WO2022056490A1 - Chimeric antigen receptors for treatment of cancer - Google Patents
Chimeric antigen receptors for treatment of cancer Download PDFInfo
- Publication number
- WO2022056490A1 WO2022056490A1 PCT/US2021/050331 US2021050331W WO2022056490A1 WO 2022056490 A1 WO2022056490 A1 WO 2022056490A1 US 2021050331 W US2021050331 W US 2021050331W WO 2022056490 A1 WO2022056490 A1 WO 2022056490A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- seq
- cell
- car
- nucleic acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/70521—CD28, CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2896—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
Definitions
- Acute myelogenous leukemia is a highly aggressive acute leukemia, representing the second most common leukemia occurring in children and adolescents and young adults (AYAs).
- AYAs a highly aggressive acute leukemia
- current treatment regimens which include intensive cycles of multi-agent chemotherapy, and frequently consolidation with allogeneic donor stem cell transplantation to achieve cure, only 60% of children and AYAs with AML will be achieve long-term remission.
- New therapeutic strategies are needed to increase remission rates, decrease relapse and to improve overall survival.
- aspects of the present disclosure provide chimeric antigen receptors (CARs) comprising an antigen binding domain specific for CD33, a transmembrane domain, and an intracellular T cell signaling domain.
- the CARs comprise one or more additional domains, such as a linker region, a hinge region, and one or more costimulatory signaling domain.
- CAR constructs comprising any of the amino acid sequences as described herein.
- nucleic acids nucleic acids, recombinant expression vectors, host cells, populations of cells, and pharmaceutical compositions relating to the CAR constructs of the present disclosure or cells expressing such CAR constructs.
- Additional embodiments of the invention provide methods of treating a hematopoietic malignancy (e.g., acute myeloid leukemia (AML), myelodysplastic syndrome (MDS)) in a subject by administering to the subject a population of immune cells comprising a CAR specific for CD33 alone or in combination with a population of hematopoietic cells, wherein the hematopoietic cells are genetically-engineered such that the gene encoding CD33 engineered to reduce or eliminate the expression of CD33.
- a hematopoietic malignancy e.g., acute myeloid leukemia (AML), myelodysplastic syndrome (MDS)
- AML acute myeloid leukemia
- MDS myelodysplastic syndrome
- the CAR comprises a CD33 binding domain, a transmembrane domain, and an intracellular signaling domain.
- the encoded CD33 binding domain comprises a heavy chain variable region and/or a light chain variable region.
- the encoded transmembrane domain comprises a transmembrane domain of a protein selected from CD8a or CD28.
- the encoded intracellular signaling domain comprises a functional signaling domain of CD3 ⁇ .
- the CARs comprise one or more additional domains, such as a linker region, a hinge region, and one or more costimulatory signaling domain.
- the heavy chain variable region and the light chain variable region are joined by a linker.
- the encoded CD33 binding domain comprises a single-chain variable fragment (scFv), an Fab, an F(ab’)2, a dsFv, a diabody, Nanobody® (single domain antibody, also referred to as VHH), or a tiabody.
- the encoded CD33 binding domain is connected to the transmembrane domain by a hinge region.
- the encoded hinge region comprises a hinge region of a protein selected from CD8a, IgG4, or CD28.
- the encoded CAR further comprises one or more costimulatory domains.
- the one more co- stimulatory domains comprises a functional signaling domain of 4- IBB and/or CD28.
- the isolated nucleic acid sequence further comprises a promoter sequence.
- the promoter sequence is a SFFV (silencing- prone spleen focus forming virus) promoter sequence or an EFl ⁇ promoter sequence.
- the encoded CAR comprises (i) an amino acid sequence of any one of SEQ ID NOs: 10, 13, 16, 19, 22, 25, 29, 33, 36, 39, 42, 45, 48, 51, 54, 57, and 60-92; or (ii) an amino acid sequence having 95-99% identity to any one of SEQ ID NOs: 10, 13, 16, 19, 22, 25, 29, 33, 36, 39, 42, 45, 48, 51, 54, 57, and 60-92.
- the nucleic acid molecule comprises (i) a nucleotide sequence selected from any one of SEQ ID NOs: 9, 12, 15, 18, 21, 24, 28, 32, 35, 38, 41, 44, 47, 50, 53, and 56; or (ii) a nucleotide sequence with 95-99% identity to any one of SEQ ID NOs: 9, 12, 15, 18, 21, 24, 28, 32, 35, 38, 41, 44, 47, 50, 53, and 56.
- an expression vector comprising any of the nucleic acid molecules encoding any of the CARs as described herein.
- the vector is a DNA vector, an RNA vector, a plasmid, a lentivirus vector, an adenoviral vector, or a retrovirus vector.
- the expression vector comprises (i) a nucleotide sequence selected from any one of SEQ ID NOs: 11, 14, 17, 20, 23, 26, 30, 34, 37, 40, 43, 46, 49, 52, 55, and 58; or (ii) a nucleotide sequence with 95-99% identity to any one of SEQ ID NOs: 11, 14, 17, 20, 23, 26, 30, 34, 37, 40, 43, 46, 49, 52, 55, and 58; or (ii) a nucleotide sequence with 95-99% identity to any one of SEQ ID NOs: 11, 14, 17, 20, 23, 26, 30, 34, 37, 40, 43, 46, 49, 52, 55, and 58; or (ii) a nucleotide sequence with 95-99%
- the disclosure provides immune effector cells comprising any of the nucleic acid molecules as described herein.
- the disclosure provides immune effectors comprising any of the CARs as described herein.
- the cell is selected from the group consisting of a T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a human embryonic stem cell, and a pluripotent stem cell from which lymphoid cells may be differentiated.
- NK Natural Killer
- CTL cytotoxic T lymphocyte
- the present disclosure also provides populations of cells comprising at least one immune effector cell comprising any of the nucleic acid molecules as described herein.
- the present disclosure also provides populations of cells comprising at least one immune effector cell comprising any of the CARs as described herein.
- a further aspect of the disclosure provides pharmaceutical composition comprising any of the populations of immune effector cells comprising the nucleic acids and/or any of the CARs described herein and a pharmaceutically acceptable carrier.
- the disclosure features a method of treating a hematopoietic malignancy.
- the method comprises administering to a subject in need thereof an effective amount of an agent targeting CD33.
- the agent is an immune cell expressing a chimeric receptor (CAR).
- the CAR comprises: an antigen-binding domain that binds CD33 comprising a heavy chain variable region and/or a light chain variable region; a transmembrane domain comprising a transmembrane domain of a protein selected from CD8a or CD28; and an intracellular signaling domain comprising a functional signaling domain of CD3 ⁇ .
- the CARs comprise one or more additional domains, such as a linker region, a hinge region, and one or more costimulatory signaling domain.
- the method further comprises administering a population of hematopoietic cells, wherein the hematopoietic cells are genetically-engineered such that the gene encoding CD33 that is targeted by the antigen-binding domain is engineered to reduce or eliminate the expression of CD33.
- the immune cells, the hematopoietic cells, or both are allogeneic or autologous.
- the hematopoietic cells are hematopoietic stem cells.
- the hematopoietic cells are hematopoietic progenitor cells. In some embodiments, the hematopoietic cells are hematopoietic stem and progenitor cells. In some embodiments, the hematopoietic stem cells are from bone marrow cells or peripheral blood mononuclear cells (PBMCs). In some embodiments, the hematopoietic stem cells are
- the hematopoietic cells are prepared by editing the endogenous gene coding for CD33 to reduce or eliminate the expression of CD33.
- the endogenous gene is edited using a CRISPR system ⁇ e.g., by an RNA- guided nuclease, e.g., CRISPR-Cas9, CRISPR-Cas 12a).
- the subject has or has been diagnosed with a hematopoietic malignancy or pre-malignancy characterized by the expression of CD33 on malignant cells or pre-malignant cells.
- the subject has Hodgkin's lymphoma, non-Hodgkin's lymphoma, myelodysplastic syndrome, leukemia, or multiple myeloma.
- the leukemia is acute myeloid leukemia (AML), chronic myelogenous leukemia, acute lymphoblastic leukemia, chronic lymphoblastic leukemia, or myelodysplastic syndrome (MDS).
- the immune cells comprise one or more cell types selected from the group consisting of a T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a human embryonic stem cell, and a pluripotent stem cell from which lymphoid cells may be differentiated.
- a T cell a Natural Killer (NK) cell
- CTL cytotoxic T lymphocyte
- a regulatory T cell a human embryonic stem cell
- pluripotent stem cell from which lymphoid cells may be differentiated.
- the antigen-binding domain of the CAR is a singlechain variable fragment (scFv), an Fab, an F(ab’)2, a dsFv, a diabody, a Nanobody® (single domain antibody), or a triabody that specifically binds CD33.
- the heavy chain variable region and the light chain variable region of the antigen-binding domain are joined by a linker.
- the antigen-binding domain is connected to the transmembrane domain by a hinge region.
- the hinge region comprises a hinge region of a protein selected from CD8a, IgG4, or CD28.
- the CAR further comprises one or more co-stimulatory domains.
- the one more co-stimulatory domains comprises a functional signaling domain of 4- IBB and/or CD28.
- the encoded CAR comprises (i) an amino acid sequence of any one of SEQ ID NOs: 10, 13, 16, 19, 22, 25, 29, 33, 36, 39, 42, 45, 48, 51, 54, 57, and 60-92; or (ii) an amino acid sequence having 95-99% identity to any one of SEQ ID NOs: 10, 13, 16, 19, 22, 25, 29, 33, 36, 39, 42, 45, 48, 51, 54, 57, and 60-92.
- the CAR is encoded by a nucleotide sequence that is (i) selected from any one of SEQ ID NOs: 9, 12, 15, 18, 21, 24, 28, 32, 35, 38, 41, 44, 47, 50, 53, and 56; or (ii) 95- 99% identical to any one of SEQ ID NOs: 9, 12, 15, 18, 21, 24, 28, 32, 35, 38, 41, 44, 47, 50, 53, and 56.
- agent refers to a molecule that may be expressed, released, secreted or delivered to a target by a modified cell (e.g., an immune cell comprising a chimeric antigen receptor) described herein.
- a modified cell e.g., an immune cell comprising a chimeric antigen receptor
- An agent includes, but is not limited to, a nucleic acid, an antibiotic, an antiinflammatory agent, an antibody or fragments thereof, a chimeric antigen receptor, an antibody agent or fragments thereof, a growth factor, a cytokine, an enzyme, a protein (e.g., an RNAse inhibitor), a peptide, a fusion protein, a synthetic molecule, an organic molecule (e.g., a small molecule), a carbohydrate, a lipid, a hormone, a microsome, a derivative or a variation thereof, and any combinations thereof.
- An agent may bind any cell moiety, such as a receptor, an antigenic determinant, or other binding site present on a target or target cell.
- Antibody refers to a polypeptide that includes canonical immunoglobulin sequence elements sufficient to confer specific binding to a particular target antigen.
- intact antibodies as produced in nature are approximately 150 kD tetrameric agents comprising two identical heavy chain polypeptides (about 50 kD each) and two identical light chain polypeptides (about 25 kD each) that associate with each other into what is commonly referred to as a “Y-shaped” structure.
- Each heavy chain comprises at least four domains (each about 110 amino acids long) - an amino- terminal variable (VH) domain (located at the tips of the Y structure), followed by three constant domains: CHI, CH2, and the carboxy-terminal CHS (located at the base of the Y’s stem).
- VH amino- terminal variable
- CH2 amino-terminal variable
- CHS carboxy-terminal CHS
- Each light chain comprises two domains - an amino-terminal variable (VL) domain, followed by a carboxy-terminal constant (CL) domain, separated from one another by another “switch”.
- Intact antibody tetramers comprise two heavy chain-light chain dimers in which the heavy and light chains are linked to one another by a single disulfide bond; two other disulfide bonds connect the heavy chain hinge regions to one another, so that the dimers are connected to one another and a tetramer is formed.
- Naturally -produced antibodies are also glycosylated, typically on the CH2 domain.
- Each domain in a natural antibody has a structure characterized by an “immunoglobulin fold” formed from two beta sheets (e.g., 3-, 4-, or 5 -stranded sheets) packed against each other in a compressed antiparallel beta barrel.
- Each variable domain contains three hypervariable loops known as “complementarity determining regions” (CDR1, CDR2, and CDR3) and four somewhat invariant “framework” regions (FR1, FR2, FR3, and FR4).
- CDR1, CDR2, and CDR3 three hypervariable loops known as “complementarity determining regions” (CDR1, CDR2, and CDR3) and four somewhat invariant “framework” regions (FR1, FR2, FR3, and FR4).
- the Fc region of naturally-occurring antibodies binds to elements of the complement system, and also to receptors on effector cells, including, for example, effector cells that mediate cytotoxicity. Affinity and/or other binding attributes of Fc regions for Fc receptors can be modulated through glycosylation or other modification.
- antibodies produced and/or utilized in accordance with the present invention include glycosylated Fc domains, including Fc domains with modified or engineered glycosylation.
- any polypeptide or complex of polypeptides that includes sufficient immunoglobulin domain sequences as found in natural antibodies can be referred to and/or used as an “antibody”, whether such polypeptide is naturally produced (e.g., generated by an organism reacting to an antigen), or produced by recombinant engineering, chemical synthesis, or other artificial system or methodology.
- an antibody is polyclonal.
- an antibody is monoclonal.
- an antibody has constant region sequences that are characteristic of mouse, rabbit, primate, or human antibodies.
- antibody sequence elements are humanized, primatized, chimeric, etc, as is known in the art.
- the term “antibody”, as used herein can refer in appropriate embodiments (unless otherwise stated or clear from context) to any of the art-known or developed constructs or formats for utilizing antibody structural and functional features in alternative presentation.
- an antibody utilized in accordance with the present invention is in a format selected from, but not limited to, intact IgA, IgG, IgE or IgM antibodies; bi- or multi- specific antibodies (e.g., Zybodies®, etc); antibody fragments such as is used herein in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and/or antibody fragments (preferably those fragments that exhibit the desired antigen-binding activity).
- An antibody described herein can be an immunoglobulin, heavy chain antibody, light chain antibody, LRR-based antibody, or other protein scaffold with antibody-like properties, as well as other immunological binding moiety known in the art, including, e.g., a Fab, Fab', Fab'2, Fab2, Fab3, F(ab’)2 , Fd, Fv, Feb, scFv, SMIP, antibody, diabody, triabody, tetrabody, minibody, nanobody (single domain antibody, VHH), maxibody, tandab, DVD, BiTe, TandAb, or the like, or any combination thereof.
- the subunit structures and three-dimensional configurations of different classes of antibodies are known in the art.
- an antibody may lack a covalent modification (e.g., attachment of a glycan) that it would have if produced naturally.
- an antibody may contain a covalent modification (e.g., attachment of a glycan, a payload (e.g., a detectable moiety, a therapeutic moiety, a catalytic moiety, etc), or other pendant group (e.g., poly-ethylene glycol, etc.).
- Antigen-binding fragment refers to a portion of an intact antibody that binds the antigen to which the intact antibody binds.
- An antigenbinding fragment of an antibody includes any naturally occurring, enzymatically obtainable, synthetic, or genetically engineered polypeptide or glycoprotein that specifically binds an antigen to form a complex.
- Exemplary antibody fragments include, but are not limited to, Fv, Fab, Fab', Fab'-SH, F(ab')2; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv or VHH or VH or VL domains only); and multispecific antibodies formed from antibody fragments.
- the antigen-binding fragments of the antibodies described herein are scFvs. In some embodiments, the antigen-binding fragments of the antibodies described herein are VHH domains only. As with full antibody molecules, antigen-binding fragments may be mono- specific or multispecific (e.g., bispecific). A multispecific antigen-binding fragment of an antibody may comprise at least two different variable domains, wherein each variable domain is capable of specifically binding to a separate antigen or to a different epitope of the same antigen.
- Antibody heavy chain refers to the larger of the two types of polypeptide chains present in all antibody molecules in their naturally occurring conformations.
- Antibody light chain As used herein, the term “antibody light chain” refers to the smaller of the two types of polypeptide chains present in all antibody molecules in their naturally occurring conformations.
- Synthetic antibody refers to an antibody that is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage or yeast as described herein.
- the term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using synthetic DNA or amino acid sequence technology which is available and well known in the art.
- Antigen refers to a molecule that is capable of provoking an immune response. This immune response may involve either antibody production, the activation of specific immunologically-competent cells, or both. A skilled artisan will understand that any macromolecule, including virtually all proteins or peptides, can serve as an antigen. Furthermore, antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA that comprises a nucleotide sequences or a partial nucleotide sequence encoding a protein that elicits an immune response encodes an “antigen” as that term is used herein.
- an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the present invention includes, but is not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences are arranged in various combinations to elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a “gene” at all. It is readily apparent that an antigen can be generated synthesized or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a tumor sample, a cell or a biological fluid.
- Autologous refers to any material (e.g., a population of cells) derived from an individual to which it is later to be re-introduced into the same individual.
- Allogeneic refers to any material (e.g., a population of cells) derived from a different animal of the same species.
- Xenogeneic refers to any material (e.g., a population of cells) derived from an animal of a different species.
- cancer refers to a disease characterized by the rapid and uncontrolled growth of aberrant cells. Cancer cells can spread locally or through the bloodstream and lymphatic system to other parts of the body. Examples of various cancers include but are not limited to, breast cancer, prostate cancer, ovarian cancer, cervical cancer, skin cancer, pancreatic cancer, colorectal cancer, renal cancer, liver cancer, brain cancer, lymphoma, leukemia, lung cancer and the like. In certain embodiments, the cancer is medullary thyroid carcinoma.
- Conservative sequence modifications refers to amino acid modifications that do not significantly affect or alter the binding characteristics of an antibody containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody compatible with various embodiments by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are ones in which an amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art.
- amino acids with basic side chains e.g., lysine, arginine, histidine
- acidic side chains e.g., aspartic acid, glutamic acid
- uncharged polar side chains e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan
- nonpolar side chains e.g., alanine, valine, leucine, isoleucine, praline, phenylalanine, methionine
- beta-branched side chains e.g., threonine, valine, isoleucine
- aromatic side chains e.g., tyrosine, phenylalanine, tryptophan, histidine
- Co-stimulatory ligand refers to a molecule on an antigen presenting cell (e.g., an APC, dendritic cell, B cell, and the like) that specifically binds a cognate co- stimulatory molecule on an immune cell (e.g., a T lymphocyte), thereby providing a signal which mediates an immune cell response, including, but not limited to, proliferation, activation, differentiation, and the like.
- an antigen presenting cell e.g., an APC, dendritic cell, B cell, and the like
- an immune cell e.g., a T lymphocyte
- a co-stimulatory ligand can include, but is not limited to, CD7, B7-1 (CD80), B7-2 (CD86), CD28, PD-L1, PD-L2, 4-1BBL, OX40L, inducible costimulatory ligand (ICOS-L), intercellular adhesion molecule (ICAM), CD30L, CD40, CD70, CD83, HLA-G, MICA, MICE, HVEM, lymphotoxin beta receptor, 3/TR6, ILT3, ILT4, HVEM, an agonist or antibody that binds Toll ligand receptor and a ligand that specifically binds with B7-H3.
- a co- stimulatory ligand also encompasses, inter alia, an antibody that specifically binds with a co-stimulatory molecule present on an immune cell (e.g., a T lymphocyte), such as, but not limited to, CD27, CD28, 4-1BB, 0X40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds with CD83.
- an immune cell e.g., a T lymphocyte
- Cytotoxic refers to killing or damaging cells.
- cytotoxicity of the metabolically enhanced cells is improved, e.g. increased cytolytic activity of immune cells (e.g., T lymphocytes).
- cytotoxicity of the cells described herein i.e., cells expressing the CARs described herein
- cytotoxicity of the cells described herein is improved, e.g. increased cytolytic activity of immune cells (e.g., T lymphocytes).
- cytotoxicity of the cells described herein i.e., cells expressing the CARs described herein
- a target cell expressing an CD33 is improved, e.g increased cytolytic activity of immune cells (e.g., T lymphocytes).
- an “effective amount” as described herein refers to a dose that is adequate to prevent or treat cancer in an individual. Amounts effective for a therapeutic or prophylactic use will depend on, for example, the stage and severity of the disease or disorder being treated, the age, weight, and general state of health of the patient, and the judgment of the prescribing physician. The size of the dose will also be determined by the active selected, method of administration, timing and frequency of administration, the existence, nature, and extent of any adverse side-effects that might accompany the administration of a particular active, and the desired physiological effect.
- an exemplary dose of host cells may be a minimum of one million cells (l x 10 6 cells/dose).
- the amount or dose of an agent comprising an immune cell containing a CAR construct described herein administered should be sufficient to effect a therapeutic or prophylactic response in the subject or animal over a reasonable time frame.
- the dose should be sufficient to bind to antigen, or detect, treat or prevent cancer, a hematopoietic malignancy or premalignancy, in a period of from about 2 hours or longer, e.g., about 12 to about 24 or more hours, from the time of administration. In certain embodiments, the time period could be even longer.
- the dose will be determined by the efficacy of the particular CARs described herein and the condition of the animal (e.g., human), as well as the body weight of the animal (e.g., human) to be treated.
- effector function refers to a specific activity carried out by an immune cell in response to stimulation of the immune cell.
- effector function of a T lymphocyte includes, recognizing an antigen and killing a cell that expresses the antigen.
- Encoding refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom.
- a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system.
- Both the coding strand the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
- Endogenous refers to any material from or produced inside a particular organism, cell, tissue or system.
- Exogenous refers to any material introduced from or produced outside a particular organism, cell, tissue or system.
- the term “expand” refers to increasing in number, as in an increase in the number of cells, for example, immune cells, e.g., T lymphocytes, and/or hematopoietic cells.
- immune cells e.g., T lymphocytes, NK cells, and/or hematopoietic cells that are expanded ex vivo increase in number relative to the number originally present in a culture.
- immune cells e.g., T lymphocytes, NK cells, and/or hematopoietic cells that are expanded ex vivo increase in number relative to other cell types in a culture.
- expansion may occur in vivo.
- the term "ex vivo," as used herein, refers to cells that have been removed from a living organism, (e.g., a human) and propagated outside the organism (e.g., in a culture dish, test tube, or bioreactor).
- a gene product can be a transcript.
- a gene product can be a polypeptide.
- expression of a nucleic acid sequence involves one or more of the following: (1) production of an RNA template from a DNA sequence ⁇ e.g., by transcription); (2) processing of an RNA transcript (e.g., by splicing, editing, 5’ cap formation, and/or 3’ end formation); (3) translation of an RNA into a polypeptide or protein; and/or (4) post-translational modification of a polypeptide or protein.
