC (6el0).
  • Treated Mecp2-ko mice showed ambulatory activity at or above WT levels.
  • FIG. 30B shows plotted ambulatory activity in center in WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3el0) and 6 x 10 10 GC (6el0).
  • Treated Mecp2-ko mice showed improved or WT- level ambulatory activity in the arena center compared to untreated Mecp2-ko mice.
  • FIG 30C shows plotted rearing activity in WT and Mecp2-KO mice administered PBS (served as control), and Mecp2-KO mice treated with AAVrh91.UbC.MECP2co.miR182(4x).miR183(4x).rBG at doses of 2 x 10 10 GC (2el0), 3 x 10 10 GC (3el0) and 6 x 10 10 GC (6el0).
  • Treated Mecp2-ko mice showed improved or WT- level rearing activity compared to untreated Mecp2-ko mice.
  • EXAMPLE 6 Preliminary AAV Vector expression and safety testing in non-human primates (NHPs).
  • FIG. 31A shows a representative image of RNAscope in-situ hybridization (ISH) of cortical brain section in native control NHP.
  • FIG. 3 IB shows a representative image of RNAscope in-situ hybridization (ISH) of cortical brain section in treated NHP 1.
  • the RNAscope probe used in this study was specific for the hMECP2 transgene sequence and did not cross-react with endogenous rhMECP2.
  • FIG. 32A shows quantification of bulk tissue, including brain tissue, analyzed for vector transduction (GC/diploid genome).
  • FIG. 32B shows quantification of bulk tissue for MECP2 transgene expression in various tissues. Average brain transduction was 0.9 vg/cell. Average brain MECP2 transgene expression was 4.6% of mouse therapeutic level.
  • FIG. 33 shows quantification of vector transduction (VG, vector genome) and MECP2 transgene (Tg, MECP2 transgene mRNA) expression on a single-neuron basis for motor cortex in 3 NHPs. These results show that about 40-60% of neurons in different NHP brain regions were transduced with vector. Also, these results showed that about 25-35% of neurons express any MECP2 Tg mRNA; however, may be too low to yield detectable protein MECP2 protein levels.
  • VG vector genome
  • Tg MECP2 transgene mRNA
  • FIG. 34A and 34B and table below show comparison between different DRG- detargeting approaches including in naive (untreated NHP), NHP treated with no miR, NHP treated with AAV comprising 4 tandem repeats of miR183, or in NHP treated with AAV comprising 4 tandem repeats of miR182 and 4 tandem repeats of miR183.
  • FIG. 34A shows severity scores (5 stands for maximum severity) assigned by veterinary pathologist blinded to treatment status in dorsal root ganglia tissue.
  • FIG. 34B shows severity scores (5 stands for maximum severity) assigned by veterinary pathologist blinded to treatment status in spinal cord (SpC) tissue.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biochemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Veterinary Medicine (AREA)
  • Microbiology (AREA)
  • Neurosurgery (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Neurology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Virology (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Abstract

L'invention concerne un virus adéno-associé recombinant (rAAV) ayant une capside d'AAV et un génome de vecteur comprenant une séquence d'acide nucléique codant pour une protéine 2 de liaison méthyl-CpG humaine (hMECP2) fonctionnelle. L'invention concerne également un système de production utile pour produire le rAAV, une composition pharmaceutique comprenant le rAAV et un procédé de traitement d'un sujet souffrant du syndrome de Rett, ou d'amélioration des symptômes du syndrome de Rett, ou de retardement de la progression du syndrome de Rett par administration d'une quantité efficace du rAAV à un sujet en ayant besoin.
PCT/US2021/057047 2020-10-28 2021-10-28 Compositions utiles dans le traitement du syndrome de rett WO2022094078A1 (fr)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202063106820P 2020-10-28 2020-10-28
US63/106,820 2020-10-28
US202163178877P 2021-04-23 2021-04-23
US63/178,877 2021-04-23

Publications (1)

Publication Number Publication Date
WO2022094078A1 true WO2022094078A1 (fr) 2022-05-05