- Expression vector refers to a vector comprising a recombinant polynucleotide comprising expression control sequences operatively linked to a nucleotide sequence to be expressed.
- An expression vector comprises sufficient cis-acting elements for expression; other elements for expression can be supplied by the host cell or in an in vitro expression system.
- Expression vectors include all those known in the art, such as cosmids, plasmids (e.g., naked or contained in liposomes) and viruses (e.g., lentiviruses, retroviruses, adenoviruses, and adeno-associated viruses).
- fragment refers to a structure that includes a discrete portion of the whole, but lacks one or more moieties found in the whole structure. In some embodiments, a fragment consists of such a discrete portion. In some embodiments, a fragment consists of or comprises a characteristic structural element or moiety found in the whole.
- a nucleotide fragment comprises or consists of at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, or more monomeric units (e.g., nucleic acids) as found in the whole nucleotide.
- a nucleotide fragment comprises or consists of at least about 5%, 10%, 15%,
- the whole material or entity may in some embodiments be referred to as the “parent” of the whole.
- Functional portion when used in reference to a CAR refers to any part or fragment of the CAR constructs of the invention, which part or fragment retains the biological activity of the CAR construct of which it is a part (the parent CAR construct).
- Functional portions encompass, for example, those parts of a CAR construct that retain the ability to recognize target cells, or detect, treat, or prevent cancer, such as a hematopoietic malignancy or pre-malignancy, to a similar extent, the same extent, or to a higher extent, as the parent CAR construct.
- the functional portion can comprise, for instance, about 10%, about 25%, about 30%, about 50%, about 68%, about 80%, about 90%, about 95%, or more, of the parent CAR.
- the functional portion can comprise additional amino acids at the amino or carboxy terminus of the portion, or at both termini, which additional amino acids are not found in the amino acid sequence of the parent CAR construct.
- the additional amino acids do not interfere with the biological function of the functional portion, e.g., recognize target cells, detect cancer, treat or prevent a cancer, such as hematopoietic malignancy or pre-malignancy, etc. More desirably, the additional amino acids enhance the biological activity as compared to the biological activity of the parent CAR construct.
- Functional variant refers to a CAR construct, polypeptide, or protein having substantial or significant sequence identity or similarity to a parent CAR construct, which functional variant retains the biological activity of the CAR of which it is a variant.
- Functional variants encompass, for example, those variants of the CAR construct described herein (the parent CAR construct) that retain the ability to recognize target cells to a similar extent, the same extent, or to a higher extent, as the parent CAR construct.
- the functional variant can, for instance, be at least about 30%, about 50%, about 75%, about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or more identical in amino acid sequence to the parent CAR construct.
- a functional variant can, for example, comprise the amino acid sequence of the parent CAR with at least one conservative amino acid substitution.
- the functional variants can comprise the amino acid sequence of the parent CAR construct with at least one non-conservative amino acid substitution.
- the non-conservative amino acid substitution may enhance the biological activity of the functional variant, such that the biological activity of the functional variant is increased as compared to the parent CAR construct.
- homology refers to the overall relatedness between polymeric molecules, e.g., between nucleic acid molecules (e.g., DNA molecules and/or RNA molecules) and/or between polypeptide molecules.
- polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical.
- polymeric molecules are considered to be “homologous” to one another if their sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar (e.g., containing residues with related chemical properties at corresponding positions).
- sequences are at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% similar (e.g., containing residues with related chemical properties at corresponding positions).
- a variety of algorithms are available that permit comparison of sequences in order to determine their degree of homology, including by permitting gaps of designated length in one sequence relative to another when considering which residues “correspond” to one another in different sequences.
- Calculation of the percent homology between two nucleic acid sequences can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and noncorresponding sequences can be disregarded for comparison purposes).
- the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or substantially 100% of the length of the reference sequence.
- the nucleotides at corresponding nucleotide positions are then compared.
- the percent homology between the two sequences is a function of the number of identical and similar positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. As will be evident to one of ordinary skill in the art, the percent homology may be assessed across the full length of the amino acid or nucleic acid sequences, or a portion thereof ( e.g ., one or more domains or regions).
- Identity refers to the subunit sequence identity between two polymeric molecules particularly between two amino acid molecules, such as, between two polypeptide molecules. When two amino acid sequences have the same residues at the same positions; e.g., if a position in each of two polypeptide molecules is occupied by an Arginine, then they are identical at that position. The identity or extent to which two amino acid sequences have the same residues at the same positions in an alignment is often expressed as a percentage.
- the identity between two amino acid sequences is a direct function of the number of matching or identical positions; e.g., if half (e.g., five positions in a polymer ten amino acids in length) of the positions in two sequences are identical, the two sequences are 50% identical; if 90% of the positions (e.g., 9 of 10), are matched or identical, the two amino acids sequences are 90% identical.
- the percent identity may be assessed across the full length of the amino acid or nucleic acid sequences, or a portion thereof (e.g., one or more domains or regions).
- nucleic acid sequences As used herein, the term “substantial identity” refers to a comparison between amino acid or nucleic acid sequences. As will be appreciated by those of ordinary skill in the art, two sequences are generally considered to be “substantially identical” if they contain identical residues in corresponding positions. As is well known in this art, amino acid or nucleic acid sequences may be compared using any of a variety of algorithms, including those available in commercial computer programs such as BLASTN for nucleotide sequences and BLASTP, gapped BLAST, and PSI-BLAST for amino acid sequences. In some embodiments, two sequences are considered to be substantially identical if at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%,
- the relevant stretch is a complete sequence. In some embodiments, the relevant stretch is at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60,
- reference to “substantial identity” typically refers to a CDR having an amino acid sequence at least 80%, preferably at least 85%, at least 90%, at least 95%, at least 98% or at least 99% identical to that of a reference CDR.
- Immune cell ⁇ refers to a cell that is involved in an immune response, e.g., promotion of an immune response.
- immune cells include, but are not limited to, T-lymphocytes, natural killer (NK) cells, macrophages, monocytes, dendritic cells, neutrophils, eosinophils, mast cells, platelets, large granular lymphocytes, Langerhans' cells, or B -lymphocytes.
- a source of immune cells e.g., T lymphocytes
- Immune response refers to a cellular and/or systemic response to an antigen that occurs when lymphocytes identify antigenic molecules as foreign and induce the formation of antibodies and/or activate lymphocytes to remove the antigen.
- Immunoglobulin refers to a class of proteins that function as antibodies. Antibodies expressed by B cells are sometimes referred to as a BCR (B cell receptor) or antigen receptor. The five members included in this class of proteins are IgA, IgG, IgM, IgD, and IgE.
- IgA is the primary antibody that is present in body secretions, such as saliva, tears, breast milk, gastrointestinal secretions and mucus secretions of the respiratory and genitourinary tracts.
- IgG is the most common circulating antibody.
- IgM is the main immunoglobulin produced in the primary immune response in most subjects.
- IgD is an immunoglobulin that has no known antibody function, but may serve as an antigen receptor.
- IgE is an immunoglobulin that mediates immediate hypersensitivity by causing release of mediators from mast cells and basophils upon exposure to allergen.
- Isolated refers to something altered or removed from the natural state.
- a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.”
- An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
- Modified refers to a changed state or structure of a molecule or cell of the invention.
- Molecules may be modified in many ways, including chemically, structurally, and functionally.
- Cells may be modified through the introduction of nucleic acids.
- Modulating refers to mediating a detectable increase or decrease in the level of a response and/or a change in the nature of a response in a subject compared with the level and/or nature of a response in the subject in the absence of a treatment or compound, and/or compared with the level and/or nature of a response in an otherwise identical but untreated subject.
- the term encompasses perturbing and/or affecting a native signal or response thereby mediating a beneficial therapeutic response in a subject, preferably, a human.
- a “monoclonal antibody” or “mAh” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies (e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation), such variants generally being present in minor amounts.
- polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- nucleic acid refers to a polymer of at least three nucleotides.
- a nucleic acid comprises DNA.
- a nucleic acid comprises RNA.
- a nucleic acid is single stranded.
- a nucleic acid is double stranded.
- a nucleic acid comprises both single and double stranded portions.
- a nucleic acid comprises a backbone that comprises one or more phosphodiester linkages.
- a nucleic acid comprises a backbone that comprises both phosphodiester and non-phosphodiester linkages.
- a nucleic acid may comprise a backbone that comprises one or more phosphorothioate or 5'-N -phosphoramidite linkages and/or one or more peptide bonds, e.g., as in a “peptide nucleic acid”.
- a nucleic acid comprises one or more, or all, natural residues ⁇ e.g., adenine, cytosine, deoxyadenosine, deoxycytidine, deoxyguanosine, deoxythymidine, guanine, thymine, uracil).
- a nucleic acid comprises one or more, or all, nonnatural residues.
- a non-natural residue comprises a nucleoside analog (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3 -methyl adenosine,
- a nucleoside analog e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3 -methyl adenosine
- a non-natural residue comprises one or more modified sugars (e.g., 2'-fluororibose, ribose, 2'-deoxyribose, arabinose, and hexose) as compared to those in natural residues.
- a nucleic acid has a nucleotide sequence that encodes a functional gene product such as an RNA or polypeptide.
- a nucleic acid has a nucleotide sequence that comprises one or more intrans.
- a nucleic acid may be prepared by isolation from a natural source, enzymatic synthesis (e.g., by polymerization based on a complementary template, e.g., in vivo or in vitro, reproduction in a recombinant cell or system, or chemical synthesis.
- a nucleic acid is at least 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 110, 120, 130,
- operably linked refers to functional linkage between, for example, a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter.
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence.
- operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
- Polynucleotide refers to a chain of nucleotides.
- nucleic acids are polymers of nucleotides.
- nucleic acids and polynucleotides as used herein are interchangeable.
- nucleic acids are polynucleotides, which can be hydrolyzed into the monomeric “nucleotides.” The monomeric nucleotides can be hydrolyzed into nucleosides.
- polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any means available in the art, including, without limitation, recombinant means, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and polymerase chain reaction (PCR) methods, and the like, and by synthetic means.
- recombinant means i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and polymerase chain reaction (PCR) methods, and the like, and by synthetic means.
- Polypeptide refers to any polymeric chain of residues (e.g., amino acids) that are typically linked by peptide bonds.
- a polypeptide has an amino acid sequence that occurs in nature.
- a polypeptide has an amino acid sequence that does not occur in nature.
- a polypeptide has an amino acid sequence that is engineered in that it is designed and/or produced through action of the hand of man.
- a polypeptide may comprise or consist of natural amino acids, non-natural amino acids, or both.
- a polypeptide may comprise or consist of only natural amino acids or only non-natural amino acids.
- a polypeptide may comprise D-amino acids, L-amino acids, or both. In some embodiments, a polypeptide may comprise only D-amino acids. In some embodiments, a polypeptide may comprise only L-amino acids. In some embodiments, a polypeptide may include one or more pendant groups or other modifications, e.g., modifying or attached to one or more amino acid side chains, at the polypeptide’s N-terminus, at the polypeptide’s C-terminus, or any combination thereof. In some embodiments, such pendant groups or modifications may be selected from the group consisting of acetylation, amidation, lipidation, methylation, pegylation, etc., including combinations thereof.
- a polypeptide may be cyclic, and/or may comprise a cyclic portion. In some embodiments, a polypeptide is not cyclic and/or does not comprise any cyclic portion. In some embodiments, a polypeptide is linear. In some embodiments, a polypeptide may be or comprise a stapled polypeptide. In some embodiments, the term “polypeptide” may be appended to a name of a reference polypeptide, activity, or structure; in such instances it is used herein to refer to polypeptides that share the relevant activity or structure and thus can be considered to be members of the same class or family of polypeptides.
- exemplary polypeptides within the class whose amino acid sequences and/or functions are known; in some embodiments, such exemplary polypeptides are reference polypeptides for the polypeptide class or family.
- a member of a polypeptide class or family shows significant sequence homology or identity with, shares a common sequence motif (e.g., a characteristic sequence element) with, and/or shares a common activity (in some embodiments at a comparable level or within a designated range) with a reference polypeptide of the class; in some embodiments with all polypeptides within the class).
- a member polypeptide shows an overall degree of sequence homology or identity with a reference polypeptide that is at least about 30-40%, and is often greater than about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more and/or includes at least one region (e.g., a conserved region that may in some embodiments be or comprise a characteristic sequence element) that shows very high sequence identity, often greater than 90% or even 95%, 96%, 97%, 98%, or 99%.
- a conserved region that may in some embodiments be or comprise a characteristic sequence element
- Such a conserved region usually encompasses at least 3-4 and often up to 20 or more amino acids; in some embodiments, a conserved region encompasses at least one stretch of at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more contiguous amino acids.
- a useful polypeptide may comprise or consist of a fragment of a parent polypeptide.
- a useful polypeptide as may comprise or consist of a plurality of fragments, each of which is found in the same parent polypeptide in a different spatial arrangement relative to one another than is found in the polypeptide of interest (e.g., fragments that are directly linked in the parent may be spatially separated in the polypeptide of interest or vice versa, and/or fragments may be present in a different order in the polypeptide of interest than in the parent), so that the polypeptide of interest is a derivative of its parent polypeptide.
- Protein refers to a polypeptide (i.e., a string of at least two amino acids linked to one another by peptide bonds). Proteins may include moieties other than amino acids ⁇ e.g., may be glycoproteins, proteoglycans, etc.) and/or may be otherwise processed or modified. Those of ordinary skill in the art will appreciate that a “protein” can be a complete polypeptide chain as produced by a cell (with or without a signal sequence), or can be a characteristic portion thereof. Those of ordinary skill will appreciate that a protein can sometimes include more than one polypeptide chain, for example linked by one or more disulfide bonds or associated by other means.
- Polypeptides may contain L- amino acids, D-amino acids, or both and may contain any of a variety of amino acid modifications or analogs known in the art. Useful modifications include, e.g., terminal acetylation, amidation, methylation, etc.
- proteins may comprise natural amino acids, non-natural amino acids, synthetic amino acids, and combinations thereof.
- the term “peptide” is generally used to refer to a polypeptide having a length of less than about 100 amino acids, less than about 50 amino acids, less than 20 amino acids, or less than 10 amino acids.
- proteins are antibodies, antibody fragments, biologically active portions thereof, and/or characteristic portions thereof.
- Signal transduction pathway refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
- cell surface receptor includes molecules and complexes of molecules capable of receiving a signal and transmitting signal across the plasma membrane of a cell.
- Single chain antibodies refers to antibodies formed by recombinant DNA techniques in which immunoglobulin heavy and light chain fragments are linked to the Fv region via an engineered span of amino acids.
- Various methods of generating single chain antibodies are known, including those described in U.S. Pat. No. 4,694,778; Bird (1988) Science 242:423-442; Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883; Ward et al. (1989) Nature 334:54454; Skerra et al. (1988) Science 242:1038-1041.
- an antigen binding domain such as an antibody agent
- an antigen binding domain or antibody agent which recognizes a specific antigen, but does not substantially recognize or bind other molecules in a sample.
- an antigen binding domain or antibody agent that specifically binds to an antigen from one species may also bind to that antigen from one or more species. But, such cross-species reactivity does not itself alter the classification of an antigen binding domain or antibody agent as specific.
- an antigen binding domain or antibody agent that specifically binds to an antigen may also bind to different allelic forms of the antigen.
- the terms “specific binding” or “specifically binding,” can be used in reference to the interaction of an antigen binding domain or antibody agent, a protein, or a peptide with a second chemical species, to mean that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antigen binding domain or antibody agent recognizes and binds to a specific protein structure rather than to proteins generally.
- an antigen binding domain or antibody agent is specific for epitope “A”
- the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled “A” and the antigen binding domain or antibody agent will reduce the amount of labeled A bound to the antibody.
- “Specifically binds,” with respect to ligand such as CD33 -binding fragment thereof, and its respective receptor refers to an antigen binding domain that does not substantially recognize or bind other molecules in a sample, such as other antigens.
- Subject refers to an organism, for example, a mammal (e.g., a human, a non-human mammal, a non-human primate, a primate, a laboratory animal, a mouse, a rat, a hamster, a gerbil, a cat, or a dog).
- a mammal e.g., a human, a non-human mammal, a non-human primate, a primate, a laboratory animal, a mouse, a rat, a hamster, a gerbil, a cat, or a dog.
- a human subject is an adult, adolescent, or pediatric subject.
- a subject is suffering from a disease, disorder or condition, e.g., a disease, disorder, or condition that can be treated as provided herein, e.g., a cancer, such ss a hematopoietic malignancy or premalignancy.
- a subject is susceptible to a disease, disorder, or condition; in some embodiments, a susceptible subject is predisposed to and/or shows an increased risk (as compared to the average risk observed in a reference subject or population) of developing the disease, disorder, or condition.
- a subject displays one or more symptoms of a disease, disorder, or condition.
- a subject does not display a particular symptom (e.g., clinical manifestation of disease) or characteristic of a disease, disorder, or condition. In some embodiments, a subject does not display any symptom or characteristic of a disease, disorder, or condition. In some embodiments, a subject is a patient. In some embodiments, a subject is an individual to whom diagnosis and/or therapy is and/or has been administered. In some embodiments, the subject has been diagnosed with the disease, disorder, or condition.
- a particular symptom e.g., clinical manifestation of disease
- a subject does not display any symptom or characteristic of a disease, disorder, or condition.
- a subject is a patient. In some embodiments, a subject is an individual to whom diagnosis and/or therapy is and/or has been administered. In some embodiments, the subject has been diagnosed with the disease, disorder, or condition.
- substantially purified refers to a cell that is essentially free of other cell types.
- a substantially purified cell also refers to a cell which has been separated from other cell types with which it is normally associated in its naturally occurring state.
- a population of substantially purified cells refers to a homogenous population of cells. In other instances, this term refers simply to cell that have been separated from the cells with which they are naturally associated in their natural state.
- the cells are cultured in vitro. In other embodiments, the cells are not cultured in vitro.
- Target refers to a cell, tissue, organ, or site within the body that is the subject of provided methods, systems, and /or compositions, for example, a cell, tissue, organ or site within a body that is in need of treatment or is preferentially bound by, for example, an antibody (or fragment thereof) or a CAR.
- Target site refers to a genomic nucleic acid sequence that defines a portion of a nucleic acid to which a binding molecule (e.g., an antigen-binding domain of a CAR, e.g., a CD33 binding fragment of any of the CARs described herein) may specifically bind under conditions sufficient for binding to occur.
- a binding molecule e.g., an antigen-binding domain of a CAR, e.g., a CD33 binding fragment of any of the CARs described herein
- T cell receptor refers to a complex of membrane proteins that participate in the activation of T cells in response to the presentation of antigen.
- a TCR is responsible for recognizing antigens bound to major histocompatibility complex molecules.
- a TCR comprises a heterodimer of an alpha (a) and beta ( ⁇ ) chain, although in some cells the TCR comprises gamma and delta ( ⁇ / ⁇ ) chains.
- TCRs may exist in alpha/beta and gamma/delta forms, which are structurally similar but have distinct anatomical locations and functions. Each chain comprises two extracellular domains, a variable and constant domain.
- a TCR may be modified on any cell comprising a TCR, including, for example, a helper T cell, a cytotoxic T cell, a memory T cell, regulatory T cell, natural killer T cell, and gamma delta T cell.
- therapeutic refers to a treatment.
- a therapeutic effect is obtained by suppression, remission, or eradication of a disease state.
- a therapeutic effect may be obtained by prevention (prophylaxis).
- Transfected As used herein, the term “transfected” or “transformed” or “transduced” refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell.
- a “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
- Treat As used herein, the term “treat, 99 66 treatment,” or “treating” refers to partial or complete alleviation, amelioration, delay of onset of, inhibition, relief, and/or reduction in incidence and/or severity of one or more symptoms or features of a disease, disorder, and/or condition.
- treatment may be administered to a subject who does not exhibit signs or features of a disease, disorder, and/or condition (e.g., may be prophylactic). In some embodiments, treatment may be administered to a subject who exhibits only early or mild signs or features of the disease, disorder, and/or condition, for example for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition. In some embodiments, treatment may be administered to a subject who exhibits established, severe, and/or late-stage signs of the disease, disorder, or condition.
- treating may comprise administering to an immune cell (e.g., a T lymphocyte, NK cell) or contacting an immune cell with a modulator of a pathway activated by in vitro transcribed mRNA.
- an immune cell e.g., a T lymphocyte, NK cell
- the methods described herein are for prevention of a disease, disorder, and/or condition or one or more symptoms or features of a disease, disorder, and/or condition.
- Tumor refers to an abnormal growth of cells or tissue.
- a tumor may comprise cells that are precancerous ⁇ e.g., benign), malignant, pre-metastatic, metastatic, and/or non-metastatic.
- a tumor is associated with, or is a manifestation of, a cancer.
- a tumor may be a disperse tumor or a liquid tumor.
- a tumor may be a solid tumor.
- Vector refers to a composition of matter that comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell.
- vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compounds, plasmids, and viruses.
- the term “vector” includes an autonomously replicating plasmid or a virus.
- the term should also be construed to include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, polylysine compounds, liposomes, and the like.
- viral vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, lentiviral vectors, and the like.
- range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range.
- FIGs. 1A-1C show flow cytometry analysis plots of exemplary reporter cells as described herein.
- FIG. 1 A shows Jurkat cells containing the mOrange reporter molecule under control of the constitutively active ElFalpha promoter and mTurquoise reporter molecule (mTurq) under control of an IL-2 reporter system described herein. Cells were either not activated (“-PMA/Ion,” top row) or activated using phorbol myristate acetate (PM A) and ionomycin (“+PMA/Ion,” bottom row).
- FIG. IB show Jurkat cells containing the mTurquoise reporter molecule (mTurq) under control of the constitutively active ElFalpha promoter and mOrange reporter molecule under control of an IL-2 reporter system described herein. Cells were either not activated (“-PMA/Ion,” top row) or activated using phorbol myristate acetate (PM A) and ionomycin (“+PMA/Ion,” bottom row).
- FIG. 1C shows a plot of quantification flow cytometric analysis of FIGs. 1A and IB.
- the y-axis shows the percentage of cells expressing the second reporter molecule (FP2), which was under control of an IL-2 reporter system described herein, based on the cells expressing the first reporter molecule (FP1), which was under control of the constitutively active promoter EFl ⁇ .
- EFl ⁇ _mOrange_IL-2_mTurq refers to Jurkat cells containing the mOrange reporter molecule under control of the constitutively active ElFalpha promoter (FP1) and mTurquoise reporter molecule (mTurq) under control of an IL 2 reporter system described herein (FP2)
- FP1 constitutively active ElFalpha promoter
- mTurq mTurquoise reporter molecule
- FP2 IL 2 reporter system described herein
- EFl ⁇ _mTurq_IL-2_mOrange refers to Jurkat cells containing the mTurquoise reporter molecule under control of the constitutively active ElFalpha promoter (FP1) and mOrange reporter molecule under control of an IL-2 reporter system described herein (FP2).
- FIG. 2 shows a graph of the fold increase in IL-2 inducible fluorescent protein (FP2; either mTurq in black or mOrange in light gray) upon exposure of Jurkat cells to MOLM13 CD33 -expressing cells, where the Jurkat cells express the indicated CAR or costimulatory protein.
- FP2 IL-2 inducible fluorescent protein
- FIG. 3 shows a graph of the absolute change in IL-2 inducible fluorescence ( ⁇ 2) (either mTurq in black or mOrange in light gray) upon exposure of Jurkat cells to MOLM13 CD33 -expressing cells, where the Jurkat cells express the indicated CAR or costimulatory protein.
- FIGs. 4A and 4B show schematics of exemplary genetic constructs containing reporter molecules under control of the constitutive activate EF-la promote
- FIG. 4A shows mOrange under control of the constitutive activate EF-la promoter.
- FIG. 4A shows mTurquoise under control of the constitutive activate EF-la promoter.
- FIGs. 5A and 5B show schematics of exemplary genetic constructs of the IL-2 reporter systems described herein.
- FIG. 5A shows the mOrange reporter molecule under control of a minimal NFAT-responsive promoter containing 6 NEAT binding sites and a minimal IL-2 promoter (“minP”) and the mTurquoise reporter molecule (mTurq) under control of the constitutively active ElFalpha promoter.
- FIG. 5B shows the mTurquoise reporter molecule under control of a minimal NFAT-responsive promoter containing 6 NEAT binding sites and a minimal IL-2 promoter (“minP”) and the mOrange reporter molecule under control of the constitutively active ElFalpha promoter.
- minP minimal NFAT-responsive promoter containing 6 NEAT binding sites and a minimal IL-2 promoter
- minP minimal IL-2 promoter
- chimeric antigen receptors e.g. , also referred to herein as CARs
- CARs chimeric antigen receptors
- the CARs described herein further comprise any one or more of a hinge domain linker region, and a costimulatory signaling domain.
- nucleic acid constructs and vectors encoding any of the CARs described herein.
- cells e.g., immune cells such as T lymphocytes or NK cells
- the present disclosure provides, in some embodiments, administration of a CAR, a nucleic acid or vector encoding the CAR, or a population of cells that express the CAR to treat a disease or disorder, such as a hematopoietic malignancy or premalignancy.
- the present disclosure provides methods for treating a disease, disorder, or condition that is characterized by the expression of CD33 on malignant or pre-malignant cells.
- the methods involve administering any of the CARs described herein, which target and bind CD33 through a CD33 binding domain.
- Acute Myeloid Leukemia is an aggressive malignancy that is normally treated using intensive cytotoxic chemotherapeutic regimens with limited alternative therapeutic options when the disease becomes refractory to cytotoxic chemotherapy.
- Acute myeloid leukemia is a cancer of the bone marrow that needs more effective therapies. According to the National Cancer Institute, more than 60,000 people in the U.S. have AML, and less than 30% of patients survive five years following diagnosis.
- CD33 also known as Siglec (Sialic-acid-binding immunoglobulin-like lectin) plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state.
- CD33 preferentially recognizes and binds alpha-2,3- and more avidly alpha-2, 6-linked sialic acid-bearing glycans and upon engagement of ligands such as Clq or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in the cytoplasmic tail of CD33 are phosphorylated by Src-like kinases such as LCK.
- ITIMs immunoreceptor tyrosine-based inhibitory motifs
- phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2.
- these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules.
- One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PBK.
- CD33 is expressed on the surface of the vast majority of AML blasts and chronic myeloid leukemia in blast crisis. It is also aberrantly expressed on a subset of T cell acute lymphoblastic leukemias. Normal tissue expression is restricted to normal myeloid cells. Currently, treating AML with a therapy that targets CD33 can be effective, but the therapy may be limited in utility due to toxicity to the normal blood and bone marrow.
- a CAR of the present disclosure comprises an anti-CD33 antigen-binding domain comprising, consisting of, or consisting essentially of, a single chain variable fragment (scFv) of an antigen-binding domain.
- a CD33 CAR as described herein may comprise any one or more additional domains, such as a hinge domain, a transmembrane domain, and one or more intracellular signaling domains (including one or more co-stimulatory domains).
- the present disclosure provides, in some embodiments, administration of a population of immune cells modified to comprise any of the CD33 CARs described herein to treat a hematopoietic malignancy or pre-malignancy, e.g., AML or MDS.
- the present disclosure provides, in some embodiments, administration of a population of hematopoietic cells that are deficient in the lineage-specific cell-surface antigen (CD33).
- the combination of treatment is based, at least in part, on the discovery that agents comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., immune cells expression a chimeric receptor that targets CD33) selectively cause cell death of cells expressing the lineage- specific cell- surface antigen, whereas cells that are deficient for the antigen (e.g., genetically engineered hematopoietic cells) evade cell death caused thereby.
- agents comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen e.g., immune cells expression a chimeric receptor that targets CD33
- agents that are deficient for the antigen e.g., genetically engineered hematopoietic cells
- evade cell death caused thereby e.
- the present disclosure provides methods of administering a combination of therapies including agents comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., immune cells expressing a chimeric receptor that targets CD33) and a population of hematopoietic cells that are deficient in the lineage- specific cell- surface antigen (CD33).
- agents comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., immune cells expressing a chimeric receptor that targets CD33) and a population of hematopoietic cells that are deficient in the lineage- specific cell- surface antigen (CD33).
- a lineage-specific cell-surface antigen e.g., immune cells expressing a chimeric receptor that targets CD33
- CD33 lineage-specific cell-surface antigen
- a CAR is an artificially constructed hybrid protein or polypeptide containing the antigen-binding domain of one or more antibodies (e.g., single chain variable fragment (scFv)) linked to T-cell signaling domains.
- Characteristics of CARs include their ability to redirect T- cell specificity and reactivity toward a selected target in a non-MHC- restricted manner, exploiting the antigen-binding properties of monoclonal antibodies.
- the non-MHC-restricted antigen recognition gives T cells expressing CARs the ability to recognize antigen independent of antigen processing, thus bypassing a major mechanism of tumor escape.
- CARs when expressed in T-cells, CARs advantageously do not dimerize with endogenous T cell receptor (TCR) alpha and beta chains.
- TCR T cell receptor
- First generation CARs are typically composed of an extracellular antigen-binding domain (e.g., a scFv), which is fused to a transmembrane domain, which is fused to cytoplasmic/intracellular signaling domain.
- First generation CARs can provide de novo antigen recognition and cause activation of both CD4+ and CD8+ T cells through their CD3 ⁇ chain signaling domain in a single fusion molecule, independent of HLA-mediated antigen presentation.
- “Second generation” CARs add an intracellular signaling domain from various co- stimulatory signaling molecules (e.g., CD28, 4-1BB, ICOS, 0X40, CD27, CD40/My88 and NKGD2) to the cytoplasmic tail of the CAR to provide additional signals to the T cell.
- Second generation CARs comprise those that provide both co- stimulation (e.g., CD28 or 4- IBB) and activation ( CD3 ⁇ ).
- “Third generation” CARs comprise those that provide multiple co-stimulatory domains (e.g., CD28 and 4- IBB) and a signaling domain providing activation (e.g., CD3 ⁇ ).
- a CAR described herein comprises an extracellular portion of the CAR containing anti-CD33 binding domain, a transmembrane domain, and a signaling domain.
- the CAR further comprises one or more of a linker region, hinge region, and co- stimulatory signaling domains.
- the CAR further comprises a signal peptide/signal sequence.
- a CAR can consist of or consist essentially of the specified amino acid sequence or sequences described herein, such that other components, e.g., other amino acids, do not materially change the biological activity of the functional variant.
- CARs of the present disclosure can be of any length, i.e., can comprise any number of amino acids, provided that the CARs (or functional portions or functional variants thereof) retain their biological activity, e.g., the ability to specifically bind to the target antigen (e.g., CD33), detect diseased cells in a mammal, or treat or prevent disease in a mammal, etc.
- the CAR can be about 50 to about 5000 amino acids long, such as 50, 70, 75, 100, 125, 150, 175, 200, 300, 400, 500, 600, 700, 800, 900, 1000 or more amino acids in length.
- CAR constructs can comprise synthetic amino acids in place of one or more naturally-occurring amino acids.
- synthetic amino acids include, for example, aminocyclohexane carboxylic acid, norleucine, a-amino n-decanoic acid, homoserine, S-acetylaminomethy 1-cysteine, trans-3- and trans-4-hydroxyproline, 4- aminophenylalanine, 4- nitrophenylalanine, 4-chlorophenylalanine, 4-carboxyphenylalanine, b-phenylserine b-hydroxyphenylalanine, phenylglycine, a-naphthylalanine, cyclohexylalanine, cyclohexylglycine, indoline-2-carboxylic acid, 1,2, 3, 4- tetrahydroisoquinoline-3 -carboxylic
- CAR constructs can be glycosylated, amidated, carboxylated, phosphorylated, esterified, N-acylated, cyclized via, e.g., a disulfide bridge, or converted into an acid addition salt and/or optionally dimerized or polymerized, or conjugated.
- CAR constructs (including functional portions and functional variants thereof) can be obtained by methods known in the art.
- CAR constructs may be made by any suitable method of making polypeptides or proteins, including de novo synthesis.
- CAR constructs can be recombinantly produced using the nucleic acids described herein using standard recombinant methods. See, for instance, Green et al., Molecular Cloning: A Laboratory Manual, 4th ed., Cold Spring Harbor Press, Cold Spring Harbor, NY 2012.
- portions of some of the CAR constructs described herein can be isolated and/or purified from a source, such as a plant, a bacterium, an insect, a mammal, e.g., a rat, a human, etc. Methods of isolation and purification are well known in the art.
- the CAR constructs described herein can be commercially synthesized by companies, such as Synpep (Dublin, CA), Peptide Technologies Corp. (Gaithersburg, MD), and Multiple Peptide Systems (San Diego, CA).
- the CAR constructs can be synthetic, recombinant, isolated, and/or purified.
- nucleic acids comprising a nucleotide sequence encoding any of the CAR constructs described herein (including functional portions and functional variants thereof).
- the nucleic acids described herein may comprise a nucleotide sequence encoding any of the leader sequences (e.g., signal peptides), antigen binding domains, transmembrane domains, linker regions, costimulatory signaling domains, and/or intracellular T cell signaling domains described herein.
- any of the CARs described herein comprises an antigen-binding domain that binds to an antigen (e.g., a lineage-specific cell surface antigen) on a target cell.
- an antigen e.g., a lineage-specific cell surface antigen
- the terms “lineage-specific cell- surface antigen” and “cell- surface lineage-specific antigen” may be used interchangeably and refer to any antigen that is sufficiently present on the surface of a cell and is associated with one or more populations of cell lineage(s).
- the antigen may be present on one or more populations of cell lineage(s) and absent (or at reduced levels) on the cell- surface of other cell populations.
- lineage- specific cell-surface antigens can be classified based on a number of factors such as whether the antigen and/or the populations of cells that present the antigen are required for survival and/or development of the host organism.
- the cell-surface lineage-specific antigen may be a cancer antigen, for example a cell-surface lineage- specific antigen that is differentially present on cancer cells.
- the cancer antigen is an antigen that is specific to a tissue or cell lineage.
- cell- surface lineage-specific antigen examples include without limitation CD20 CD22 (Non- Hodgkin's) lymphoma, B-cell lymphoma, chronic lymphocytic leukemia (CLL)), CD52 (13- cell CLL), CD33 (Acute myelogenous leukemia (AML)), CD 10 (gplOO) (Common (pre-B) acute lymphocytic leukemia and malignant melanoma), CD3/T-cell receptor (TCR) (T-cell lymphoma and leukemia), CD79/B-cell receptor (BCR) (B-cell lymphoma and leukemia), CD26 (epithelial and lymphoid malignancies), RCAS1 (gynecological carcinomas, biliary adenocarcinomas and ductal adenocarcinomas of the pancreas) as well as prostate specific membrane antigen.
- the cell- surface antigen is CD33
- the antigen-binding domain may comprise any antigen-binding portion of an antibody.
- the antigen-binding portion can be any portion that has at least one antigen binding site, such as Fab, F(ab’)2, dsFv, scFv, diabodies, Nanobody®, and triabodies.
- the antigen-binding portion is a singlechain variable region fragment (scFv) antigen-binding fragment.
- An scFv is a truncated Fab fragment including the variable (V) domain of an antibody heavy chain linked to a V domain of a light antibody chain via a synthetic peptide linker, which can be generated using routine recombinant DNA technology techniques.
- dsFv disulfide- stabilized variable region fragments
- the antigen-binding domain can include, but is not limited to, a monoclonal antibody, a polyclonal antibody, a synthetic antibody, a human antibody, a humanized antibody, a non-human antibody, and any fragment thereof.
- the antigen binding domain portion comprises a mammalian antibody or a fragment thereof.
- the antigen-binding domain is derived from the same species in which the CAR will ultimately be used herein.
- the antigen binding domain of the CAR comprises a human antibody, a humanized antibody, or a fragment thereof.
- Human antibodies can be made by a variety of methods known in the art including phage display methods using antibody libraries derived from human immunoglobulin sequences, including improvements to these techniques. See, also, U.S. Pat. Nos.
- the antigen-binding domain is derived from a different species as the species in which the CAR will ultimately be used herein.
- the antigen-binding domain may be derived from a camelid species but used in a human.
- antibodies specific to a lineage- specific antigen of interest can be made by the conventional hybridoma technology.
- the lineage-specific antigen which may be coupled to a carrier protein such as KLH, can be used to immunize a host animal for generating antibodies binding to that complex.
- the route and schedule of immunization of the host animal are generally in keeping with established, and conventional techniques for antibody stimulation and production, as further described herein.
- General techniques for production of mouse, humanized, and human antibodies are known in the art and are described herein. It is contemplated that any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human hybridoma cell lines.
- the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and/or intradermally with an amount of immunogen including, as described herein.
- Hybridomas can be prepared from the lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler. B. and Milstein. C. Nature (1975) 256:495-497 or as modified by Buck, D. W., et al., In Vitro (1982), 18:377-381. Available myeloma lines, including but not limited to X63-Ag8.653 and those from the Salk Institute, Cell Distribution Center, San Diego, Calif., USA, may be used in the hybridization. Generally, the technique involves fusing myeloma cells and lymphoid cells using a fusogen such as polyethylene glycol, or by electrical means well known to those skilled in the art.
- a fusogen such as polyethylene glycol
- the cells are separated from the fusion medium and grown in a selective growth medium, such as hypoxanthine-aminopterin-thymidine (HAT) medium, to eliminate unhybridized parent cells.
- a selective growth medium such as hypoxanthine-aminopterin-thymidine (HAT) medium
- HAT hypoxanthine-aminopterin-thymidine
- Any of the media described herein, supplemented with or without serum, can be used for culturing hybridomas that secrete monoclonal antibodies.
- EBV immortalized B cells may be used to produce the TCR-like monoclonal antibodies described herein.
- hybridomas are expanded and subcloned, if desired, and supernatants are assayed for antiimmunogen activity by conventional immunoassay procedures (e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay).
- immunoassay procedures e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay.
- Hybridomas that may be used as source of antibodies encompass all derivatives, progeny cells of the parent hybridomas that produce monoclonal antibodies capable of binding to a lineage- specific antigen.
- Hybridomas that produce such antibodies may be grown in vitro or in vivo using known procedures.
- the monoclonal antibodies may be isolated from the culture media or body fluids, by conventional immunoglobulin purification procedures such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography, and ultrafiltration, if desired.
- Undesired activity if present, can be removed, for example, by running the preparation over adsorbents made of the immunogen attached to a solid phase and eluting or releasing the desired antibodies off the immunogen.
- a target antigen or a fragment containing the target amino acid sequence conjugated to a protein that is immunogenic in the species to be immunized e.g., keyhole limpet hemocyanin, serum album
- an antibody of interest (e.g., produced by a hybridoma) may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation.
- the sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use.
- the polynucleotide sequence may be used for genetic manipulation to “humanize” the antibody or to improve the affinity (affinity maturation), or other characteristics of the antibody.
- the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans.
- Fully human antibodies can be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins.
- Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are Xenomouse® from Amgen, Inc. (Fremont, Calif.) and HuMAb-Mouse® and TC MouseTM from Medarex, Inc. (Princeton, N.J.).
- antibodies may be made recombinantly by phage display or yeast technology. See, for example, U.S. Pat. Nos.
- phage display technology can be used to produce human antibodies and antibody and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors.
- Antigen-binding fragments of an intact antibody can be prepared via routine methods.
- F(ab')2 fragments can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab')2 fragments.
- DNA encoding a monoclonal antibodies specific to a target antigen can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies).
- the hybridoma cells serve as a preferred source of such DNA.
- the DNA may be placed into one or more expression vectors, which are then transfected into host cells such as E.
- DNA can then be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et al., Proc. Nat. Acad. Sci. (1984) 81:6851, or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a nonimmunoglobulin polypeptide.
- genetically engineered antibodies such as “chimeric” or “hybrid” antibodies; can be prepared that have the binding specificity of a target antigen.
- variable regions of VH and VL of a parent non-human antibody are subjected to three-dimensional molecular modeling analysis following methods known in the art.
- framework amino acid residues predicted to be important for the formation of the correct CDR structures are identified using the same molecular modeling analysis.
- human VH and VL chains having amino acid sequences that are homologous to those of the parent non-human antibody are identified from any antibody gene database using the parent VH and VL sequences as search queries. Human VH and VL acceptor genes are then selected.
- the CDR regions within the selected human acceptor genes can be replaced with the CDR regions from the parent non-human antibody or functional variants thereof.
- residues within the framework regions of the parent chain that are predicted to be important in interacting with the CDR regions can be used to substitute for the corresponding residues in the human acceptor genes.
- a single-chain antibody can be prepared via recombinant technology by linking a nucleotide sequence coding for a heavy chain variable region and a nucleotide sequence coding for a light chain variable region.
- a flexible linker is incorporated between the two variable regions.
- techniques described for the production single chain antibodies U.S. Pat. Nos. 4,946,778 and 4,704,692 can be adapted to produce a phage or yeast scFv library and scFv clones specific to a lineage-specific antigen can be identified from the library following routine procedures. Positive clones can be subjected to further screening to identify those that bind lineage-specific antigen.
- the antigen-binding domain is operably linked to another domain of the CAR, such as the transmembrane domain or the intracellular domain, for expression in the cell.
- a nucleic acid encoding the antigen-binding domain is operably linked to a nucleic acid encoding a transmembrane domain and a nucleic acid encoding an intracellular domain.
- CARs described herein target CD33 and comprise an extracellular region comprising an anti-CD33 binding domain.
- a lineage-specific antigen of interest is CD33 and the antigen-binding domain of a CAR specifically binds CD33, for example, human CD33.
- the CAR comprises an anti-CD33 antigen-binding domain comprising, consisting of, or consisting essentially of, an antigen-binding fragment such as a single chain variable fragment (scFv) of the antigen-binding domain.
- the CAR comprises an anti-CD33 antigen binding domain of hP67.6 (Cowan et al., Front. Biosci. (2013) (Landmark Ed.), 18: 1311-1334 and U.S. Patent No. 5,739,116, each incorporated by reference herein), M195 (Co et al., J. Immunol., (1992) 148: 1149-1154, incorporated by reference herein), or Hu 195 (Co et al., supra).
- hP67.6 Cowan et al., Front. Biosci. (2013) (Landmark Ed.), 18: 1311-1334 and U.S. Patent No. 5,739,116, each incorporated by reference herein
- M195 Co et al., J. Immunol., (1992) 148: 1149-1154, incorporated by reference herein
- Hu 195 Co et al., supra.
- a CAR comprises anti-CD33 antigen-binding domain comprising, consisting of, or consisting essentially of, a single chain variable fragment (scFv) of the antigen-binding domain of hP67.6, M195, or Hul95 or a portion thereof.
- scFv single chain variable fragment
- the anti-CD33 antigen-binding domain includes at least 10%
- the anti-CD33 antigenbinding domain includes at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 99% or more of hP67.6, M195, or Hul95, such that the fragment retains the ability to bind CD33.
- an anti-CD33 antigen-binding domain is a monoclonal antibody, or antigen-binding fragment thereof. In some embodiments, an anti-CD33 antigenbinding domain is a humanized antibody, or antigen-binding fragment thereof.
- Exemplary anti-CD33 antibodies or antigen-binding fragments thereof can include, but are not limited to, SEQ ID NOs: 60-101.
- an anti-CD33 antigen binding domain comprises an scFv of an antibody light chain.
- an anti-CD33 antigen binding domain comprises an scFv of an antibody heavy chain.
- an anti-CD33 antibody or antigen-binding fragment thereof comprises an amino acid sequence shown in any one of SEQ ID NOs: 60-101, or a sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to any one of SEQ ID NOs: 60-101.
- an anti-CD33 antigen binding domain comprises an scFv of an antibody heavy chain comprising an amino acid sequence of SEQ ID NO: 60 (or a sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to any one of SEQ ID NO: 60), and an scFv of an antibody light chain comprising an amino acid sequence of SEQ ID NO: 90 (or a sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to any one of SEQ ID NO: 90).
- an anti-CD33 antigen binding domain comprises an scFv of an antibody heavy chain comprising an amino acid sequence of SEQ ID NO: 91 (or a sequence with at least 80 85 90 91 92 93 94 95 96 97 98 or 99% identity to any one of SEQ ID NO: 91), and an scFv of an antibody light chain comprising an amino acid sequence of SEQ ID NO: 92 (or a sequence with at least 80, 85, 90, 91, 92, 93,
- an anti-CD33 antigen binding domain comprises an scFv of an antibody heavy chain comprising an amino acid sequence of SEQ ID NO: 100 (or a sequence with at least 80, 85, 90, 91, 92,
- an scFv of an antibody light chain comprising an amino acid sequence of SEQ ID NO: 101 (or a sequence with at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% identity to any one of SEQ ID NO: 101).