Family

ID=78806640

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/057047 WO2022094078A1 (fr) 2020-10-28 2021-10-28 Compositions utiles dans le traitement du syndrome de rett

Country Status (1)

Country Link
WO (1) WO2022094078A1 (fr)

Citations (33)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US5741683A (en) 1995-06-07 1998-04-21 The Research Foundation Of State University Of New York In vitro packaging of adeno-associated virus DNA
US6057152A (en) 1992-12-04 2000-05-02 University Of Pittsburgh Recombinant viral vector system
US6204059B1 (en) 1994-06-30 2001-03-20 University Of Pittsburgh AAV capsid vehicles for molecular transfer
US6268213B1 (en) 1992-06-03 2001-07-31 Richard Jude Samulski Adeno-associated virus vector and cis-acting regulatory and promoter elements capable of expressing at least one gene and method of using same for gene therapy
US6491907B1 (en) 1998-11-10 2002-12-10 The University Of North Carolina At Chapel Hill Recombinant parvovirus vectors and method of making
WO2003042397A2 (fr) 2001-11-13 2003-05-22 The Trustees Of The University Of Pennsylvania Methode de detection et/ou d'identification de sequences de virus associes aux adenovirus (aav) et d'isolation de nouvelles sequences ainsi identifiees
US6596535B1 (en) 1999-08-09 2003-07-22 Targeted Genetics Corporation Metabolically activated recombinant viral vectors and methods for the preparation and use
US6660514B1 (en) 1998-05-27 2003-12-09 University Of Florida Research Foundation Method of preparing recombinant adeno-associated virus compositions
WO2005033321A2 (fr) 2003-09-30 2005-04-14 The Trustees Of The University Of Pennsylvania Variantes des virus associes aux adenovirus (aav), sequences, vecteurs les contenant, et leur utilisation
US6951753B2 (en) 1989-09-07 2005-10-04 The 501 Trustees Of Princeton University Helper-free stocks of recombinant adeno-associated virus vectors
US7094604B2 (en) 2002-06-05 2006-08-22 University Of Florida Research Foundation, Inc. Production of pseudotyped recombinant AAV virions
WO2006110689A2 (fr) 2005-04-07 2006-10-19 The Trustees Of The University Of Pennsylvania Procede d'augmentation de la fonction d'un vecteur aav
US7201898B2 (en) 2000-06-01 2007-04-10 The University Of North Carolina At Chapel Hill Methods and compounds for controlled release of recombinant parvovirus vectors
US7229823B2 (en) 1997-04-14 2007-06-12 Richard Jude Samulski Methods for increasing the efficiency of recombinant AAV product
US7439065B2 (en) 1995-06-07 2008-10-21 The University Of North Carolina At Chapel Hill Helper virus-free AAV production
US7456683B2 (en) 2005-06-09 2008-11-25 Panasonic Corporation Amplitude error compensating device and quadrature skew error compensating device
US7588772B2 (en) 2006-03-30 2009-09-15 Board Of Trustees Of The Leland Stamford Junior University AAV capsid library and AAV capsid proteins
WO2011126808A2 (fr) 2010-03-29 2011-10-13 The Trustees Of The University Of Pennsylvania Système d'ablation de transgène induit pharmacologiquement
WO2013004943A1 (fr) 2011-07-06 2013-01-10 Gaztransport Et Technigaz Cuve etanche et thermiquement isolante integree dans une structure porteuse
US20130225666A1 (en) * 2008-12-19 2013-08-29 Nationwide Children's Hospital, Inc. Delivery of polynucleotides using recombinant aav9
US8734809B2 (en) 2009-05-28 2014-05-27 University Of Massachusetts AAV's and uses thereof
US8927514B2 (en) 2010-04-30 2015-01-06 City Of Hope Recombinant adeno-associated vectors for targeted treatment
US20150079038A1 (en) 2013-09-13 2015-03-19 California Institute Of Technology Selective recovery
WO2016049230A1 (fr) 2014-09-24 2016-03-31 City Of Hope Variants de vecteur de virus adénoassocié pour une édition de haute efficacité du génome et procédés correspondants
WO2017160360A2 (fr) 2015-12-11 2017-09-21 The Trustees Of The University Of Pennsylvania Méthode de purification évolutive pour virus adéno-associé 9 (aav9)
WO2018160582A1 (fr) 2017-02-28 2018-09-07 The Trustees Of The University Of Pennsylvania Vecteur de clade f de virus adéno-associé (aav) et ses utilisations
WO2018172795A1 (fr) 2017-03-24 2018-09-27 The University Court Of The University Of Edinburgh Cassettes d'expression de mecp2
US20180339065A1 (en) 2015-10-28 2018-11-29 The Trustees Of The University Of Pennsylvania Intrathecal administration of adeno-associated-viral vectors for gene therapy
WO2018226785A1 (fr) * 2017-06-06 2018-12-13 University Of Massachusetts Vecteurs aav à autorégulation pour l'expression sans risque de mecp2 dans le syndrome de rett
WO2020132455A1 (fr) 2018-12-21 2020-06-25 The Trustees Of The University Of Pennsylvania Compositions pour la réduction spécifique de drg de l'expression de transgène
WO2020219766A1 (fr) * 2019-04-24 2020-10-29 The Trustees Of The University Of Pennsylvania Compositions utiles dans le traitement du syndrome de rett
WO2020223231A1 (fr) 2019-04-29 2020-11-05 The Trustees Of The University Of Pennsylvania Nouvelles capsides de aav et compositions les contenant