- scFv heavy chain Q V QL V QS GAE VKKPGS S VK V S CKAS G YTFTD YNMHW VRQ APGQGLEWIG YI YPYNGGTGYNQKFKSKATITADESTNTAYMELSSLRSEDTAVYYCARGRPAMDYW GQGTLVTVSS [SEQ ID NO: 100] scFv light chain:
- a nucleic acid encoding the anti-CD33 antigen binding domain is operably linked to a nucleic acid encoding a linker region, a nucleic acid encoding a transmembrane domain, and/or a nucleic acid encoding an intracellular domain ⁇ e.g., a costimulatory signaling domain, a signaling domain).
- the CAR comprises a linker region.
- the light chain variable region and the heavy chain variable region of the antigen-binding domain can be joined to each other by a linker.
- the antigen-binding domain can be joined to another domain, such as a transmembrane domain, hinge, and/or intracellular domain with a linker region.
- the linker may comprise any suitable amino acid sequence.
- the linker is a Gly/Ser linker from about 1 to about 100, from about 3 to about 20, from about 5 to about 30, from about 5 to about 18, or from about 3 to about 8 amino acids in length and consists of glycine and/or serine residues in sequence.
- the Gly/Ser linker may consist of glycine and/or serine residues.
- the Gly/Ser linker comprises the amino acid sequence of GGGGS (SEQ ID NO: 1), and multiple SEQ ID NO: 1 may be present within the linker. Any linker sequence may be used as a spacer between the antigen-binding domain and any other domain of the CAR, such as the transmembrane domain.
- the region linker is ([G]x[S]y)z, for example wherein x can be 1-10, 7 can be 1-3, and z can be 1-5.
- the linker region comprises the amino acid sequence GGGGSGGGGS (SEQ ID NO: 93).
- the linker region comprises the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO: 99).
- the antigen-binding domain comprises one or more leader sequences (signal peptides, signal sequence), such as those described herein.
- the leader sequence may be positioned at the amino terminus of the CAR within the CAR construct.
- the leader sequence may comprise any suitable leader sequence, e.g., any CARs described herein may comprise any leader sequence, such as those described herein.
- the leader sequence may facilitate expression of the released CARs on the surface of the cell, the presence of the leader sequence in an expressed CAR is not necessary in order for the CAR to function.
- the leader sequence upon expression of the CAR on the cell surface, the leader sequence may be cleaved off. Accordingly, in some embodiments, the released CARs (e.g., surface expressed) lack a leader sequence. In some embodiments, the CARs within the CAR construct lack a leader sequence.
- the CAR comprises a hinge/spacer region that links the extracellular antigen-binding domain to another domain, such as a transmembrane domain.
- the hinge/spacer region can be flexible enough to allow the antigen-binding domain to orient in different directions to facilitate target antigen recognition.
- the hinge domain is a portion of the hinge domain of CD8a or CD28, e.g., a fragment containing at least 15 (e.g., 20, 25, 30, 35, or 40) consecutive amino acids of the hinge domain of CD8a or
- the CAR comprises a hinge domain, such as a hinge domain from CDS, CD28, or IgG4.
- the hinge domain is a CDS (e.g., CD8a) hinge domain.
- the CDS hinge domain is human (e.g., obtained from/derived from a human protein sequence).
- the CDS hinge domain comprises, consists of, or consists essentially of SEQ ID NO: 2.
- the hinge domain is a CD28 hinge domain.
- the CD28 hinge domain is human (e.g., obtained from/derived from a human protein sequence).
- the CD28 hinge domain comprises, consists of, or consists essentially of SEQ ID NO: 3.
- Hinge domains of antibodies are also compatible for use in the chimeric receptors described herein.
- the hinge domain is the hinge domain that joins the constant domains CHI and CH2 of an antibody
- the hinge domain is of an antibody and comprises the hinge domain of the antibody and one or more constant regions of the antibody.
- the hinge domain comprises the hinge domain of an antibody and the CHS constant region of the antibody.
- the hinge domain comprises the hinge domain of an antibody and the CH2 and CHS constant regions of the antibody.
- the antibody is an IgG, IgA, IgM, IgE, or IgD antibody. In some embodiments, the antibody is an IgG antibody. In some embodiments, the antibody is an IgG1, IgG2, IgG3, or IgG4 antibody. In some embodiments, the hinge region comprises the hinge region and the CH2 and CHS constant regions of an IgGl antibody. In some embodiments, the hinge region comprises the hinge region and the CH3 constant region of an IgGl antibody. In some embodiments, the hinge domain is an IgG4 hinge domain.
- CARs comprising a hinge domain that is a non-naturally occurring peptide.
- the hinge domain between the C-terminus of the extracellular ligand-binding domain of an Fc receptor and the N-terminus of the transmembrane domain is a peptide linker, such as a (GlyxSer)n linker, wherein x and n, independently can be an integer between 3 and 12, including 3, 4, 5, 6, 7, 8,
- the hinge/spacer region of a presently disclosed CAR comprises a native or modified hinge region of a CD28 polypeptide as described herein. In certain embodiments, the hinge/spacer region of a presently disclosed CAR construct comprises a native or modified hinge region of a CD8a polypeptide as described herein. In certain embodiments, the hinge/spacer region of a presently disclosed CAR construct comprises a native or modified hinge region of a IgG4 polypeptide as described herein.
- a CAR can be designed to comprise a transmembrane domain that connects the antigen-binding domain of the CAR to an intracellular region of the CAR.
- the transmembrane domain is naturally associated with one or more of the domains in the CAR.
- the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
- Transmembrane regions of particular use in this invention may be derived from (i.e. comprise at least the transmembrane region(s) of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD8a, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154,
- TLR1 Toll-like receptor 1 (TLR1), TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, and TLR9.
- the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
- a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
- the transmembrane domain is a CD8 (e.g., CD8a) transmembrane domain.
- the CDS transmembrane domain is human (e.g., obtained from/derived from a human protein sequence).
- a CD8 Dransmembrane domain comprises, consists of, or consists essentially of SEQ ID NO: 4.
- the transmembrane domain is a CD28 transmembrane domain.
- the CD28 transmembrane domain is human (e.g., obtained from/derived from a human protein sequence).
- the CD28 transmembrane domain comprises, consists of, or consists essentially of SEQ ID NO: 5.
- theCAR construct comprises an intracellular signaling domain which may be comprised of one or more signaling domains and costimulatory domains.
- the intracellular signaling domain of the CAR is involved in activation of the cell in which the CAR is expressed.
- the intracellular signaling domain of the CAR construct described herein is involved in activation of a T lymphocyte or NK cells.
- the signaling domain of the CAR construct described herein includes a domain involved in signal activation and/or transduction.
- Examples of an intracellular signaling domains for use in the CAR constructs described herein include, but are not limited to, the cytoplasmic portion of a surface receptor, co-stimulatory molecule, and any molecule that acts in concert to initiate signal transduction in a cell ⁇ e.g., an immune cell (e.g., a T lymphocyte), NK cell), as well as any derivative or variant of these elements and any synthetic sequence that has the same functional capability.
- Examples of the signaling domains that may be used in the intracellular signaling domain of the CARs described herein include, without limitation, a fragment or domain from one or more molecules or receptors including, but are not limited to, TCR, CDS zeta ( CD3 ⁇ ), CDS gamma, CDS delta, CDS epsilon, CD86, common FcR gamma, FcR beta (Fc Epsilon Rib), CD79a, CD79b, Fcgamma Rlla, DAP10, DAP 12, T cell receptor (TCR), CD27, CD28, 4-1BB (CD137), 0X40, CD30, CD40, PD-1, ICOS, lymphocyte function- associated antigen- 1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, CDS, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NK
- CD 160 BY55
- PSGL1, CD 100 SEMA4D
- CD69 SLAMF6
- SLAMF1, CD 150 IPO-3
- BLAME SLAMF8
- SELPLG CD 162
- LTBR LAT
- GADS SLP-76
- PAG/Cbp PAG/Cbp
- NKp44 PAG/Cbp
- NKp30 NKp46
- NKG2D Toll-like receptor 1
- TLR1 Toll-like receptor 1
- cytoplasmic signaling domain can be used in the CARs described herein.
- a cytoplasmic signaling domain relays a signal, such as interaction of an extracellular ligand-binding domain with its ligand, to stimulate a cellular response, such as inducing an effector function of the cell (e.g., cytotoxicity).
- a factor involved in T cell activation is the phosphorylation of immunoreceptor tyrosine-based activation motif ( ⁇ ) of a cytoplasmic signaling domain.
- ⁇ AM-containing domain known in the art may be used to construct the chimeric receptors described herein, and included as part of the cytoplasmic signaling domain.
- an ⁇ motif may comprise two repeats of the amino acid sequence YxxL/I separated by 6-8 amino acids, wherein each x is independently any amino acid, producing the conserved motif YxxL/Ix(6-8)YxxL/I.
- the cytoplasmic signaling domain is from CD3 ⁇ ,.
- CD3 ⁇ associates with TCRs to produce a signal and contains immunoreceptor tyrosine-based activation motifs (ITAMs).
- a CD3 ⁇ , intracellular T cell signaling sequence is human (e.g., obtained from or derived from a human protein).
- a CD3 ⁇ , intracellular T cell signaling sequence comprises, consists of, or consists essentially of the amino acid sequence of SEQ ID NO: 6 or 98, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical the amino acid sequence of SEQ ID NO: 6 or 98.
- an intracellular T cell signaling domain comprises a CD3 ⁇ , that contains on or more mutated and/or deleted ITAMs.
- an intracellular signaling domain of the CAR further comprises at least one (e.g., 1, 2, 3 or more) co- stimulatory signaling domain.
- the co-stimulatory signaling domain comprises at least one costimulatory molecule, which can provide optimal lymphocyte activation.
- many immune cells require co- stimulation, in addition to stimulation of an antigen-specific signal, to promote cell proliferation, differentiation and survival, and to activate effector functions of the cell.
- Activation of a co- stimulatory signaling domain in a host cell may induce the cell to increase or decrease the production and secretion of cytokines, phagocytic properties, proliferation, differentiation, survival, and/or cytotoxicity.
- the costimulatory signaling domain of any co-stimulatory protein may be compatible for use in the chimeric receptors described herein.
- the type(s) of co-stimulatory signaling domains may be selected based on factors such as the type of the cells in which the CARs would be expressed (e.g., primary T cells, T cell lines, NK cell lines) and the desired immune effector function (e.g., cytotoxicity).
- factors such as the type of the cells in which the CARs would be expressed (e.g., primary T cells, T cell lines, NK cell lines) and the desired immune effector function (e.g., cytotoxicity).
- Examples of such co-stimulatory signaling domains include a fragment or domain from one or more molecules or receptors including, without limintation, are not limited to 4-1BB, CD28, ICOS, TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, CD116 receptor beta chain, CSF1-R, LRP1/CD91, SR-A1, SR-A2, MARCO, SR-CL1, SR-CL2, SR-C, SR-E, CR1, CR3, CR4, dectin 1, DEC-205, DC- SIGN, CD 14, CD36, LOX-1, CD lib, together with any of the signaling domains listed in the above paragraph in any combination.
- the intracellular signaling domain of the CAR includes any portion of one or more co- stimulatory signaling molecules, such as at least one signaling domain from CD3, Fc epsilon RI gamma chain, any derivative or variant thereof, including any synthetic sequence thereof that has the same functional capability, and any combination thereof.
- one or more co- stimulatory signaling domains are included in a CAR construct with a CD3 ⁇ intracellular T cell signaling sequence.
- the one or more co-stimulatory signaling domains are selected from CD 137 (4- IBB) and CD28, or a combination thereof.
- the CAR comprises a 4-1BB (CD 137) costimulatory signaling domain.
- the CAR comprises a CD28 costimulatory signaling domain.
- the CAR comprises both a 4- IBB costimulatory signaling domain and a CD28 costimulatory signaling domain.
- 4-1BB also known as CD137, transmits a potent costimulatory signal to T cells, promoting differentiation and enhancing long-term survival of T lymphocytes.
- a 4- IBB intracellular signaling sequence is human (e.g., obtained from/derived from a human protein sequence).
- the 4- IBB intracellular T cell signaling sequence comprises, consists of, or consists essentially of the amino acid sequence of SEQ ID NO: 7.
- the 4-1BB costimulatory signaling domain comprises, consists of, or consists essentially of the amino acid sequence of SEQ ID NO: 7, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical the amino acid sequence of SEQ ID NO: 7.
- Suitable costimulatory domains include, for example, those described in Weinkove et al., Selecting costimulatory domains for chimeric antigen receptors: functional and clinical considerations, Clin Transl Immunology. 2019; 8(5): el049, the entire contents of which are incorporated herein by reference.
- spacer domain generally means any oligo- or polypeptide that functions to link the transmembrane domain to, either the antigen binding domain or, the intracellular domain in the polypeptide chain.
- the spacer domain may comprise up to 300 amino acids, preferably 10 to 100 amino acids and most preferably 25 to 50 amino acids.
- a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the intracellular domain of the CAR.
- An example of a linker includes a glycine- serine doublet.
- any of the CARs described herein may further comprise a signal peptide (signal sequence).
- signal peptides are short amino acid sequences that target a polypeptide to a site in a cell.
- the signal peptide directs the CAR to the secretory pathway of the cell and will allow for integration and anchoring of the CAR into the lipid bilayer at the cell surface.
- Signal sequences including signal sequences of naturally occurring proteins or synthetic, non-naturally occurring signal sequences, that are compatible for use in the chimeric receptors described herein will be evident to one of skill in the art.
- the CARs described herein may be prepared in constructs with, e.g., selfcleaving peptides, such that the CAR constructs containing anti-CD33 CAR components are bicistronic, tricistranic, etc.
- CAR constructs and numerous elements of CAR constructs are disclosed herein, and those of skill in the art will be able to ascertain the sequences of these elements and of additional suitable elements known in the art based on the present disclosure in view of the knowledge in the art.
- CAR element sequences e.g., for CD33 binding domains, signal peptides, linkers, hinge sequences, transmembrane domains, costimulatory domains, and signaling domains, are disclosed in PCT/US2019/022309, published as WO/2019/178382, e.g., throughout the specification and in Tables 1-6, the entire contents of which are incorporated herein by reference.
- Nucleic acids encoding any of the CAR constructs described herein can be incorporated into a vector, such as a recombinant expression vector.
- a vector such as a recombinant expression vector.
- an embodiment of the invention provides recombinant expression vectors comprising any of the nucleic acids of the invention.
- the terms “recombinant expression vector” and “vector” may be used interchangeably and refer to a genetically-modified oligonucleotide or polynucleotide construct that permits the expression of an mRNA, protein, polypeptide, or peptide by a host cell, when the construct comprises a nucleotide sequence encoding the mRNA, protein, polypeptide, or peptide, and the vector is contacted with the cell under conditions sufficient to have the mRNA, protein, polypeptide, or peptide expressed within the cell.
- vectors are not naturally-occurring as a whole. However, parts of the vectors can be naturally-occurring.
- inventive recombinant expression vectors can comprise any type of nucleotides, including, but not limited to DNA and RNA, which can be single-stranded or double- stranded, synthesized or obtained in part from natural sources, and which can contain natural, non-natural or altered nucleotides.
- the vector is a DNA vector.
- the vector is an RNA vector.
- the vectors can comprise naturally-occurring or non-naturally-occurring intemucleotide linkages, or both types of linkages. In some embodiments, a non-naturally occurring or altered nucleotides or intemucleotide linkages do not hinder the transcription or replication of the vector.
- the vector may be any suitable recombinant expression vector, and can be used to transform or transfect any suitable host cell. Suitable vectors include those designed for propagation and expansion or for expression or both, such as plasmids and viruses.
- a vector can be selected from the group consisting of the pUC series (Fermentas Life Sciences, Glen Bumie, MD), the pBluescript series (Stratagene, LaJolla, CA), the pET series (Novagen, Madison, WI), the pGEX series (Pharmacia Biotech, Uppsala, Sweden), and the pEX series (Clontech, Palo Alto, CA).
- Bacteriophage vectors such as LGTIO, ⁇ GT11, LZapII (Stratagene), ⁇ EMBT4, and ⁇ NMI149, also can be used.
- plant expression vectors include pBIOl, pBI101.2, pBHOl.3, pBH21 and pBIN19 (Clontech).
- animal expression vectors include pEUK-CI, pMAM, and pMAMneo (Clontech).
- the recombinant expression vector may be a viral vector, e.g., an adenoviral vector, a retroviral vector, or a lentiviral vector.
- the vector is an adenoviral vector.
- the vector is a retroviral vector.
- the vector is a lentiviral vector.
- the vectors of the invention can be prepared using standard recombinant DNA techniques described in, for example, Green et al., supra.
- Constructs of expression vectors which are circular or linear, can be prepared to contain a replication system functional in a prokaryotic or eukaryotic host cell.
- Replication systems can be derived, e.g., from Co1E1, 2 ⁇ plasmid, ⁇ , SV40, bovine papilloma virus, and the like.
- a recombinant expression vector may comprise regulatory sequences, such as transcription and translation initiation and termination codons, which are specific to the type of host cell (e.g., bacterium, fungus, plant, or animal) into which the vector is to be introduced, as appropriate, and taking into consideration whether the vector is DNA- or RNA-based.
- a recombinant expression vector may also comprise restriction sites to facilitate cloning.
- a vector can include one or more marker genes, which allow for selection of transformed or transfected host cells. Marker genes include biocide resistance, e.g., resistance to antibiotics, heavy metals, etc., complementation in an auxotrophic host to provide prototrophy, and the like. Suitable marker genes for the inventive expression vectors include, for instance, neomycin/G418 resistance genes, hygromycin resistance genes, histidinol resistance genes, tetracycline resistance genes, and ampicillin resistance genes. [0170] Further, the vectors can be made to include a suicide gene. As used herein, the term “suicide gene” refers to a gene that causes the cell expressing the suicide gene to die.
- a suicide gene can be a gene that confers sensitivity to an agent, e.g., a drug, upon the cell in which the gene is expressed, and causes the cell to die when the cell is contacted with or exposed to the agent.
- Suicide genes are known in the art and include, for example, the Herpes Simplex Virus (HSV) thymidine kinase (TK) gene, cytosine deaminase, purine nucleoside phosphorylase, and nitroreductase.
- a recombinant expression vector can comprise a native or nonnative promoter operably linked to the nucleotide sequence encoding the CAR construct (including functional portions and functional variants thereof), or to the nucleotide sequence which is complementary to or which hybridizes to the nucleotide sequence encoding the CAR construct.
- promoters e.g., strong, weak, inducible, tissue-specific and developmental-specific.
- the selection of promoters e.g., strong, weak, inducible, tissue-specific and developmental-specific, is within the ordinary skill of the artisan.
- the combining of a nucleotide sequence with a promoter is also within the skill of the artisan.
- the promoter can be a non-viral promoter or a viral promoter, e.g., a cytomegalovirus (CMV) promoter, a SFFV promoter, an EFl ⁇ promoter, an SV40 promoter, an RS V promoter, or a promoter found in the long-terminal repeat of the murine stem cell virus.
- CMV cytomegalovirus
- SFFV cytomegalovirus
- EFl ⁇ promoter EFl ⁇ promoter
- an SV40 promoter SV40 promoter
- RS V promoter a promoter found in the long-terminal repeat of the murine stem cell virus.
- the promoter is an SFFV promoter (e.g., as represented in SEQ ID NO: 8).
- the vectors described herein can be designed for transient expression, stable expression, or for both.
- the recombinant expression vectors can be made for constitutive expression or for inducible expression.
- conjugates e.g., bioconjugates, comprising any of the CAR constructs (including any of the functional portions or variants thereof), nucleic acids, recombinant expression vectors, host cells, or populations of host cells described herein.
- Conjugates, as well as methods of synthesizing conjugates in general, are known in the art.
- aspects of the present disclosure provide methods for modifying a cell comprising introducing a chimeric antigen receptor (CAR) into cell, ⁇ e.g., an immune cell, such as a T lymphocyte or NK cell), wherein the CAR comprises an antigen binding domain, a transmembrane domain, and an intracellular signaling domain, e.g., of a co-stimulatory molecule, and wherein the immune cell expresses the CAR and possesses targeted effector activity.
- the CAR further comprise a linker region, a hinge region, and/or at least one costimulatory domains.
- introducing the CAR into the cell comprises introducing a nucleic acid sequence encoding the CAR.
- introducing the nucleic acid sequence comprises electroporating a mRNA encoding the CAR.
- the cell may be an immune cell, such as T lymphocyte or an NK cell.
- a T lymphocyte can be any T cell, such as a cultured T cell, e.g., a primary T cell, or a T cell from a cultured T cell line, e.g., TIB-153 TM , Jurkat, SupTl, etc., or a T cell obtained from a mammal. If obtained from a mammal, a T cell can be obtained from numerous sources, including but not limited to blood, bone marrow, lymph node, the thymus, or other tissues or fluids. T cells can also be enriched for or purified. In some embodiments, the T cell is a human T cell.
- the T cell may be a T cell isolated from a human.
- a T cell can be any type of T cell and can be of any developmental stage, including but not limited to, CD4+/CD8+ double positive T cells, CD4+ helper T cells, e.g., Thl and Th2 cells, CD8+ T cells (e.g., cytotoxic T cells), tumor infiltrating cells, memory T cells, naive T cells, and the like.
- a T cell may be a CD 8+ T cell or a CD4+ T cell.
- the T cell is an alpha/beta T cell.
- the T cell is a gamma/delta T cell.
- the immune cell is a natural killer T cell (NKT cell).
- the immune cell is a natural killer cell (NK cell).
- the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art.
- the expression vector can be transferred into a host cell by physical, chemical, or biological means
- Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, transduction (e.g., lentiviral transduction, retroviral transduction), electroporation (e.g., DNA or RNA electroporation), and the like.
- Nucleic acids can be introduced into target cells using commercially available methods which include electroporation (Amaxa Nucleofector-II (Amaxa Biosystems, Cologne, Germany)), (ECM 830 (BTX) (Harvard Instruments, Boston, Mass.) or the Gene Pulser ⁇ (BioRad, Denver, Colo.), Multiporator (Eppendort, Hamburg Germany).
- Nucleic acids can also be introduced into cells using cationic liposome mediated transfection using lipofection, using polymer encapsulation, using peptide mediated transfection, or using biolistic particle delivery systems such as "gene guns” (see, for example, Nishikawa, et al.
- the DNA or RNA construct is introduced into the cells by electroporation. See, e.g., the formulations and methodology of electroporation of nucleic acid constructs into mammalian cells as taught in US Publication Nos. US 2004/0014645, US 2005/0052630A1, US 2005/0070841 Al, US 2004/0059285 Al, and US 2004/0092907 Al, which are incorporated herein by reference.
- the various parameters including electric field strength required for electroporation of any known cell type are generally known in the relevant research literature as well as numerous patents and applications in the field. See e.g., U.S. Pat. No. 6,678,556, U.S. Pat. No.
- Electroporation may also be utilized to deliver nucleic acids into cells in vitro. Accordingly, electroporation-mediated administration into cells of nucleic acids including expression constructs utilizing any of the many available devices and electroporation systems known to those of skill in the art present additional means for delivering DNA or RNA of interest to a target cell.
- Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors.
- RNA vectors include vectors having an RNA promoter and/ other relevant domains for production of a RNA transcript.
- Viral vectors and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells.
- Other viral vectors may be derived from lentivirus, poxviruses, herpes simplex virus, adenoviruses and adeno-as sociated viruses, and the like.
- Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- colloidal dispersion systems such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).
- an exemplary delivery vehicle is a liposome.
- lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo).
- the nucleic acid may be associated with a lipid.
- the nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid.
- Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution.
- Lipids are fatty substances which may be naturally occurring or synthetic lipids.
- lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.
- Lipids suitable for use can be obtained from commercial sources.
- DMPC dimyristyl phosphatidylcholine
- DCP dicetyl phosphate
- Choi cholesterol
- DMPG dimyristyl phosphatidylglycerol
- Stock solutions of lipids in chloroform or chloroform/methanol can be stored at about -20°C.
- Liposome is a generic term encompassing a variety of single and multilamellar lipid vehicles formed by the generation of enclosed lipid bilayers or aggregates. Liposomes can be characterized as having vesicular structures with a phospholipid bilayer membrane and an inner aqueous medium. Multilamellar liposomes have multiple lipid layers separated by aqueous medium. They form spontaneously when phospholipids are suspended in an excess of aqueous solution.
- compositions that have different structures in solution than the normal vesicular structure are also encompassed.
- the lipids may assume a micellar structure or merely exist as nonuniform aggregates of lipid molecules.
- lipofectamine-nucleic acid complexes are also contemplated.
- the methods further involve selecting the cells in which the exogenous nucleic acids have been introduced (and expressed) from a population of cells, such as through use of a selectable marker.
- theCAR construct includes particular components including an antigen-binding domain (e.g., CD33 binding domain), a transmembrane domain, a hinge domain, and one or more costimulatory/intracellular signaling domains.
- the CAR further comprises one or more of a linker region, hinge domainregion, and/or one or more costimulatory/intracellular signaling domains.
- a CAR construct may include any combinations of the exemplary elements described herein, for example, any of the antigen binding domains, transmembrane domains, hinge domains, and any one or more co- stimulatory/intracellular signaling domains described herein.
- any of the CARs described herein may further comprise a signal peptide (signal sequence).
- the CAR comprises, from N-terminus to C-terminus: (a) the anti-CD33 antigen-binding domain; (b) the transmembrane region, and (c) the signaling domain. In some embodiments, the CAR does not comprise a costimulatory signaling domain. In some embodiments, the CAR further comprises a signal peptide/signal sequence at the N-terminus of the CAR, which may be removed from the protein upon surface presentation.
- Additional embodiments of the invention provide full-length exemplary CAR constructs encoded by any one or more of the nucleic acid sequence sequences set forth below.
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (MyloTarg (also referred to as “h67.6”)), a CD8a transmembrane domain, a CD8a hinge domain, a CD 137 (4-1BB) co- stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CD33 binding domain MyloTarg (also referred to as “h67.6”)
- a CD8a transmembrane domain a CD8a hinge domain
- CD 137 (4-1BB) co- stimulatory domain a CD3 ⁇ intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 10, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 10.
- underline denotes a leader sequence
- bold denotes a heavy chain of an antibody or antigen-binding domain
- italics denote a linker
- dotted underline denotes a light chain of an antibody or antigen-binding domain
- long dashed underline denotes a hinge domain
- double underline denotes a transmembrane domain
- bold underline denotes an intracellular signaling domain.
- a CAR construct as shown in SEQ ID NO: 9 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 9 comprises the sequence that is shown in SEQ ID NO: 11, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 11.
- a recombinant expression vector including the CAR of SEQ ID NO: 4 comprises the sequence that is shown in SEQ ID NO: 9, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8).
- a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO: 4, but does not include the SFFV sequence (as shown in SEQ ID NO: 8), and instead includes an EFl ⁇ promoter sequence.
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (MyloTarg (h67.6)), a C28 transmembrane domain, a CD28 hinge domain, a CD28 co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 13, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 13.
- a CAR construct as shown in SEQ ID NO: 12 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 12 comprises the sequence that is shown in SEQ ID NO: 14, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 14.
- a recombinant expression vector including the CAR of SEQ ID NO: 5 comprises the sequence that is shown in SEQ ID NO: 14, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8).
- a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct comprises a CD33 binding domain (MyloTarg (h67.6)), a CD8a transmembrane domain, a CD8a hinge domain, a CD 137 (4- 1BB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CAR in encoded by a nucleic acid sequence that comprises the sequence that is shown in SEQ ID NO: 15, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 15.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 16, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 16.
- a CAR construct as shown in SEQ ID NO: 15 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 15 comprises the sequence that is shown in SEQ ID NO: 17, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least
- SEQ ID NO: 15 comprises the sequence that is shown in SEQ ID NO: 17, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8)
- a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (hM195 (Lintuzumab)), a CD28 transmembrane domain, a CD28 hinge domain, a CD28 co-stimulatory domain, and a CD3 ⁇ , intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 19, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 19.
- a CAR construct as shown in SEQ ID NO: 18 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 18 comprises the sequence that is shown in SEQ ID NO: 20, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 20.
- a recombinant expression vector including the CAR of SEQ ID NO: 18 comprises the sequence that is shown in SEQ ID NO: 20, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8). In some embodiments, a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (hM195 (Lintuzumab)), a CD8a transmembrane domain, a CD8a hinge domain, a CD 137 (4- IBB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 22, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 22.
- a CAR construct as shown in SEQ ID NO: 21 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 21 comprises the sequence that is shown in SEQ ID NO: 23, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 23.
- a recombinant expression vector including the CAR of SEQ ID NO: 21 comprises the sequence that is shown in SEQ ID NO: 23, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8). In some embodiments, a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (M195), a CD28 transmembrane domain, a CD28 hinge domain, a CD28 co- stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- M195 CD33 binding domain
- CD28 transmembrane domain CD28 transmembrane domain
- CD28 hinge domain CD28 hinge domain
- CD28 co- stimulatory domain CD28 co- stimulatory domain
- CD3 ⁇ intracellular signaling domain CD3 ⁇ intracellular signaling domain
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 25, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 25.
- a CAR construct as shown in SEQ ID NO: 24 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 24 comprises the sequence that is shown in SEQ ID NO: 26, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 26.
- a recombinant expression vector including the CAR of SEQ ID NO: 24 comprises the sequence that is shown in SEQ ID NO: 26, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8). In some embodiments, a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO: 26, but does not include the SFFV sequence (as shown in SEQ ID NO: 8), and instead includes an EFl ⁇ promoter sequence.
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (My9.6, wherein the VH-CDR3 comprises the amino acid sequence of LGGSLPD Y GMD V [SEQ ID NO: 27]), a CD8a transmembrane domain, a CD8a hinge domain, a CD137 (4-1BB) co-stimulatory domain, and a CD3 ⁇ , intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 29, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 29.
- a CAR construct as shown in SEQ ID NO: 28 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 28 comprises the sequence that is shown in SEQ ID NO: 30, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 30.
- a recombinant expression vector including the CAR of SEQ ID NO: 28 comprises the sequence that is shown in SEQ ID NO: 30, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8). In some embodiments, a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (My9.6, wherein the VH-CDR3 sequence comprises the amino acid sequence RGGYSDYDYYFDF [SEQ ID NO: 31]), a CD8a transmembrane domain, a CD8a hinge domain, a CD137 (4-1BB) co-stimulatory domain, and a CD3 ⁇ , intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 33, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 33.
- a CAR construct as shown in SEQ ID NO: 32 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 32 comprises the sequence that is shown in SEQ ID NO: 34, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 34.
- a recombinant expression vector including the CAR of SEQ ID NO: 32 comprises the sequence that is shown in SEQ ID NO: 34, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8). In some embodiments, a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (My9.6, wherein the CD33 binding domain comprises a VL-VH orientation), a CD8a transmembrane domain, a CD8a hinge domain, a CD137 (4-1BB) co- stimulatory domain, and a CD3 ⁇ , intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 36, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 36.
- a CAR construct as shown in SEQ ID NO: 35 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 35 comprises the sequence that is shown in SEQ ID NO: 37, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 37.
- a recombinant expression vector including the CAR of SEQ ID NO: 35 comprises the sequence that is shown in SEQ ID NO: 37, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8). In some embodiments, a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (My9.6, wherein the CD33 binding domain comprises a VL-VH orientation), a CD8a transmembrane domain, an IgG4 hinge domain, a CD137 (4-1BB) co- stimulatory domain, and a CD3 ⁇ , intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 39 or an amino acid sequence that is at least 70% at least 75% at least 80% at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 39.
- a CAR construct as shown in SEQ ID NO: 38 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 38 comprises the sequence that is shown in SEQ ID NO: 40, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 40.
- a recombinant expression vector including the CAR of SEQ ID NO: 38 comprises the sequence that is shown in SEQ ID NO: 40, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8). In some embodiments, a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (hM195 (Lintuzumab)), a CD8a transmembrane domain, a CD8a hinge domain, a CD 137 (4- IBB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 42, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 42.
- a CAR construct as shown in SEQ ID NO: 41 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 41 comprises the sequence that is shown in SEQ ID NO: 43, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 43.
- a recombinant expression vector including the CAR of SEQ ID NO: 41 comprises the sequence that is shown in SEQ ID NO: 43, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8). In some embodiments, a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (Ml 95) scFv, a CD8a transmembrane domain, a CD8a hinge domain, a CD 137 (4- 1BB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 45, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 45.
- a CAR construct as shown in SEQ ID NO: 44 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 44 comprises the sequence that is shown in SEQ ID NO: 46, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 46.
- a recombinant expression vector including the CAR of SEQ ID NO: 44 comprises the sequence that is shown in SEQ ID NO: 46, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8). In some embodiments, a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (My 9.6) scFv, a CD8a transmembrane domain, a CD8a hinge domain, a CD137 (4- 1BB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 48, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 48.
- a CAR construct as shown in SEQ ID NO: 47 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 47 comprises the sequence that is shown in SEQ ID NO: 49, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 49.
- a recombinant expression vector including the CAR of SEQ ID NO: 47 comprises the sequence that is shown in SEQ ID NO: 49, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8). In some embodiments, a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO:
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (M2H12) scFv, a CD8a transmembrane domain, a CD8a hinge domain, a CD 137 (4- 1BB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- M2H12 CD33 binding domain
- CD8a transmembrane domain CD8a transmembrane domain
- CD8a hinge domain CD8a hinge domain
- CD 137 (4- 1BB) co-stimulatory domain CD3 ⁇ intracellular signaling domain
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 51, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 51.
- a CAR construct as shown in SEQ ID NO: 50 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 50 comprises the sequence that is shown in SEQ ID NO: 52, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 52.
- a recombinant expression vector including the CAR of SEQ ID NO: 50 comprises the sequence that is shown in SEQ ID NO: 52, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8).
- a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO: 52, but does not include the SFFV sequence (as shown in SEQ ID NO: 8), and instead includes an EFl ⁇ promoter sequence.
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (DRB2) scFv, a CD8a transmembrane domain, a CD8a hinge domain, a CD137 (4- 1BB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- DRB2 CD33 binding domain
- CD8a transmembrane domain CD8a transmembrane domain
- CD8a hinge domain CD137 (4- 1BB) co-stimulatory domain
- CD137 (4- 1BB) co-stimulatory domain CD137 (4- 1BB) co-stimulatory domain
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 54, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 54.
- a CAR construct as shown in SEQ ID NO: 53 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 53 comprises the sequence that is shown in SEQ ID NO: 55, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 55.
- a recombinant expression vector including the CAR of SEQ ID NO: 53 comprises the sequence that is shown in SEQ ID NO: 55, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8).
- a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO: 55, but does not include the SFFV sequence (as shown in SEQ ID NO: 8), and instead includes an EFl ⁇ promoter sequence.
- An exemplary CAR construct as described herein, comprises a CD33 binding domain (CAR33VH), a CD8a transmembrane domain, a CD8a hinge domain, a CD137 (4- 1BB) co-stimulatory domain, and a CD3 ⁇ , intracellular signaling domain.
- CD33VH CD33 binding domain
- CD8a transmembrane domain CD8a transmembrane domain
- CD8a hinge domain CD137 (4- 1BB) co-stimulatory domain
- CD137 (4- 1BB) co-stimulatory domain CD137 (4- 1BB) co-stimulatory domain
- CD3 ⁇ intracellular signaling domain
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 57, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 57.
- a CAR construct as shown in SEQ ID NO: 56 is included in a recombinant expression vector.
- the recombinant expression vector includes a promoter (e.g., an SFFV promoter or and EFl ⁇ promoter).
- a recombinant expression vector including the CAR of SEQ ID NO: 56 comprises the sequence that is shown in SEQ ID NO: 58, or in a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the nucleic acid sequence shown in SEQ ID NO: 58.
- a recombinant expression vector including the CAR of SEQ ID NO: 56 comprises the sequence that is shown in SEQ ID NO: 58, but does not include the SFFV promoter sequence (as shown in SEQ ID NO: 8).
- a recombinant expression vector comprises the nucleic acid sequence shown in SEQ ID NO: 58, but does not include the SFFV sequence (as shown in SEQ ID NO: 8), and instead includes an EFl ⁇ promoter sequence.
- An exemplary CAR construct as described herein, comprises a CD33 binding domain as comprised in SEQ ID NO: 60, a CD8a transmembrane domain, a CD8a hinge domain, a CD 137 (4- IBB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CAR comprises an antibody V-D-J region.
- the CAR (e.g., the V-D-J region) comprises an amino acid sequence shown in SEQ ID NO: 61, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 61.
- a CAR comprises an antibody comprising a first heavy chain CDR (CDR1), a second heavy chain CDR (CDR2), and a third heavy chain CDR (CDR3).
- heavy chain CDR1 comprises an amino acid sequence shown in SEQ ID NO: 72, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- heavy chain CDR2 comprises an amino acid sequence shown in SEQ ID NO: 77, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- heavy chain CDR3 comprises an amino acid sequence shown in SEQ ID NO: 78, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- a CAR comprises an antibody comprising 1, 2, 3, or 4 heavy chain framework regions (e.g., 4 heavy chain framework regions).
- the CAR comprises a heavy chain framework region 1 (FR1).
- the heavy chain FR1 comprises an amino acid sequence shown in SEQ ID NO: 79, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 2 (FR2).
- the heavy chain FR2 comprises an amino acid sequence shown in SEQ ID NO: 80, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 3 (FR3).
- the heavy chain FR3 comprises an amino acid sequence shown in SEQ ID NO: 81, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 4 (FR4).
- the heavy chain FR4 comprises an amino acid sequence shown in SEQ ID NO: 82, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 60, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 60.
- An exemplary CAR construct as described herein, comprises a CD33 binding domain as comprised in SEQ ID NO: 90, a CD8a transmembrane domain, a CD8a hinge domain, a CD 137 (4- IBB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CAR comprises an antibody V-D-J region.
- the CAR (e.g., the V-D-J region) comprises an amino acid sequence shown in SEQ ID NO: 83, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 83.
- a CAR comprises an antibody comprising a first heavy chain CDR (CDR1), a second heavy chain CDR (CDR2), and a third heavy chain CDR (CDR3).
- heavy chain CDR1 comprises an amino acid sequence shown in SEQ ID NO: 62, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- heavy chain CDR2 comprises an amino acid sequence shown in SEQ ID NO: 63, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- heavy chain CDR3 comprises an amino acid sequence shown in SEQ ID NO: 64, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- a CAR comprises an antibody comprising 1, 2, 3, or 4 heavy chain framework regions (e.g., 4 heavy chain framework regions).
- the CAR comprises a heavy chain framework region 1 (FR1).
- the heavy chain FR1 comprises an amino acid sequence shown in SEQ ID NO: 65, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 2 (FR2).
- the heavy chain FR2 comprises an amino acid sequence shown in SEQ ID NO: 66, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 3 (FR3).
- the heavy chain FR3 comprises an amino acid sequence shown in SEQ ID NO: 67, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 4 (FR4).
- the heavy chain FR4 comprises an amino acid sequence shown in SEQ ID NO: 68, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 90, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 90.
- An exemplary CAR construct as described herein, comprises a CD33 binding domain as comprised in SEQ ID NO: 91, a CD8a transmembrane domain, a CD8a hinge domain, a CD 137 (4- IBB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CAR comprises an antibody V-D-J region.
- the CAR (e.g., the V-D-J region) comprises an amino acid sequence shown in SEQ ID NO: 69, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 69.
- a CAR comprises an antibody comprising a first heavy chain CDR (CDR1), a second heavy chain CDR (CDR2), and a third heavy chain CDR (CDR3).
- heavy chain CDR1 comprises an amino acid sequence shown in SEQ ID NO: 70, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- heavy chain CDR2 comprises an amino acid sequence shown in SEQ ID NO: 71, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- heavy chain CDR3 comprises an amino acid sequence shown in SEQ ID NO: 73, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- a CAR comprises an antibody comprising 1, 2, 3, or 4 heavy chain framework regions (e.g., 4 heavy chain framework regions).
- the CAR comprises a heavy chain framework region 1 (FRl).
- the heavy chain FRl comprises an amino acid sequence shown in SEQ ID NO: 74, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 2 (FR2).
- the heavy chain FR2 comprises an amino acid sequence shown in SEQ ID NO: 75, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 3 (FR3).
- the heavy chain FR3 comprises an amino acid sequence shown in SEQ ID NO: 76, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 4 (FR4).
- the heavy chain FR4 comprises an amino acid sequence shown in SEQ ID NO: 68, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 91, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 91.
- An exemplary CAR construct as described herein, comprises a CD33 binding domain as comprised in SEQ ID NO: 92, a CD8a transmembrane domain, a CD8a hinge domain, a CD 137 (4- IBB) co-stimulatory domain, and a CD3 ⁇ intracellular signaling domain.
- a CAR comprises an antibody V-D-J region.
- the CAR (e.g., the V-D-J region) comprises an amino acid sequence shown in SEQ ID NO: 61, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 61.
- a CAR comprises an antibody comprising a first heavy chain CDR (CDR1), a second heavy chain CDR (CDR2), and a third heavy chain CDR (CDR3).
- heavy chain CDR1 comprises an amino acid sequence shown in SEQ ID NO: 72, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- heavy chain CDR2 comprises an amino acid sequence shown in SEQ ID NO: 77, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- heavy chain CDR3 comprises an amino acid sequence shown in SEQ ID NO: 78, or an amino acid sequence having 1, 2, or 3 alterations (e.g., substitutions) relative thereto.
- a CAR comprises an antibody comprising 1, 2, 3, or 4 heavy chain framework regions (e.g., 4 heavy chain framework regions).
- the CAR comprises a heavy chain framework region 1 (FR1).
- the heavy chain FR1 comprises an amino acid sequence shown in SEQ ID NO: 79, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 2 (FR2).
- the heavy chain FR2 comprises an amino acid sequence shown in SEQ ID NO: 80, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 3 (FR3).
- the heavy chain FR3 comprises an amino acid sequence shown in SEQ ID NO: 81, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- the CAR comprises a heavy chain framework region 4 (FR4).
- the heavy chain FR4 comprises an amino acid sequence shown in SEQ ID NO: 82, or an amino acid sequence having no more than 1, 2, 3, 4, 5, 6, 7, or 8 alterations (e.g., substitutions) relative thereto.
- a CAR comprises an amino acid sequence shown in SEQ ID NO: 92, or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the amino acid sequence shown in SEQ ID NO: 92.
- any nucleotide sequences described herein may be codon-optimized. Without being bound to a particular theory or mechanism, it is believed that codon optimization of the nucleotide sequence increases the translation efficiency of the mRNA transcripts. Codon optimization of the nucleotide sequence may involve substituting a native codon for another codon that encodes the same amino acid, but can be translated by tRNA that is more readily available within a cell, thus increasing translation efficiency. Optimization of the nucleotide sequence may also reduce secondary mRNA structures that would interfere with translation, thus increasing translation efficiency.
- the codon-optimized nucleotide sequence may comprise, consist, or consist essentially of any one of the nucleic acid sequences described herein.
- any of the nucleic acids described herein may be recombinant.
- the term “recombinant” refers to (i) molecules that are constructed outside living cells by joining natural or synthetic nucleic acid segments to nucleic acid molecules that can replicate in a living cell, or (ii) molecules that result from the replication of those described in (i) above.
- the replication can be in vitro replication or in vivo replication.
- a recombinant nucleic acid may be one that has a sequence that is not naturally occurring or has a sequence that is made by an artificial combination of two otherwise separated segments of sequence. This artificial combination is often accomplished by chemical synthesis or, more commonly, by the artificial manipulation of isolated segments of nucleic acids, e.g., by genetic engineering techniques, such as those described in Green et al., supra.
- the nucleic acids can be constructed based on chemical synthesis and/or enzymatic ligation reactions using procedures known in the art. See, for example, Green et al., supra.
- a nucleic acid can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed upon hybridization (e.g., phosphorothioate derivatives and acridine substituted nucleotides).
- modified nucleotides that can be used to generate the nucleic acids include, but are not limited to, 5-fluorouracil, 5-bromouracil, 5- chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxymethyl) uracil, 5-carboxymethylaminomethyl- 2-thiouridine, 5 -carboxy methylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N 6-isopentenyladenine, 1 -methyl guanine, 1- methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5- methylcytosine, N6-substituted adenine, 7 -methylguanine, 5 -methylaminomethyluracil, 5- methoxyaminomethyl-2- thiouracil, beta
- the nucleic acids can comprise any isolated or purified nucleotide sequence which encodes any of the CAR constructs or functional portions or functional variants thereof.
- the nucleotide sequence can comprise a nucleotide sequence which is degenerate to any of the sequences or a combination of degenerate sequences.
- nucleic acids comprising a nucleotide sequence which is complementary to the nucleotide sequence of any of the nucleic acids described herein or a nucleotide sequence which hybridizes under stringent conditions to the nucleotide sequence of any of the nucleic acids described herein.
- the nucleotide sequence which hybridizes under stringent conditions may hybridize under high stringency conditions.
- high stringency conditions refers to a nucleotide sequence that specifically hybridizes to a target sequence (the nucleotide sequence of any of the nucleic acids described herein) in an amount that is delectably stronger than non-specific hybridization.