Patent Citations (38)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5139941A (en) 1985-10-31 1992-08-18 University Of Florida Research Foundation, Inc. AAV transduction vectors
US6951753B2 (en) 1989-09-07 2005-10-04 The 501 Trustees Of Princeton University Helper-free stocks of recombinant adeno-associated virus vectors
US6268213B1 (en) 1992-06-03 2001-07-31 Richard Jude Samulski Adeno-associated virus vector and cis-acting regulatory and promoter elements capable of expressing at least one gene and method of using same for gene therapy
US6057152A (en) 1992-12-04 2000-05-02 University Of Pittsburgh Recombinant viral vector system
US6204059B1 (en) 1994-06-30 2001-03-20 University Of Pittsburgh AAV capsid vehicles for molecular transfer
US5741683A (en) 1995-06-07 1998-04-21 The Research Foundation Of State University Of New York In vitro packaging of adeno-associated virus DNA
US7439065B2 (en) 1995-06-07 2008-10-21 The University Of North Carolina At Chapel Hill Helper virus-free AAV production
US7229823B2 (en) 1997-04-14 2007-06-12 Richard Jude Samulski Methods for increasing the efficiency of recombinant AAV product
US6660514B1 (en) 1998-05-27 2003-12-09 University Of Florida Research Foundation Method of preparing recombinant adeno-associated virus compositions
US6491907B1 (en) 1998-11-10 2002-12-10 The University Of North Carolina At Chapel Hill Recombinant parvovirus vectors and method of making
US7172893B2 (en) 1998-11-10 2007-02-06 University Of North Carolina At Chapel Hill Virus vectors and methods of making and administering the same
US7125717B2 (en) 1999-08-09 2006-10-24 Targeted Genetics Corporation Metabolically activated recombinant viral vectors and methods for their preparation and use
US6596535B1 (en) 1999-08-09 2003-07-22 Targeted Genetics Corporation Metabolically activated recombinant viral vectors and methods for the preparation and use
US7201898B2 (en) 2000-06-01 2007-04-10 The University Of North Carolina At Chapel Hill Methods and compounds for controlled release of recombinant parvovirus vectors
WO2003042397A2 (fr) 2001-11-13 2003-05-22 The Trustees Of The University Of Pennsylvania Methode de detection et/ou d'identification de sequences de virus associes aux adenovirus (aav) et d'isolation de nouvelles sequences ainsi identifiees
US20130045186A1 (en) 2001-11-13 2013-02-21 The Trustees Of The University Of Pennsylvania Method of Detecting and/or Identifying Adeno-Associated Virus (AAV) Sequences and Isolating Novel Sequences Identified Thereby
US7094604B2 (en) 2002-06-05 2006-08-22 University Of Florida Research Foundation, Inc. Production of pseudotyped recombinant AAV virions
WO2005033321A2 (fr) 2003-09-30 2005-04-14 The Trustees Of The University Of Pennsylvania Variantes des virus associes aux adenovirus (aav), sequences, vecteurs les contenant, et leur utilisation
US7906111B2 (en) 2003-09-30 2011-03-15 The Trustees Of The University Of Pennsylvania Adeno-associated virus (AAV) clades, sequences, vectors containing same, and uses therefor
WO2006110689A2 (fr) 2005-04-07 2006-10-19 The Trustees Of The University Of Pennsylvania Procede d'augmentation de la fonction d'un vecteur aav
US7456683B2 (en) 2005-06-09 2008-11-25 Panasonic Corporation Amplitude error compensating device and quadrature skew error compensating device
US7588772B2 (en) 2006-03-30 2009-09-15 Board Of Trustees Of The Leland Stamford Junior University AAV capsid library and AAV capsid proteins
US20130225666A1 (en) * 2008-12-19 2013-08-29 Nationwide Children's Hospital, Inc. Delivery of polynucleotides using recombinant aav9
US8734809B2 (en) 2009-05-28 2014-05-27 University Of Massachusetts AAV's and uses thereof
WO2011126808A2 (fr) 2010-03-29 2011-10-13 The Trustees Of The University Of Pennsylvania Système d'ablation de transgène induit pharmacologiquement
US8927514B2 (en) 2010-04-30 2015-01-06 City Of Hope Recombinant adeno-associated vectors for targeted treatment
US20150344911A1 (en) 2010-04-30 2015-12-03 City Of Hope Recombinant adeno-associated vectors for targeted treatment
WO2013004943A1 (fr) 2011-07-06 2013-01-10 Gaztransport Et Technigaz Cuve etanche et thermiquement isolante integree dans une structure porteuse
US20150079038A1 (en) 2013-09-13 2015-03-19 California Institute Of Technology Selective recovery
WO2016049230A1 (fr) 2014-09-24 2016-03-31 City Of Hope Variants de vecteur de virus adénoassocié pour une édition de haute efficacité du génome et procédés correspondants
US20180339065A1 (en) 2015-10-28 2018-11-29 The Trustees Of The University Of Pennsylvania Intrathecal administration of adeno-associated-viral vectors for gene therapy
WO2017160360A2 (fr) 2015-12-11 2017-09-21 The Trustees Of The University Of Pennsylvania Méthode de purification évolutive pour virus adéno-associé 9 (aav9)
WO2018160582A1 (fr) 2017-02-28 2018-09-07 The Trustees Of The University Of Pennsylvania Vecteur de clade f de virus adéno-associé (aav) et ses utilisations
WO2018172795A1 (fr) 2017-03-24 2018-09-27 The University Court Of The University Of Edinburgh Cassettes d'expression de mecp2
WO2018226785A1 (fr) * 2017-06-06 2018-12-13 University Of Massachusetts Vecteurs aav à autorégulation pour l'expression sans risque de mecp2 dans le syndrome de rett
WO2020132455A1 (fr) 2018-12-21 2020-06-25 The Trustees Of The University Of Pennsylvania Compositions pour la réduction spécifique de drg de l'expression de transgène
WO2020219766A1 (fr) * 2019-04-24 2020-10-29 The Trustees Of The University Of Pennsylvania Compositions utiles dans le traitement du syndrome de rett
WO2020223231A1 (fr) 2019-04-29 2020-11-05 The Trustees Of The University Of Pennsylvania Nouvelles capsides de aav et compositions les contenant