- High stringency conditions include conditions which would distinguish a polynucleotide with an exact complementary sequence, or one containing only a few scattered mismatches from a random sequence that happened to have a few small regions (e.g., 3-10 bases) that matched the nucleotide sequence.
- Relatively high stringency conditions would include, for example, low salt and/or high temperature conditions, such as provided by about 0.02-0.1 M NaCl or the equivalent, at temperatures of about 50-70 °C.
- Such high stringency conditions tolerate little, if any, mismatch between the nucleotide sequence and the template or target strand, and are particularly suitable for detecting expression of any of the CARs constructs described herein. It is generally appreciated that conditions can be rendered more stringent by the addition of increasing amounts of formamide.
- the present disclosure also provides nucleic acids comprising a nucleotide sequence that is at least about 70% or more, e.g., about 80%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, or about 99% identical to any of the nucleic acids described herein. Also with the scope of the present disclosure are functional portions of the CAR constructs described herein.
- aspects of the present disclosure provide methods of treating a disease, disorder, or condition in a subject comprising administering to the subject a therapeutically effective amount of any of the CARs, nucleic acids, cells expressing any of the CARs, or pharmaceutical compositions described herein.
- the methods involve administering a therapeutically effective amount of a pharmaceutical composition comprising cells ⁇ e.g., a population of cells) expressing any of the CARs described herein.
- the disclosure provides a method of treating cancer in a subject, comprising administering to the subject a therapeutically effective amount of any of the CARs, nucleic acids, cells expressing any of the CARs, or pharmaceutical compositions described herein.
- the method is for treating a hematopoietic malignancy or pre-malignancy in a subject, comprising administering to the subject a therapeutically effective amount of a pharmaceutical composition comprising cells ⁇ e.g., a population of cells) expressing any of the CARs described herein.
- the disclosure provides methods for stimulating an immune response to a target cell or tissue ⁇ e.g., a cancer cell, tumor cell, or tumor tissue) in a subject comprising administering to a subject a therapeutically effective amount of a pharmaceutical composition comprising cells (e.g., a population of cells) expressing any of the CARs described herein.
- a pharmaceutical composition comprising cells (e.g., a population of cells) expressing any of the CARs described herein.
- the disclosure includes use of the modified cells described herein in the manufacture of a medicament for the stimulating an immune response in a subject in need thereof.
- the disclosure includes use of any of the CARs, nucleic acids, cells expressing any of the CARs, or pharmaceutical compositions described herein in the manufacture of a medicament for the treatment of a cancer in a subject in need thereof.
- the method involves use of any of the CARs, nucleic acids, cell expressing any of the CARs, or pharmaceutical compositions described herein in the manufacture of a medicament for the treatment of a tumor or cancer in a subject in need thereof. In some embodiments, the method involves use of any of the CARs, nucleic acids, cell expressing any of the CARs, or pharmaceutical compositions described herein in the manufacture of a medicament for the treatment of a hematopoietic malignancy or premalignancy in a subject in need thereof.
- the modified cells (e.g., immune cells, such as T-lymphocytes, NK cells) generated as described herein possess targeted effector activity.
- the modified cells have targeted effector activity directed against an antigen on a target cell, such as through specific binding to an antigen-binding domain of a CAR.
- the targeted effector activity includes, but is not limited to, phagocytosis, targeted cellular cytotoxicity, antigen presentation, and cytokine secretion.
- CAR construct materials are collectively referred to as “CAR construct materials.”
- the CAR construct materials described herein can be formulated into a composition, such as a pharmaceutical composition.
- the present disclosure provides a pharmaceutical composition comprising any of the CAR construct materials described herein and a pharmaceutically acceptable carrier.
- the pharmaceutical compositions containing any of the CAR construct materials can comprise more than one CAR construct material, e.g., a CAR construct and a nucleic acid, or two or more different CAR constructs.
- the pharmaceutical composition can comprise a CAR construct in combination with other pharmaceutically active agents or drugs, such as chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc.
- the pharmaceutical composition comprises a cell expressing any of the CAR constructs described herein or populations of such cells.
- the pharmaceutically acceptable carrier can be any of those conventionally used and is limited only by chemico-physical considerations, such as solubility and lack of reactivity with the active agent(s), and by the route of administration.
- Pharmaceutically acceptable carriers described herein, for example, vehicles, adjuvants, excipients, and diluents, are well known to those skilled in the art and are readily available to the public. It is preferred that the pharmaceutically acceptable carrier be one which has no detrimental side effects or toxicity under the conditions of use.
- the choice of carrier will be determined in part by the particular CAR construct material, as well as by the particular methods used to administer the CAR construct material, for example to a subject. Accordingly, there are a variety of suitable formulations of the pharmaceutical composition of the invention. Methods for preparing administrable (e.g., parenterally administrable) compositions are known or apparent to those skilled in the art and are described in more detail in, for example, Remington: The Science and Practice of
- the CAR construct materials may be administered in any suitable manner.
- CAR materials, including pharmaceutical compositions comprising any of the CAR materials are administered by injection, (e.g., subcutaneously, intravenously, intratumorally, intraarterially, intramuscularly, intradermally, interperitoneally, or intrathecally).
- CAR construct materials, including pharmaceutical compositions comprising any of the CAR materials are administered intravenously.
- CAR materials, including pharmaceutical compositions comprising any of the CAR materials are administered by infusion.
- a suitable pharmaceutically acceptable carrier for the CAR construct materials described herein for injection may include any isotonic carrier such as, for example, normal saline (about 0.90% w/v of NaCl in water, about 300 mOsm/L NaCl in water, or about 9.0 g NaCl per liter of water), NORMOSOL R electrolyte solution (Abbott, Chicago, IL), PLASMA-LYTE A (Baxter, Deerfield, IL), about 5% dextrose in water, or Ringer’s lactate.
- the pharmaceutically acceptable carrier is supplemented with human serum albumen.
- Amounts effective for a therapeutic or prophylactic use will depend on, for example, the stage and severity of the disease or disorder being treated, the age, weight, and general state of health of the patient, and the judgment of the prescribing physician.
- the size of the dose will also be determined by the active selected, method of administration, timing and frequency of administration, the existence, nature, and extent of any adverse side-effects that might accompany the administration of a particular active, and the desired physiological effect. It will be appreciated by one of skill in the art that various diseases or disorders could require prolonged treatment involving multiple administrations, for example using the CAR construct materials described herein in each or various rounds of administration.
- an exemplary dose of host cells may be a minimum of one million cells (1 x 10 6 cells/dose).
- the amount or dose of the CAR construct material administered should be sufficient to effect a therapeutic or prophylactic response in the subject or animal over a reasonable time frame.
- the dose of the CAR construct material should be sufficient to bind to antigen (i.e., CD33), or detect, treat or prevent cancer or hematopoietic malignancy or pre-malignancy, including reducing one or more symptoms and/or delaying the progression of the disease, in a period of from about 2 hours or longer, e.g., about 12 to about 24 or more hours, such as for about 1 day to 6 months or longer, from the time of administration. In some embodiments, the time period could be even longer.
- the dose will be determined by factors such as the efficacy of the particular CAR construct material, the condition of the animal (e.g., human), including the body weight of the animal (e.g., human) to be treated, and the severity of the disease in the subject.
- An assay which comprises, for example, comparing the extent to which target cells are lysed and/or IFN-gamma or IL-2 is secreted by cells expressing any o the CARs described herein upon administration of a given dose of such cells (e.g., T cells, NK cells) to a subject, among a set of subjects of which is each given a different dose of the cells, could be used to determine a starting dose to be administered to a subject.
- a given dose of such cells e.g., T cells, NK cells
- the extent to which target cells are lysed and/or IFN-gamma or IL-2 is secreted upon administration of a certain dose can be assayed by methods known in the art.
- one or more additional therapeutic agents can be coadministered to a subject.
- co-administering refers to administering one or more additional therapeutic agents and the CAR construct materials sufficiently close in time such that the CAR construct materials can enhance the effect of one or more additional therapeutic agents, or vice versa.
- CAR construct materials can be administered first and the one or more additional therapeutic agents can be administered second, or vice versa.
- CAR construct materials and the one or more additional therapeutic agents can be administered simultaneously.
- An exemplary therapeutic agent that may be coadministered with the CAR construct materials is IL-2.
- CAR construct materials described herein can be used in methods of treating or preventing a disease in a subject.
- the CAR constructs have biological activity, e.g., CARs that recognize antigen, e.g., CD33, such that the CARs, when expressed by a cell, are able to mediate an immune response against the cell expressing the antigen, e.g., CD33.
- the methods of treating or preventing a disease, disorder, or condition ⁇ e.g., cancer, e.g., hematopoietic malignancy or pre-malignancy) in a subject comprising administering to the mammal any of the CAR constructs, the nucleic acids, the recombinant expression vectors, the host cells, the population of cells, and/or the pharmaceutical compositions described herein in an amount effective to treat or prevent the disease, disorder, or condition in a subject (e.g., cancer, hematopoietic malignancy or pre-malignancy) in the subject.
- the method further comprises lymphodepleting the subject ⁇ e.g., mammal) prior to administering any of the CAR construct materials described herein.
- lymphodepletion include, but may not be limited to, nonmyeloablative lymphodepleting chemotherapy, myeloablative lymphodepleting chemotherapy, total body irradiation, etc.
- the cells expressing the cells or populations of such cells are administered, the cells can be cells that are allogeneic or autologous to the subject. In some embodiments, the cells are autologous to the subject.
- the disease, disorder, or condition is cancer.
- the cancer can be any cancer, including any of acute lymphocytic cancer, acute myeloid leukemia (AML), alveola rhabdomyosarcoma, bladder cancer (e.g., bladder carcinoma), bone cancer, brain cancer (e.g., medulloblastoma), breast cancer, cancer of the anus, anal canal, or anorectum, cancer of the eye, cancer of the intrahepatic bile duct, cancer of the joints, cancer of the neck, gallbladder, or pleura, cancer of the nose, nasal cavity, or middle ear, cancer of the oral cavity, cancer of the vulva, chronic lymphocytic leukemia (CLL), chronic myeloid cancer, colon cancer, esophageal cancer, cervical cancer, fibrosarcoma, gastrointestinal carcinoid tumor, head and neck cancer (e.g., head and neck squamous cell carcinoma), Ho
- the cancer is a hematological malignancy (e.g., leukemia or lymphoma, including but not limited to Hodgkin lymphoma, non-Hodgkin lymphoma, CLL, acute lymphocytic cancer, acute myeloid leukemia (AML), B -chronic lymphocytic leukemia, hairy cell leukemia, acute lymphocytic leukemia (ALL) (also referred to as “acute lymphoblastic leukemia”), B-ALL, BCP-ALL, B cell lymphoma, and Burkitt’s lymphoma).
- the cancer is characterized by the expression of CD33.
- the disease, disorder, or condition is a hematologic malignancy, or a cancer of the blood.
- the malignancy is a lymphoid malignancy or a myeloid malignancy.
- the disease, disorder, or condition is a hematopoietic malignancy.
- the disease, disorder, or condition is a leukemia, e.g., acute myeloid leukemia (AML).
- AML is characterized as a heterogeneous, clonal, neoplastic disease that originates from transformed cells that have progressively acquired critical genetic changes that disrupt key differentiation and growth- regulatory pathways.
- CD 123 is expressed on myeloid leukemia cells as well as on normal myeloid and monocytic precursors and is an attractive target for AML therapy.
- the hematopoietic malignancy or hematological disorder associated with CD 123 is a precancerous condition such as a myelodysplasia, a myelodysplastic syndrome or a preleukemia.
- Myelodysplastic syndromes are hematological medical conditions characterized by disorderly and ineffective hematopoiesis, or blood production. Thus, the number and quality of blood-forming cells decline irreversibly. Some patients with MDS can develop severe anemia, while others are asymptomatic.
- the classification scheme for MDS is known in the art, with criteria designating the ratio or frequency of particular blood cell types, e.g., myeloblasts, monocytes, and red cell precursors.
- MDS includes refractory anemia, refractory anemia with ring sideroblasts, refractory anemia with excess blasts, refractory anemia with excess blasts in transformation, chronic myelomonocytic leukemia (CML). In some embodiments, MDS can progress to an acute myeloid leukemia (AML).
- AML acute myeloid leukemia
- the treatment or prevention provided by the methods described herein can include treatment or prevention of one or more conditions or symptoms of the disease, e.g., cancer, being treated or prevented.
- aspects of the present disclosure also provide a method of detecting the presence of a disease, disorder, or condition ⁇ e.g., cancer) in a subject, comprising: (a) contacting a sample comprising one or more cells from the subject with any of the CAR constructs, the nucleic acids, the vectors, the host cells expressing any of the CARs, populations of such cells, or any of the pharmaceutical compositions described herein, thereby forming a complex, (b) and detecting the complex, wherein detection of the complex is indicative of the presence of the disease, disorder, or condition in the subject.
- the sample may be obtained by any suitable method, e.g., biopsy or necropsy.
- a biopsy is the removal of tissue and/or cells from an individual. Such removal may be to collect tissue and/or cells from the individual in order to perform experimentation on the removed tissue and/or cells. This experimentation may include experiments to determine if the individual has and/or is suffering from a certain condition or disease-state.
- the condition or disease may be, e.g., cancer, e.g., a hematopoietic malignancy or pre-malignancy..
- the sample comprising cells of the subject can be a sample comprising whole cells, lysates thereof, or a fraction of the whole cell lysates, e.g., a nuclear or cytoplasmic fraction, a whole protein fraction, or a nucleic acid fraction.
- the cells can be any cells of the subject, e.g., the cells of any organ or tissue, including blood cells or endothelial cells.
- the contacting of the sample with any of the CARs, nucleic acids, vectors, cells expressing any of the CARs, populations of such cells, or any of the pharmaceutical compositions described herein can take place in vitro or in vivo with respect to the subject.
- the contacting is in vitro.
- any of the CAR constructs, nucleic acids, vectors, host cells expressing any of the CARs, or populations of such cells, or any of the pharmaceutical compositions described herein can be labeled with a detectable label such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles).
- a detectable label such as, for instance, a radioisotope, a fluorophore (e.g., fluorescein isothiocyanate (FITC), phycoerythrin (PE)), an enzyme (e.g., alkaline phosphatase, horseradish peroxidase), and element particles (e.g., gold particles).
- FITC fluorescein isothio
- cytokines e.g., interferon-g, granulocyte/monocyte colony stimulating factor (GM-CSF), tumor necrosis factor alpha (TNF-a) or interleukin 2 (IL-2)
- cytokines e.g., interferon-g, granulocyte/monocyte colony stimulating factor (GM-CSF), tumor necrosis factor alpha (TNF-a) or interleukin 2 (IL-2)
- GM-CSF granulocyte/monocyte colony stimulating factor
- TNF-a tumor necrosis factor alpha
- IL-2 interleukin 2
- compositions and methods for the inhibition of a CD33 target antigen can involve, for example, the following steps: (1) administering a therapeutically effective amount of a cell or population of cells , e.g., an immune cell (e.g., a T lymphocyte, NK cell) to the patient, where the cell comprises a nucleic acid sequence encoding any of the CARs targeting CD33 described herein ; and (2) administering (e.g., infusing or reinfusing) the patient with hematopoietic stem cells, either autologous or allogeneic, where the hematopoietic cells have reduced expression of CD33.
- the hematopoietic cells are genetically modified to have reduced or eliminated expression of CD33.
- the hematopoietic cells are hematopoietic stem cells HSCs).
- the hematopoietic cells are hematopoietic progenitor cells (HPCs).
- HSCs Hematopoietic stem cells
- myeloid cells e.g., monocytes, macrophages, neutrophils, basophils, dendritic cells, erythrocytes, platelets, etc
- lymphoid cells e.g., T cells, B cells, NK cells
- HSCs are characterized by the expression of the cell surface marker CD34 (e.g., CD34+), which can be used for the identification and/or isolation of HSCs, and absence of cell surface markers associated with commitment to a cell lineage.
- CD34 e.g., CD34+
- the HSCs are peripheral blood HSCs.
- the hematopoietic cells are obtained from a subject, such as a mammalian subject.
- the mammalian subject is a non-human primate, a rodent (e.g., mouse or rat), a bovine, a porcine, an equine, or a domestic animal.
- hematopoietic cells e.g., HSCs
- a human patient such as a human patient having a hematopoietic malignancy or premalignancy.
- the hematopoietic cells are obtained from a healthy donor.
- the hematopoietic cells are obtained from the subject to whom the immune cells expressing the chimeric antigen receptors will be subsequently administered.
- HSCs may be obtained from any suitable source using convention means known in the art.
- HSCs are obtained from a sample from a subject, such as bone marrow sample or from a blood sample.
- HSCs may be obtained from an umbilical cord.
- the HSCs are from bone marrow or peripheral blood mononuclear cells (PBMCs).
- PBMCs peripheral blood mononuclear cells
- bone marrow cells may be obtained from iliac crest, femora, tibiae, spine, rib or other medullary spaces of a subject. Bone marrow may be taken out of the patient and isolated through various separations and washing procedures known in the art.
- An exemplary procedure for isolation of bone marrow cells comprises the following steps: a) extraction of a bone marrow sample; b) centrifugal separation of bone marrow suspension in three fractions and collecting the intermediate fraction, or buffycoat; c) the buffycoat fraction from step (b) is centrifuged one more time in a separation fluid, commonly FicollTM, and an intermediate fraction which contains the bone marrow cells is collected; and d) washing of the collected fraction from step (c) for recovery of re-transfusable bone marrow cells.
- a separation fluid commonly FicollTM
- HSCs typically reside in the bone marrow but can be mobilized into the circulating blood by administering a mobilizing agent in order to harvest HSCs from the peripheral blood.
- a mobilizing agent such as granulocyte colony- stimulating factor (G-CSF).
- the number of the HSCs collected following mobilization using a mobilizing agent is typically greater than the number of cells obtained without use of a mobilizing agent.
- a sample is obtained from a subject and is then enriched for a desired cell type (e.g. CD34+/CD33- cells).
- a desired cell type e.g. CD34+/CD33- cells.
- PBMCs and/or CD34+ hematopoietic cells can be isolated from blood as described herein.
- Cells can also be isolated from other cells, for example by isolation and/or activation with an antibody binding to an epitope on the cell surface of the desired cell type.
- Another exemplary method that can be used includes negative selection using antibodies to cell surface markers to selectively enrich for a specific cell type without activating the cell by receptor engagement.
- Populations of HSC can be expanded prior to or after genetically engineering the HSC to become deficient a target antigen (i.e., CD33).
- the cells may be cultured under conditions that comprise an expansion medium comprising one or more cytokines, such as stem cell factor (SCF), Flt-3 ligand (FLt3L), thrombopoietin (TPO), Interleukin 3 (IL-3), or Interleukin 6 (IL-6).
- SCF stem cell factor
- FLt3L Flt-3 ligand
- TPO thrombopoietin
- IL-3 Interleukin 3
- IL-6 Interleukin 6
- the cell may be expanded for about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 23, 25 days or any range necessary.
- HSCs are expanded after isolation of a desired cell population (e.g., CD34+/CD33-) from a sample obtained from a subject and prior to genetic engineering.
- a desired cell population e.g., CD34+/CD33-
- the HSC are expanded after genetic engineering, thereby selectively expanding cells that have undergone the genetic modification and are deficient in a lineage- specific cell-surface antigen.
- a cell (“a clone”) or several cells having a desired characteristic (e.g., phenotype or genotype) following genetic modification may be selected and independently expanded.
- the hematopoietic cells are genetically engineered to be deficient in a target antigen, e.g., a cell-surface lineage- specific antigen.
- a target antigen e.g., a cell-surface lineage- specific antigen.
- the hematopoietic cells are genetically engineered to be deficient in the same target antigen (e.g., cell- surface lineage- specific antigen) that is targeted by the CARs described herein.
- the hematopoietic cells are genetically engineered to be deficient in CD33.
- the hematopoietic cells are genetically engineered to be deficient in a domain of CD33.
- the hematopoietic cells are genetically engineered to be deficient in the IgV domain of CD33. In some embodiments, the hematopoietic cells are genetically engineered to be deficient in the IgC2 domain of CD33. In some embodiments, the hematopoietic cells are genetically engineered to be deficient in the immunoglobulin C domain of CD33.
- a hematopoietic cell is considered to be deficient in a target antigen (e.g., a cell-surface lineage-specific antigen) if the hematopoietic cell has substantially reduced expression of the target antigen (e.g., a cell-surface lineage- specific antigen) as compared to a naturally-occurring hematopoietic cell of the same type as the genetically engineered hematopoietic cell (e.g., is characterized by the presence of the same cell surface markers, such as CD34).
- the hematopoietic cell has no detectable expression of the target antigen (e.g., a cell-surface lineage- specific antigen).
- the expression level of a target antigen can be assessed by any means known in the art.
- the expression level of a target antigen e.g., a cell-surface lineage-specific antigen
- the expression level of a target antigen can be assessed by detecting the antigen with an antigen-specific antibody (e.g., flow cytometry methods, Western blotting) and/or by measuring the level of a transcript encoding the antigen ⁇ e.g., RT-qPCR, microarray).
- the expression of the target antigen ⁇ e.g., a cell- surface lineage-specific antigen) on the genetically engineered hematopoietic cell is compared to the expression of the target antigen ⁇ e.g., a cell- surface lineage-specific antigen) on a naturally occurring hematopoietic cell.
- the genetic engineering results in a reduction in the expression level of the target antigen ⁇ e.g., a cell-surface lineage- specific antigen) by at least about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% as compared to the expression of the target antigen ⁇ e.g., a cell-surface lineage-specific antigen) on a naturally occurring hematopoietic cell.
- the target antigen e.g., a cell-surface lineage-specific antigen
- the hematopoietic cell is deficient in the whole endogenous gene encoding the target antigen ⁇ e.g. , a cell-surface lineage-specific antigen).
- the whole endogenous gene encoding the target antigen ⁇ e.g., a cell- surface lineage-specific antigen has been deleted.
- the hematopoietic cell comprises a portion of endogenous gene encoding the target antigen ⁇ e.g., a cell-surface lineage-specific antigen).
- the hematopoietic cell expressing a portion (e.g. a truncated protein) of the target antigen ⁇ e.g., a cell- surface lineage- specific antigen).
- a portion of the endogenous gene encoding the target antigen ⁇ e.g., a cell-surface lineage- specific antigen) has been deleted. In some embodiments, at least 10%, 20%, 30%, 40%, 50%, 60%, 70% or more of the gene encoding the target antigen ⁇ e.g., a cell-surface lineage- specific antigen) has been deleted.
- a portion of the nucleotide sequence encoding the target antigen may be deleted or one or more non-coding sequences, such that the hematopoietic cell is deficient in the antigen (e.g., has substantially reduced expression of the antigen).
- the target antigen ⁇ e.g., a cell-surface lineage- specific antige)n is CD33.
- the predicted structure of CD33 includes two immunoglobulin domains, an IgV domain and an IgC2 domain. In some embodiments, a portion of the immunoglobulin C domain of CD33 is deleted.
- any of the genetically engineering hematopoietic cells, such as HSCs, that are deficient in a a target antigen ⁇ e.g., a cell- surface lineage-specific antigen) can be prepared by a routine method or by a method described herein.
- the genetic engineering is performed using genome editing.
- genome editing refers to a method of modifying the genome, including any protein-coding or non-coding nucleotide sequence, of an organism to knock-out the expression of a target gene.
- genome editing methods involve use of an endonuclease that is capable of cleaving the nucleic acid of the genome, for example at a targeted nucleotide sequence. Repair of the double- stranded breaks in the genome may be repaired introducing mutations and/or exogenous nucleic acid may be inserted into the targeted site.
- Genome editing methods are generally classified based on the type of endonuclease that is involved in generating double stranded breaks in the target nucleic acid. These methods include use of zinc finger nucleases (ZFN), transcription activator-like effector-based nuclease (TALEN), meganucleases, and CRISPR/Cas systems. Methods of editing the genome of HSCs described herein can be found, e.g., in WO 2017/066760, incorporated by reference herein.
- any of the C ARs comprising an antigen-binding domain that binds to a cell-surface lineage-specific antigen (e.g., CD33 CAR), nucleic acids, vectors, cells expressing any of the CARs, and/or pharmaceutical compositions described herein may be administered to a subject in combination with hematopoietic cells that are deficient for the antigen ⁇ e.g., cell-surface lineage-specific antigen (i.e ., CD33)).
- a cell-surface lineage-specific antigen e.g., CD33 CAR
- the agents and/or the hematopoietic cells may be mixed with a pharmaceutically acceptable carrier to form a pharmaceutical composition, which is also within the scope of the present disclosure.
- an effective amount of the any of the CARs that target CD33, nucleic acids, vectors, cells expressing any of the CARs, and/or pharmaceutical compositions described herein and an effective amount of hematopoietic cells can be co-administered to a subject in need of the treatment.
- the hematopoietic cells and/or cells expressing chimeric antigen receptors ⁇ e.g., immune cells may be autologous to the subject, i.e., the cells are obtained from the subject in need of the treatment, genetically engineered to be deficient for expression of the target antigen ⁇ e.g., cell-surface lineage- specific antigen) or for expression of the chimeric antigen receptor constructs, and then administered to the same subject.
- Administration of autologous cells to a subject may result in reduced rejection of the host cells as compared to administration of non-autologous cells.
- the hematopoietic cells and/or cells expressing chimeric antigen receptors are allogeneic cells, i.e., the cells are obtained from a first subject, genetically engineered to be deficient for expression of the target antigen ⁇ e.g., cell-surface lineage- specific antigen) or for expression of the chimeric antigen receptor constructs, and administered to a second subject that is different from the first subject but of the same species.
- allogeneic immune cells may be derived from a human donor ⁇ e.g., a healthy donor) and administered to a human recipient who is different from the donor.
- the cells ⁇ e.g., immune cells) expressing any of the CARs described herein and/or hematopoietic cells are allogeneic cells and have been further genetically engineered to reduced graft-versus-host disease.
- the hematopoietic stem cells may be genetically engineered (e.g., using genome editing) to have reduced expression of CD45RA.
- the cells ⁇ e.g., immune cells) expressing any of the chimeric antigen receptors described herein are administered to a subject in an amount effective in to reduce the number of target cells (e.g., cancer cells, malignant cells) by least
- 20% e.g., 50%, 80%, 100%, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100 fold or more.
- a typical amount of cells, i.e., cells ⁇ e.g., immune cells) expressing any of the CARs described herein or hematopoietic cells, administered to a mammal (e.g., a human) can be, for example, in the range of one million to 100 billion cells; however, amounts below or above this exemplary range are also within the scope of the present disclosure.
- the daily dose of cells can be about 1 million to about 50 billion cells (e.g., about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, or a range defined by any two of the foregoing values), preferably about 10 million to about 100 billion cells (e.g., about 20 million cells, about 30 million cells, about 40 million cells, about 60 million cells, about 70 million cells, about 80 million cells, about 90 million cells, about 10 billion cells, about 25 billion cells, about 50 billion cells, about 75 billion cells, about 90 billion cells, or a range defined by any two of the foregoing values), more preferably about 100 million cells to about 50 billion cells (e.g., about 120 million cells, about 350 million cells, about 350 million cells, about 450 million cells, about 650 million cells, about 800 million cells, about 900 million cells, about 3 billion cells, about 30 billion cells, about 45 billion cells, or a range defined by any two of the foregoing values
- the chimeric receptor (e.g., a nucleic acid encoding the chimeric receptor) is introduced into a cell ⁇ e.g., an immune cell), and the subject (e.g., human patient) receives an initial administration or dose of the cells expressing the chimeric antigen receptor.
- the subject e.g., human patient
- One or more subsequent administrations of the cells expressing the chimeric antigen receptor may be provided to the patient at intervals of 15 days, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 days after the previous administration. More than one dose of the cells expressing the chimeric antigen receptor can be administered to the subject per week, e.g., 2, 3, 4, or more administrations of the cells.
- the subject may receive more than one doses of the cells (e.g., an immune cell expressing a chimeric receptor) per week, followed by a week of no administration of the cells, and finally followed by one or more additional doses of the cells (e.g., more than one administration of immune cells expressing a chimeric receptor per week).
- the cells ⁇ e.g., immune cells) expressing a chimeric antigen receptor may be administered every other day for 3 administrations per week for two, three, four, five, six, seven, eight or more weeks.
- the methods involve administration of cells ⁇ e.g., immune cells) expressing the CAR targeting CD33 and a population of hematopoietic cells deficient in the antigen (e.g., CD33). Accordingly, in such therapeutic methods, the CAR recognizes (binds) a target cell expressing the target antigen for targeting killing.
- the hematopoietic cells that are deficient in the target antigen allow for repopulation of a cell type that is targeted by the cells/C ARs.
- the treatment of the patient can involve the following steps: (1) administering a therapeutically effective amount of cells ⁇ e.g., immune cells) expressing the CAR targeting CD33 to the patient and (2) infusing or reinfusing the patient with hematopoietic stem cells, either autologous or allogenic, where the hematopoietic cells have reduced expression of the target antigen.
- a therapeutically effective amount of cells ⁇ e.g., immune cells
- hematopoietic stem cells either autologous or allogenic, where the hematopoietic cells have reduced expression of the target antigen.
- the treatment of the patient can involve the following steps: (1) administering a therapeutically effective amount of cells ⁇ e.g., an immune cell) expressing a chimeric antigen receptor to the patient, wherein the cell comprises a nucleic acid sequence encoding a chimeric antigen receptor that binds a cell- surface lineage-specific, disease-associated antige(ne.g. , CD33); and (2) infusing or reinfusing the patient with hematopoietic cells (e.g., hematopoietic stem cells), either autologous or allogenic, where the hematopoietic cells have reduced expression of a lineage specific disease-associated antigen (e.g., CD33).
- hematopoietic cells e.g., hematopoietic stem cells
- the efficacy of the therapeutic methods using any of the CARs, nucleic acids, vectors, cells expressing any of the CARs, or pharmaceutical compositions comprising antigenany of the foregoing described herein and a population of hematopoietic cells deficient in the target antigen may be assessed by any method known in the art and would be evident to a skilled medical professional.
- the efficacy of the therapy may be assessed by survival of the subject or cancer burden in the subject or tissue or sample thereof.
- the efficacy of the therapy is assessed by quantifying the number of cells belonging to a particular population or lineage of cells.
- the efficacy of the therapy is assessed by quantifying the number of cells presenting the target antigen.
- the CARs, nucleic acids, vectors, cells expressing any of the CARs, or pharmaceutical compositions comprising any of the foregoing described herein and the population of hematopoietic cells is administered concomitantly.
- any of the CARs, nucleic acids, vectors, cells expressing any of the CARs, or pharmaceutical compositions comprising isany of the foregoing described herein are is administered prior to administration of the hematopoietic cells.
- any of the CARs, nucleic acids, vectors, cells expressing any of the CARs, or pharmaceutical compositions comprising any of the foregoing described herein are administered at least about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 3 months, 4 months, 5 months, 6 months or more prior to administration of the hematopoietic cells.
- the hematopoietic cells are administered prior to the any of the CARs, nucleic acids, vectors cells expressing any of the CARs, or pharmaceutical compositions comprising any of the foregoing described herein.
- the population of hematopoietic cells is administered at least about 1 day, 2 days, 3 days, 4 days,
- any of the CARs, nucleic acids, vectors, cells expressing any of the CARs, or pharmaceutical compositions comprising any of the foregoing described herein and the population of hematopoietic cells are administered at substantially the same time.
- any of the CARs, nucleic acids, vectors, cells expressing any of the CARs, or pharmaceutical compositions comprising any of the foregoing described herein is administered and the patient is assessed for a period of time, the population of hematopoietic cells is administered and the patient is assessed for a period of time, after which any of the CARs, nucleic acids, vectors, cells expressing any of the CARs, or pharmaceutical compositions comprising any of the foregoing described herein is administered.
- any of the CARs, nucleic acids, vectors, cells expressing any of the CARs, or pharmaceutical compositions comprising any of the foregoing described herein and/or populations of hematopoietic cells are administered to the subject once.
- any of the CARs, nucleic acids, vectors, cells expressing any of the CARs, or pharmaceutical compositions comprising any of the foregoing described herein and/or populations of hematopoietic cells are administered to the subject more than once (e.g., at least 2, 3, 4, 5, or more times).
- any of the CARs, nucleic acids, vectors, cells expressing any of the CARs, or pharmaceutical compositions comprising any of the foregoing described herein and/or populations of hematopoietic cells are administered to the subject at a regular interval, e.g., every six months.
- the subject is a human subject having a hematopoietic malignancy or pre-malignancy.
- the subject is a human subject that has been diagnosed with a hematopoietic malignancy or pre-malignancy.
- a hematopoietic malignancy refers to a malignant abnormality involving hematopoietic cells (e.g., blood cells, including progenitor and stem cells).
- hematopoietic malignancies and or pre-malignancies include, without limitation, Hodgkin's lymphoma, non- Hodgkin's lymphoma, leukemia, or multiple myeloma.
- Leukemias include acute myeloid leukemia (AML), myelodysplastic syndrome (MDS), chronic myelogenous leukemia, chronic lymphoblastic leukemia, and chronic lymphoid leukemia.
- AML acute myeloid leukemia
- MDS myelodysplastic syndrome
- a target antigen e.g., the cell- surface lineage-specific antigen ⁇ e.g. , CD33
- kits may include one or more containers comprising a first pharmaceutical composition that comprises any of the CARs, nucleic acids, vectors, and/or cells expressing any of the CARs described herein, and a pharmaceutically acceptable carrier, and a second pharmaceutical composition that comprises a population of hematopoietic cells that are deficient in a target antigen (e.g.., CD33), or a portion thereof, and a pharmaceutically acceptable carrier.
- a target antigen e.g., CD33
- the kit can comprise instructions for use in any of the methods described herein.
- the included instructions can comprise a description of administration of the first and second pharmaceutical compositions to a subject to achieve the intended activity in a subject.
- the kit may further comprise a description of selecting a subject suitable for treatment based on identifying whether the subject is in need of the treatment.
- the instructions comprise a description of administering the first and second pharmaceutical compositions to a subject who is in need of the treatment.
- the instructions relating to the use of the CARs, nucleic acids, vectors, and/or cells expressing any of the CARs described herein and the first and second pharmaceutical compositions described herein generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
- the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses.
- Instructions supplied in the kits of the disclosure are typically written instructions on a label or package insert.
- the label or package insert indicates that the pharmaceutical compositions are used for treating, delaying the onset, and/or alleviating a disease or disorder in a subject.
- kits provided herein are in suitable packaging.
- suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging, and the like.
- packages for use in combination with a specific device such as an inhaler, nasal administration device, or an infusion device.
- a kit may have a sterile access port (for example, the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- the container may also have a sterile access port.
- At least one active agent in the pharmaceutical composition is a chimeric receptor variants as described herein.
- Kits optionally may provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container. In some embodiment, the disclosure provides articles of manufacture comprising contents of the kits described above.
- nucleic acid constructs comprising a minimal nuclear factor of activated T cells (NFAT)-responsive promoter, which may be used, for example, to assess chimeric antigen receptors (CARs) and activation of a cell (e.g., T cells) expressing the CARs.
- CAR activation sets in motion an intracellular pathway leading to T-cell activation and effector function of the T cell, which involves NFAT signaling and gene expression (see, e.g., Hogan, Cell Calcium. (2017)63:66-9).
- NFAT -responsive promoter refers to a promoter region that is activated by NFAT signaling and promotes expression of a gene that is operably linked to the NFAT -responsive promoter upon activation.
- the gene that is operably linked (under control of) the NFAT -responsive promoter encodes a reporter molecule.
- Nuclear factor of activated T-cells is a family of transcription factors, include NFAT 1 -NFAT -5 , that are involved regulating immune responses, including regulating interleukin-2 (IL-2 expression) as well as T cell differentiation and self-tolerance.
- NFAT transcription factors comprise two components: a cytoplasmic Rel domain protein (NFAT family member) and a nuclear component comprising various transcription factors (Chow, Molecular and Cellular Biology, 1999; 19(3):2300-7).
- NFAT 1 and NFAT2 are predominantly expressed in peripheral T cells that produce IL-2 and NFAT binding sites are generally found upstream (5’) of NFAT -regulated genes, such as IL-2 .
- NFAT -regulated genes such as IL-2 .
- a promoter operably linked to a gene typically includes a core promoter adjacent and 5’ to the transcription start site of the gene (coding sequence). Further upstream (5’) of the core promoter may be cis-regulatory regions, such as transcription factor binding site(s).
- the NFAT -responsive promoter comprises a plurality of NFAT -binding sites. In some embodiments, the NFAT -responsive promoter comprises least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more NFAT binding sites. . In some embodiments, the NFAT -responsive promoter comprises six NFAT binding sites.
- each of the NFAT binding sites of a NFAT -responsive promoter may be the same NFAT binding site ⁇ e.g., bind the same type of NFAT transcription factor) or be different NFAT binding sites ⁇ e.g., bind different types of NFAT transcription factors).
- each of the NFAT binding site comprises the same nucleotide sequence. In some embodiments, the NFAT binding sites comprise different nucleotide sequence.
- NFAT binding site is provided by the nucleotide sequence provided by SEQ ID NO: 84:
- At least one of the NFAT binding site comprises the nucleotide sequence of SEQ ID NO: 84. In some embodiments, each of the NFAT binding site comprises the nucleotide sequence of SEQ ID NO: 84.
- Each of the NFAT binding sites are located immediately adjacent to one another ⁇ e.g., in tandem without any additional nucleotides between the NFAT binding sites). Alternatively, one or more additional nucleotides may be present between two or more of the NFAT binding sites.
- the NFAT -responsive promoter comprises an IL-2 promoter, or portion thereof. In some embodiments, the NFAT -responsive promoter comprises a minimal IL-2 promoter. In some embodiments, the NFAT -responsive promoter comprises the core IL-2 promoter.
- the naturally occurring IL-2 promoter is relative compact and includes a core promoter containing a TATA box and an upstream regulatory region. The core promoter is considered the region within approximately -40 and +40 nucleotides ⁇ e.g., 40 nucleotides upstream (5’) to 40 nucleotides downstream (3’)) of the transcription start site. See, e.g., Weaver et al. Mol. Immunol. (2007) 44(11) 2813-2819.
- the term “minimal IL-2 promoter” refers to the minimal portion of the IL-2 promoter requires for transcription.
- the minimal IL-2 promoter is the IL-2 core promoter.
- the NFAT -responsive promoter comprises the core IL-2 promoter comprising a TATA box.
- a TATA box (also referred to as a “Goldberg-Hogness box”) is a T/A rich sequence found upstream of a transcriptional start site (Shi & Zhou, BMC Bioinformatics (2006) 7, Article number S2).
- the TATA box comprises the consensus sequence 5'- TATA(A/T)A(A/T)-3'. The TATA box is thought to be involved in formation of the preinitiation complex for gene transcription and bind a TATA-binding protein (TBP).
- the minimal IL-2 promoter comprises the nucleotide sequence of SEQ ID NO: 85.
- nucleotide sequence provided by SEQ ID NO: 85:
- the NEAT binding sites are located 5’ (upstream) of the minimal IL-2 promoter. In some embodiments, the NEAT binding sites are located at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28,
- the NEAT responsive promoter comprises at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 4041, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more nucleotides between the last NEAT binding site and the minimal IL-2 promoter.
- nucleotide sequence of a minimal NFAT-responsive promoter is provided by SEQ ID NO: 86.
- the nucleotide sequence of the minimal NFAT-responsive promoter comprises, consists of, or consists essentially of the nucleotide sequence of SEQ ID NO: 86, or a sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical the nucleotide sequence of SEQ ID NO: 86.
- Exemplary nucleotide sequence of a minimal NFAT-responsive promoter comprising 6 NEAT binding sites (SEQ ID NO: 86):
- nucleic acid constructs encoding an IL-2 reporter system described herein may further comprise a nucleotide sequence encoding a second reporter molecule operably linked (under the control of) a constitutive promoter (also referred to as a constitutively active promoter).
- a constitutive promoter also referred to as a constitutively active promoter
- the reporter molecule that is operably linked to the minimal NFAT -responsive promoter is different than the second reporter molecule operably linked to the constitutively active promoter, such that detection of the reporter molecule that is operably linked to the minimal NFAT -responsive promoter is indicative of activity of the NFAT -responsive promoter and detection of the reporter molecule that is operably linked to the constitutively active promoter is indicative of activity of the constitutively active promoter.
- the constitutive promoter controlling expression of the second reporter molecule is referred to as a “reference promoter.”
- constitutively active promoter include, without limitation, EF-1 alpha (EFl ⁇ ), CMV promoter, SV40 promoter, PGK1 promoter, Ubc promoter, beta actin promoter, CAG promoter, TRE promoter, UAS promoter, Ac5 promoter, polyhedrin promoter, and U6 promoter.
- the constitutively active promoter is an EFl ⁇ promoter.
- nucleotide sequence of an elongation factor 1 alpha (EF-1 alpha) promoter is provided by the nucleotide sequence of SEQ ID NO: 87.
- the nucleic acid constructs described herein comprise a reporter molecule operably linked (under control of) a minimal NF AT -responsive promoter.
- the nucleic acid construct comprises a second reporter molecule operably linked (under control of) a constitutively active promoter.
- Any suitable reporter molecule(s) may be used in the nucleic acid constructs described herein.
- a reporter molecule a reporter protein
- the reporter molecule may be referred to as a screenable marker.
- reporter molecules include, without limitation, enzymes, such as ⁇ -glucuronidase, a- galactosidase, ⁇ -lactamase, and tyrosinase; luciferase; fluorescent markers/proteins.
- enzymes such as ⁇ -glucuronidase, a- galactosidase, ⁇ -lactamase, and tyrosinase
- luciferase fluorescent markers/proteins.
- Fluorescent proteins include, but are not limited to, green fluorescent protein (GFP), red fluorescent protein (RFP), blue fluorescent protein (BFP), EBFP, cyan fluorescent protein, ECFP, EG fluorescent protein,, yellow fluorescent protein, mWasabi, ZsGreen, yellow fluorescent protein (YFP), Zs Yellow, mHoneydew, mApple, mRuby, mBanana, mOrange, mCherry, mCerulean, mTurquoise, mTangerine, mStrawberry, mGrape, mRaspberry, and mPlum. Selection of a suitable reporter molecule, such as a fluorescent protein, may depend on factors such as the means for detecting and/or quantifying the reporter molecule.
- the nucleic acid constructs described herein comprise a reporter molecule operably linked (under control of) a minimal NFAT-responsive promoter.
- the nucleic acid construct comprises a second reporter molecule operably linked (under control of) a constitutively active promoter.
- Any suitable reporter molecule(s) may be used in the nucleic acid constructs described herein.
- a reporter molecule a reporter protein
- the reporter molecule may be referred to as a screenable marker.
- reporter molecules include, without limitation, enzymes, such as ⁇ -glucuronidase, a-galactosidase, ⁇ -lactamase, and tyrosinase; luciferase; fluorescent markers/proteins.
- enzymes such as ⁇ -glucuronidase, a-galactosidase, ⁇ -lactamase, and tyrosinase
- luciferase fluorescent markers/proteins.
- Fluorescent proteins include, but are not limited to, green fluorescent protein (GFP), red fluorescent protein (RFP), blue fluorescent protein (BFP), EBFP, cyan fluorescent protein, ECFP, EG fluorescent protein,, yellow fluorescent protein, mWasabi, ZsGreen, yellow fluorescent protein (YFP), Zs Yellow, mHoneydew, mApple, mRuby, mBanana, mOrange, mCherry, mCerulean, mTurquoise, mTanerine, mStrawberry, mGrape, mRaspberry, and mPlum. Selection of a suitable reporter molecule, such as a fluorescent protein, may depend on factors such as the means for detecting and/or quantifying the reporter molecule.
- the reporter molecule is a fluorescent protein.
- the reporter molecule operably linked to the NFAT-responsive promoter is a fluorescent protein.
- fluorescent protein is mTurquoise or mOrange.
- a nucleotide sequence encoding mTurquoise is provided by SEQ ID NO: 88.
- mTurquoise (SEQ ID NO: 88).
- a nucleotide sequence encoding mOrange is provided by SEQ ID NO: 89.
- mOrange (SEQ ID NO: 89)
- CAR constructs are developed with CD33 specific single chain fragment variable sequences (scFv) or single domain antibody fragments (sdAb), linked with either a CD8a or CD28 transmembrane domain, paired with either a 4- IBB or CD28 co-stimulatory domain, and a CD3 ⁇ (zeta) signaling domain.
- the CAR sequences were cloned in a third- generation lentiviral plasmid.
- the scFv or sdAb of the CD33 CAR constructs were derived from the following:
- Lintuzumab Hul95, SGN-33) (Co et al conflict J. Immunol. (1992), 148: 1149-54 (1992)) Ml 95, which is the non-humanized version of Lintuzumab.
- CD33Mylo (gemtuzumab ozogamicin, Trade name: Mylotarg, Company: Wyeth, humanized mAb/calicheamicin, CD33; U.S. Pat. No. 5,739,116; Cowan et al., Front Biosci (Landmark Ed) (2013), 18: 1311-34). Also noted, in some cases, as “hP67.6”.