Non-Patent Citations (37)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. AAS99264
"NCBI", Database accession no. NM _001110792.1
"Radically truncated MeCP2 rescues Rett syndrome-like neurological defects", NATURE, 2017
"UniProt", Database accession no. P51608-2
AMIR, R. E. ET AL.: "Rett syndrome is caused by mutations in X-linked MECP2, encoding methyl-CpG-binding protein 2", NAT GENET, vol. 23, 1999, pages 185 - 188, XP002387882, DOI: 10.1038/13810
ANDERSEN ET AL., CELL. MOL. NEUROBIOL., vol. 13, 1993, pages 503 - 15
B. J. CARTER: "Handbook of Parvoviruses", 1990, CRC PRESS, pages: 155 - 168
BHATNAGAR, S. ET AL.: "Genetic and pharmacological reactivation of the mammalian inactive X chromosome", PROC NATL ACAD SCI U S A, vol. 111, 2014, pages 12591 - 12598, XP055499258, DOI: 10.1073/pnas.1413620111
BUNING ET AL.: "Recent developments in adeno-associated virus vector technology", J. GENE MED., vol. 10, 2008, pages 717 - 733
CALCEDO, R. ET AL.: "Worldwide Epidemiology of Neutralizing Antibodies to Adeno-Associated Viruses", JOURNAL OF INFECTIOUS DISEASES, vol. 199, no. 3, 2009, pages 381 - 390
D M MCCARTY ET AL.: "Self-complementary recombinant adeno-associated virus (scAAV) vectors promote efficient transduction independently of DNA synthesis", GENE THERAPY, vol. 8, no. 16, August 2001 (2001-08-01), pages 1248 - 1254, XP002992255, DOI: 10.1038/sj.gt.3301514
DAMBAL, S. ET AL., NUCLEIC ACIDS RES, vol. 43, 2015, pages 7173 - 7188
DEVERMAN, B. E. ET AL.: "Cre-dependent selection yields AAV variants for widespread gene transfer to the adult brain", NAT BIOTECHNOL, vol. 34, 2016, pages 204 - 209, XP055328659, DOI: 10.1038/nbt.3440
G GAO ET AL., J VIROL, vol. 78, no. 10, June 2004 (2004-06-01), pages 6381 - 6388
GADALLA, K. K. E. ET AL.: "Development of a Novel AAV Gene Therapy Cassette with Improved Safety Features and Efficacy in a Mouse Model of Rett Syndrome", MOL THER METHODS CLIN DEV, vol. 5, 2017, pages 180 - 190, XP055475137, DOI: 10.1016/j.omtm.2017.04.007
GAO ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 100, no. 10, 2003, pages 6081 - 6086
GRIEGERSAMULSKI: "Adeno-associated virus as a gene therapy vector: Vector development, production and clinical applications", ADV. BIOCHEM. ENGIN/BIOTECHNOL., vol. 99, 2005, pages 119 - 145, XP009125595
GRIMM ET AL., GENE THERAPY, vol. 6, 1999, pages 1322 - 1330
GUY, J.GAN, J.SELFRIDGE, J.COBB, S.BIRD, A.: "Reversal of neurological defects in a mouse model of Rett syndrome", SCIENCE, vol. 315, 2007, pages 1143 - 1147, XP055831163, DOI: 10.1126/science.1138389
HINDERER, C. ET AL.: "Severe Toxicity in Nonhuman Primates and Piglets Following High-Dose Intravenous Administration of an Adeno-Associated Virus Vector Expressing Human SMN", HUMAN GENE THERAPY, vol. 29, 2018, pages 285 - 298, XP055532829, DOI: 10.1089/hum.2018.015
J. D. THOMSON ET AL.: "A comprehensive comparison of multiple sequence alignments", NUCL. ACIDS. RES., vol. 27, no. 13, 1999, pages 2682 - 2690
K. FISHER ET AL., J. VIROL., vol. 70, 1996, pages 520 - 532
KATZ, D. M. ET AL.: "Rett Syndrome: Crossing the Threshold to Clinical Translation", TRENDS IN NEUROSCIENCES, vol. 39, 2016, pages 100 - 113, XP029401697, DOI: 10.1016/j.tins.2015.12.008
M. LOCK ET AL., HU GENE THERAPY METHODS, HUM GENE THER METHODS, vol. 25, no. 2, 14 February 2014 (2014-02-14), pages 115 - 25
MA ZANTA-BOUSSIF ET AL., GENE THERAPY, vol. 16, 2009, pages 605 - 619
PICCIOLI ET AL., NEURON, vol. 15, 1995, pages 373 - 84
PICCIOLI ET AL., PROC. NATL. ACAD. SCI. USA, vol. 88, 1991, pages 5611 - 5
SAMBROOK ET AL.: "Molecular Cloning. A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 2012, COLD SPRING HARBOR PRESS
SARAH E. SINNETT ET AL: "Improved MECP2 Gene Therapy Extends the Survival of MeCP2-Null Mice without Apparent Toxicity after Intracisternal Delivery", MOLECULAR THERAPY- METHODS & CLINICAL DEVELOPMENT, vol. 5, 1 June 2017 (2017-06-01), GB, pages 106 - 115, XP055534097, ISSN: 2329-0501, DOI: 10.1016/j.omtm.2017.04.006 *
SINNETT, S. E. ET AL.: "Improved MECP2 Gene Therapy Extends the Survival of MeCP2-Null Mice without Apparent Toxicity after Intracisternal Delivery", MOL THER METHODS CLIN DEV, vol. 5, 2017, pages 106 - 115, XP055534097, DOI: 10.1016/j.omtm.2017.04.006
SOMMER ET AL., MOLEC. THER., vol. 7, 2003, pages 122 - 128
SRIPATHY, S. ET AL.: "Screening for reactivation of MeCP2 on the inactive X chromosome identifies the BMP/TGF-beta superfamily as a regulator of XIST expression", PROC NATL ACAD SCI USA, 2017
THIEL, G.GREENGARD, P.SIIDHOF, T. C.: "Characterization of tissue-specific transcription by the human synapsin I gene promoter", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 88, 1991, pages 3431 - 3435, XP002904375, DOI: 10.1073/pnas.88.8.3431
VASHI NEETI ET AL: "Treating Rett syndrome: from mouse models to human therapies", MAMMALIAN GENOME, SPRINGER NEW YORK LLC, US, vol. 30, no. 5, 28 February 2019 (2019-02-28), pages 90 - 110, XP036824827, ISSN: 0938-8990, [retrieved on 20190228], DOI: 10.1007/S00335-019-09793-5 *
WOBUS ET AL., J. VIROL., vol. 74, 2000, pages 9281 - 9293
ZHANG ET AL.: "Adenovirus-adeno-associated virus hybrid for large-scale recombinant adeno-associated virus production", HUMAN GENE THERAPY, vol. 20, 2009, pages 922 - 929

Similar Documents

Publication Publication Date Title
US20220202960A1 (en) Compositions useful in treatment of rett syndrome
CA3162020A1 (fr) Compositions pour le traitement de l'ataxie de friedreich
EP4048785A1 (fr) Compositions pour la réduction spécifique de drg de l'expression de transgène
US20230167455A1 (en) Compositions useful in treatment of cdkl5 deficiency disorder (cdd)
WO2018218359A1 (fr) Thérapie génique destinée au traitement de troubles des peroxysomes
WO2022094078A1 (fr) Compositions utiles dans le traitement du syndrome de rett
JP2023513487A (ja) Ｇｍ１ガングリオシドーシスを治療するのに有用な組成物
AU2020229772A1 (en) Compositions useful in treatment of krabbe disease
US20240115733A1 (en) Compositions and methods for treatment of niemann pick type a disease
WO2023069967A2 (fr) Compositions utiles dans le traitement d'un trouble du déficit en cdkl5 (cdd)
US20230210941A1 (en) Compositions useful in treatment of krabbe disease
WO2023077143A1 (fr) Compositions utiles pour traiter les troubles dus à la déficience en cdkl5 (cdd)
WO2023086928A2 (fr) Thérapie génique pour le traitement de la mucopolysaccharidose iiia
JP2024515612A (ja) 球脊髄性筋萎縮症（ｓｂｍａ）の治療に有用な組成物
JP2023534037A (ja) シャルコー・マリー・トゥース病の治療に有用な組成物
WO2023140971A1 (fr) Procédés pour le traitement du déficit en ornithine transcarbamylase (otc)
WO2023122804A1 (fr) Compositions et méthodes comprenant un promoteur spécifique du coeur

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21815740

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21815740

Country of ref document: EP

Kind code of ref document: A1