- M9.6 Binding domain Three configurations using the antigen binding domain of M9.6 were evaluated and included the following:
- VH-CDR3 LGGSLPD Y GMD V (SEQ ID NO: 27)
- VH-CDR3 RGGYSDYDYYFDF (SEQ ID NO: 31)
- the GFP and luciferase expressing AML cells lines MV411, THP1, and MOLM14 contain varying levels of CD33 expression, and different genotypes for an exon 2 splice variance (Laszlo et al., Oncotarget, 7: 43281-94 (2016)) will be used to test the efficacy of the CAR constructs described above.
- MOLM14 has a CC genotype and does not contain the SNP, while TE1P1 and MV411 are both heterozygous for the SNP with the CT genotype (Lamba et al., J. Clin. Oncol., 35: 2674- 82 (2017)).
- This cell line does not express neither CD33 nor CD123.
- MV411 is an acute monocytic leukemia line established from a 10-year-old boy with acute monocytic leukemia (AML FAB M5).
- MOLM14 is an acute myeloid leukemia line established from the peripheral blood of a 20-year-old man with acute myeloid leukemia AML FAB M5a at relapse in 1995 after initial myelodysplastic syndrome (MDS, refractory anemia with excess of blasts, RAEB).
- THP-1 is a human monocytic cell line derived from an acute monocytic leukemia patient.
- K562 is a human erythroleukemia leukemia line established and derived from a 53 -year-old female chronic myelogenous leukemia patient.
- the CD33 CAR-encoding lentiviral vectors are produced by transient transfection of the Lenti-X 293T lenti packaging cell line Lenti-X 293T cells and plated into poly-D lysine coated 15-cm plates (BD Biosciences, San Jose, CA, USA). The following day, Lenti-X 293T cells are transfected using lipofectamine 3000 (Thermo Fisher Scientific, Waltham, MA, USA) with plasmids encoding the CAR along with packaging and envelope vectors (pMDLg/pRRE, pMD-2G, and pRSV-Rev).
- Lentiviral supernatants are harvested at 24 and 48 hours post-transfection, centrifuged at 3000 RPM for 10 minutes to remove cell debris, and frozen on dry ice and stored at -80°C.
- Human PBMCs from normal donors are obtained with an NIH-approved protocol and activated with a 1:3 ratio of CD3/CD28 microbeads (Dynabeads Human T-Expander CD3/CD28, Thermo Fisher Scientific, Cat#
- AIM-V media containing 40 IU/mL recombinant IL-2 and 5% FBS for 24 hours.
- Activated T cells are resuspended at 2 million cells per 2 mL of lentiviral supernatant plus 1 mL of fresh AIM-V media with 10 mcg/mL protamine sulfate and 100 IU/mL IL-2 in 6- well plates. Plates were centrifuged at 1000 x g for 2 hours at 32°C and incubated overnight at 37°C. A second transduction is performed on the following day by repeating the same transduction procedure described above.
- the CD3/CD28 beads were removed on the third day following transduction, and the cells were cultured at 300,000 cells/mL in AIM-V containing 100 IU/mL IL2 with fresh IL2-containing media added every 2-3 days until harvest on day 8 or 9.
- CD33 CAR-transduced T cells Surface expression of CD33 CAR-transduced T cells is determined by flow cytometry using either protein-L (Themo Fisher) or a Biotinylated Human Siglec-3 / CD33 Protein (Aero Biosystems, Newark, DE, USA) followed by incubation with Streptavidin-PE (BioLegend, San Diego, CA, USA).
- PDX BioLegend-PE
- 5E4 of Target tumor cells in 100 pi of RPMI media are loaded into a 96-well plate (Coming® (Craning, NY) BioCoatTM Poly-L-Lysine 96-Well Clear TC-Treated Flat Bottom Assay Plate).
- An equal amount of CAR T cells are added into the designated well on the following day.
- the initial incucyte apoptosis marker (Essen BioScience, Ann Arbor, MI, USA) is diluted in ⁇ PBS and ⁇ of the diluent was added into each well.
- the plate is scanned for the GFP and or REP fluorescent expression to monitor the cell apoptosis using an IncuCyte ZOOM® system every 30 minutes in a duration of 40 hours. The percentage of cell killing at each time point is baseline-corrected.
- Target tumor cell and transduced CAR positive T cells are washed 3 times with 1XPBS and resuspended in RPMI at lE6/ml. 100 ⁇ of tumor cells with ⁇ of CAR positive T cells are loaded into each well of a 96-well plate. T cell only and tumor cell only controls are set up. All tests are performed in duplicate or triplicate. Cells are incubated for 18 hours at 37°C and 120 ul of the culture supernatant was harvested for detection of cytokine production. Cytokine levels in supernatants were measured using either ELISA kits (R&D Systems, Minneapolis, MN, EISA) or a multiplex assay (Meso Scale Discovery, Rockville, MD, EISA).
- the CAR-T cells are suspended in serum-free unbuffered DMEM medium (Sigma- Aldrich, St. Louis, MO, USA) supplemented with L- glutamine (200 mM) and NaCl (143 mM). 0.6 mL of a 0.5% Phenol Red solution (SigmaP0290) is added for a final concentration of 3 mg/L and adjust the pH to7.35+/-0.05.
- CAR-T cells are plated onto Seahorse cell plates (3E5 cells per well), coated with Cell-Tak (Coming) to facilitate T cell attachment. Briefly, the cartridges are hydrated the day before the assay.
- the plates are coated with Cell-Tak and the cells are seeded in the Cell-Tak coated plates and placed on the XF24 Analyzer for the assay.
- the detailed procedure is as follows.
- the assay cartridge is initially hydrated with XF calibrant solution at 200ul/well, hydro booster is added, and is wrapped in parafilm, and the sensor cartridge is placed on top of utility plate and incubated at 37 °C without CO2 for overnight.
- the cell culture plate is then coated with Cell-Tak as follows: For 1 plate, 46 mi of Cell-Tak was diluted in 204 mi TC water and 1 ml of NaHCOg.
- the mixer is dispensed 50 mi in each well and the plate is incubated at room temperature for at least 20 minutes.
- CAR-T cells (3E5/well) are plated in 158 mi assay media.
- the cell culture plate is then spun at 450 rpm for 1 sec at slow acceleration and no deceleration, and then the plate was reversed in orientation and spun at 650 rpm for 1 sec at slow acceleration and no deceleration.
- the plate is then incubated at 37 °C 0% C02 for 25-30 minutes. After 25-30 minutes incubation, 15 Sul of warm assay medium is added slowly and gently to the top of each well along the side of the wall using a manual P200 pipettor. The cell plates are incubated for 15-25 minutes.
- XF24 Analyzer After 15-25 minutes, the plates are placed on XF24 Analyzer (after calibration finished). The XF assay is executed. Solution is injected sequentially through three ports: Port A: glucose 80 mM (96 mL of the stock solution in 3 ml assay media). Port B: oligomycin 18mM (10.8 mi of the stock solution in 3 ml assay media). Port C: 2DG use stock solution. Glycolysis stress test is performed by measuring ECAR (mpH/min) at steady state after the cartridge ports are loaded with 75 mL of drug solution. For the mitochondrial stress test, CAR T cells are suspended in serum-free unbuffered DMEM medium with D-glucose (25 mM), and sodium pyruvate (1 mM).
- Mitochondrial stress test is performed similarly as the above by measuring OCR (pmol/min) at steady state and after sequential injection of oligomycin (0.5 mM), FCCP (0.5 mM), rotenone (1 mM) and antimycin A (1 mM) (Sigma-Aldrich).
- OCR pmol/min
- FCCP 0.5 mM
- rotenone 0.5 mM
- antimycin A 1 mM
- MOLM14 (4x10s) tumor cells are plated in 1 ml of warm RPMI on the Cell- tak coated inner well of an ibidi m-Dish 35 mm and incubated overnight in a 37C incubator. Tumor cells are then stained with Hoechst Dye (2.5ug/ml). T cells are transduced to express CAR- mCherry fusion proteins. CAR-T positive cells are sorted and then 7.5 E5 of these CAR-T cells are incubated with the fixed MOLM14 cell in the dish for an hour. The cells are subsequently washed and fixed with freshly prepared 4% paraformaldehyde and mounted in a non-hardening mounting media in preparation for imaging.
- Some images will be acquired using a Nikon Eclipse Ti2 spinning disc confocal microscope with 63x objective. Z stacks of 0.5 uM thickness will be acquired in parallel over a range of 10 uM above and below the focal plane for the three channels (405, 488, 640 nm). Each channel is excited at 50% laser intensity with exposure times of 300 ms,
- Image! software is used for data analysis.
- Exemplary nucleic acid constructs were designed to encode a reporter molecule operably linked to a minimal NFAT-responsive promoter and a second reporter molecule operably linked to a constitutive promoter (e.g., EFl ⁇ ).
- the minimal NFAT- responsive promoter contained 6 NFAT binding sites upstream of a minimal IL-2 promoter comprising a TATA box and the coding sequence of the reporter molecule.
- the nucleic acids were produced using conventional methods known in the art.
- the first nucleic acid construct (EFl ⁇ _mOrange_IL-2_mTurq) contained the mOrange reporter molecule under control of the constitutively active ElFalpha promoter and mTurquoise reporter molecule (mTurq) under control of the minimal NFAT-responsive promoter.
- the second nucleic acid construct (EFl ⁇ _mTurq_IL-2_mOrange) contained the mTurquoise reporter molecule under control of the constitutively active ElFalpha promoter and mOrange reporter molecule under control of the minimal NFAT-responsive promoter.
- Two IL-2 reporter cell lines were generated by transducing the lentiviral vectors into Jurkat cells.
- the minimal NEAT -responsive promoter induces expression of the reporter molecule when activated.
- Expression of the reporter molecule under control of the minimal NEAT -responsive promoter relative to expression of reporter molecule under control of EFl ⁇ (the constitutive promoter) provides a means of normalizing expression to account for factors, such as any differing transduction efficiencies between the constructs.
- CD33 also known as Siglec (Sialic-acid-binding immunoglobulin-like lectin) plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state.
- CD33 is expressed on the surface of the vast majority of AML blasts and chronic myeloid leukemia in blast crisis. It is also aberrantly expressed on a subset of T cell acute lymphoblastic leukemias. Normal tissue expression is restricted to normal myeloid cells.
- treating AML with a therapy that targets CD33 can be effective, but the therapy may be limited in utility due to toxicity to the normal blood and bone marrow.
- CAR constructs such as the activity and function of the CAR constructs
- high-throughput screening methods for identifying CAR constructs having desired properties (e.g., level of activation of T cells).
- Example CAR constructs are known in the art. See for example, PCT Publication No. WO 2019/178382 Al, as well as Kenderian, et al. Leukemia (2015) 29: 1637-1647.
- Reporter cells containing the exemplary nucleic acid construct EF1a_mOrange_IL-2_mTurq or EF1a_mTurq_IL-2_mOrange were generated as described in Example 2. The cells were transduced with the 8 different CD33 CARs shown in Tables 1 and 5. Cells were co-cultured for 24 hours with either wild-type MOLM-13 cells (CD33+) or MOLM-13 cells that are deficient for CD33 (MOLM-13 CD33KO).
- a ratio was determined for expression of the NF AT -inducible reporter when cocultured in the presence of wild-type MOLM-13 cells relative to expression of the NFAT- inducible reporter when co-cultured in the presence to MOLM-13 CD33KO cells to determine activity of the CD33 CAR (CD33-specific activation). See, Table 2.
- Results indicate that the IL-2 reporter system cells can be used as an objective and reliable reporter system for comparing activity of CAR constructs. Assessing expression of a reporter molecule that is constitutively expressed eliminates false outcomes, potentially due to altered transduction efficiencies, and verifies successful transduction of the reporter construct. Expression of the reporter molecule, driven only in activated cells, represents antigen recognition by and activity of the CAR construct.
- CD33 CARs 5-8 show T cell activating activity greater than at least one previously known anti-CD33 CAR.
- CD33-CAR5 showed the highest T cell activating activity of all CD33 CARs tested.
- FIGS. 2 and 3 show that all CD33-CAR5-8 of the disclosure show T cell activating activity in the CAR-IRS assay to varying degrees.
- CD33-CAR5 shows a high FP2 fold increase (FIG. 2), suggesting a higher T cell activating activity than other CARs tested.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Cell Biology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Epidemiology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2023516737A JP2023541456A (ja) | 2020-09-14 | 2021-09-14 | がん治療用キメラ抗原受容体 |
| US18/026,092 US20230372484A1 (en) | 2020-09-14 | 2021-09-14 | Chimeric antigen receptors for treatment of cancer |
| EP21799373.2A EP4210832A1 (en) | 2020-09-14 | 2021-09-14 | Chimeric antigen receptors for treatment of cancer |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063078237P | 2020-09-14 | 2020-09-14 | |
| US63/078,237 | 2020-09-14 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2022056490A1 true WO2022056490A1 (en) | 2022-03-17 |
Family
ID=78414716
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/050331 Ceased WO2022056490A1 (en) | 2020-09-14 | 2021-09-14 | Chimeric antigen receptors for treatment of cancer |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US20230372484A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4210832A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2023541456A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2022056490A1 (cg-RX-API-DMAC7.html) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023010118A1 (en) * | 2021-07-29 | 2023-02-02 | Vor Biopharma Inc. | Nfat-responsive reporter systems for assessing chimeric antigen receptor activation and methods of making and using the same |
| WO2025030010A1 (en) | 2023-08-01 | 2025-02-06 | Vor Biopharma Inc. | Compositions comprising genetically engineered hematopoietic stem cells and methods of use thereof |
Citations (37)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4694778A (en) | 1984-05-04 | 1987-09-22 | Anicon, Inc. | Chemical vapor deposition wafer boat |
| US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5350674A (en) | 1992-09-04 | 1994-09-27 | Becton, Dickinson And Company | Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5739116A (en) | 1994-06-03 | 1998-04-14 | American Cyanamid Company | Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US5993434A (en) | 1993-04-01 | 1999-11-30 | Genetronics, Inc. | Method of treatment using electroporation mediated delivery of drugs and genes |
| US6181964B1 (en) | 1997-08-01 | 2001-01-30 | Genetronics, Inc. | Minimally invasive apparatus and method to electroporate drugs and genes into tissue |
| US6241701B1 (en) | 1997-08-01 | 2001-06-05 | Genetronics, Inc. | Apparatus for electroporation mediated delivery of drugs and genes |
| US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
| US6678556B1 (en) | 1998-07-13 | 2004-01-13 | Genetronics, Inc. | Electrical field therapy with reduced histopathological change in muscle |
| US20040014645A1 (en) | 2002-05-28 | 2004-01-22 | Advisys, Inc. | Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system |
| US20040059285A1 (en) | 2002-07-04 | 2004-03-25 | Inovio As | Electroporation device and injection apparatus |
| US20040092907A1 (en) | 1997-04-03 | 2004-05-13 | Inovio As | Method for muscle delivery of drugs, nucleic acids and other compounds |
| US20050052630A1 (en) | 2002-03-07 | 2005-03-10 | Advisys, Inc. | Constant current electroporation device and methods of use |
| US20050070841A1 (en) | 2002-07-04 | 2005-03-31 | Inovio As | Electroporation device and injection apparatus |
| US7171264B1 (en) | 1999-05-10 | 2007-01-30 | Genetronics, Inc. | Intradermal delivery of active agents by needle-free injection and electroporation |
| US7173116B2 (en) | 2000-03-03 | 2007-02-06 | Genetronics Biomedical Corporation | Nucleic acid formulations for gene delivery and methods of use |
| US20070128708A1 (en) | 2005-12-07 | 2007-06-07 | Genetronics, Inc. | Variable volume electroporation chamber and methods therefore |
| WO2012088461A2 (en) | 2010-12-23 | 2012-06-28 | Biogen Idec Inc. | Linker peptides and polypeptides comprising same |
| WO2016014576A1 (en) * | 2014-07-21 | 2016-01-28 | Novartis Ag | Treatment of cancer using a cd33 chimeric antigen receptor |
| WO2017066760A1 (en) | 2015-10-16 | 2017-04-20 | The Trustees Of Columbia University In The City Of New York | Compositions and methods for inhibition of lineage specific antigens |
| WO2019178382A1 (en) | 2018-03-14 | 2019-09-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-cd33 chimeric antigen receptors and their uses |
| WO2020052542A1 (en) * | 2018-09-10 | 2020-03-19 | Nanjing Legend Biotech Co., Ltd. | Single-domain antibodies against cll1 and constructs thereof |
Family Cites Families (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3131927B8 (en) * | 2014-04-14 | 2020-12-23 | Cellectis | Bcma (cd269) specific chimeric antigen receptors for cancer immunotherapy |
| ES2981703T3 (es) * | 2016-09-02 | 2024-10-10 | Lentigen Tech Inc | Composiciones y métodos para tratar cáncer con DuoCars |
| US12053490B2 (en) * | 2017-10-26 | 2024-08-06 | St. Jude Children's Research Hospital, Inc. | Methods and compositions for treating CD33+ cancers and improving in vivo persistence of chimeric antigen receptor T cells |
| GB201721833D0 (en) * | 2017-12-22 | 2018-02-07 | Cancer Research Tech Ltd | Fusion proteins |
| WO2020051013A2 (en) * | 2018-08-24 | 2020-03-12 | The Trustees Of Columbia University In The City Of New York | Anti-cd33 and nkg2d ligand chimeras for treatment of myeloid malignancies |
| JP2022510218A (ja) * | 2018-11-30 | 2022-01-26 | メモリアル スローン ケタリング キャンサー センター | ヘテロ二量体四価特異性抗体およびこれらの使用 |
| EP3908613A4 (en) * | 2019-01-07 | 2022-10-19 | Celluris Participações Ltda. | BISPECIFIC IN-TANDEM RECEPTOR CAR AND METHODS FOR MODULATION OF THE TUMOR MICROAREA |
-
2021
- 2021-09-14 EP EP21799373.2A patent/EP4210832A1/en active Pending
- 2021-09-14 WO PCT/US2021/050331 patent/WO2022056490A1/en not_active Ceased
- 2021-09-14 JP JP2023516737A patent/JP2023541456A/ja active Pending
- 2021-09-14 US US18/026,092 patent/US20230372484A1/en active Pending
Patent Citations (40)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4694778A (en) | 1984-05-04 | 1987-09-22 | Anicon, Inc. | Chemical vapor deposition wafer boat |
| WO1987004462A1 (en) | 1986-01-23 | 1987-07-30 | Celltech Limited | Recombinant dna sequences, vectors containing them and method for the use thereof |
| US4704692A (en) | 1986-09-02 | 1987-11-03 | Ladner Robert C | Computer based system and method for determining and displaying possible chemical structures for converting double- or multiple-chain polypeptides to single-chain polypeptides |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
| WO1991010741A1 (en) | 1990-01-12 | 1991-07-25 | Cell Genesys, Inc. | Generation of xenogeneic antibodies |
| US5580717A (en) | 1990-05-01 | 1996-12-03 | Affymax Technologies N.V. | Recombinant library screening methods |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| US5733743A (en) | 1992-03-24 | 1998-03-31 | Cambridge Antibody Technology Limited | Methods for producing members of specific binding pairs |
| US5350674A (en) | 1992-09-04 | 1994-09-27 | Becton, Dickinson And Company | Intrinsic factor - horse peroxidase conjugates and a method for increasing the stability thereof |
| US6567694B2 (en) | 1993-04-01 | 2003-05-20 | Genetronics, Inc. | Needle electrodes for mediated delivery of drugs and genes |
| US5993434A (en) | 1993-04-01 | 1999-11-30 | Genetronics, Inc. | Method of treatment using electroporation mediated delivery of drugs and genes |
| US5739116A (en) | 1994-06-03 | 1998-04-14 | American Cyanamid Company | Enediyne derivatives useful for the synthesis of conjugates of methyltrithio antitumor agents |
| WO1996033735A1 (en) | 1995-04-27 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| WO1996034096A1 (en) | 1995-04-28 | 1996-10-31 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6265150B1 (en) | 1995-06-07 | 2001-07-24 | Becton Dickinson & Company | Phage antibodies |
| WO1998016654A1 (en) | 1996-10-11 | 1998-04-23 | Japan Tobacco, Inc. | Production of a multimeric protein by cell fusion method |
| WO1998024893A2 (en) | 1996-12-03 | 1998-06-11 | Abgenix, Inc. | TRANSGENIC MAMMALS HAVING HUMAN IG LOCI INCLUDING PLURAL VH AND Vλ REGIONS AND ANTIBODIES PRODUCED THEREFROM |
| US20040092907A1 (en) | 1997-04-03 | 2004-05-13 | Inovio As | Method for muscle delivery of drugs, nucleic acids and other compounds |
| WO1998046645A2 (en) | 1997-04-14 | 1998-10-22 | Micromet Gesellschaft Für Biomedizinische Forschung Mbh | Method for the production of antihuman antigen receptors and uses thereof |
| WO1998050433A2 (en) | 1997-05-05 | 1998-11-12 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| US6181964B1 (en) | 1997-08-01 | 2001-01-30 | Genetronics, Inc. | Minimally invasive apparatus and method to electroporate drugs and genes into tissue |
| US6241701B1 (en) | 1997-08-01 | 2001-06-05 | Genetronics, Inc. | Apparatus for electroporation mediated delivery of drugs and genes |
| US6516223B2 (en) | 1997-08-01 | 2003-02-04 | Genetronics, Inc. | Apparatus for electroporation mediated delivery for drugs and genes |
| US6233482B1 (en) | 1997-08-01 | 2001-05-15 | Genetronics, Inc. | Method of electroporation mediated delivery of drugs and genes |
| US6678556B1 (en) | 1998-07-13 | 2004-01-13 | Genetronics, Inc. | Electrical field therapy with reduced histopathological change in muscle |
| US7171264B1 (en) | 1999-05-10 | 2007-01-30 | Genetronics, Inc. | Intradermal delivery of active agents by needle-free injection and electroporation |
| US7173116B2 (en) | 2000-03-03 | 2007-02-06 | Genetronics Biomedical Corporation | Nucleic acid formulations for gene delivery and methods of use |
| US20050052630A1 (en) | 2002-03-07 | 2005-03-10 | Advisys, Inc. | Constant current electroporation device and methods of use |
| US20040014645A1 (en) | 2002-05-28 | 2004-01-22 | Advisys, Inc. | Increased delivery of a nucleic acid construct in vivo by the poly-L-glutamate ("PLG") system |
| US20040059285A1 (en) | 2002-07-04 | 2004-03-25 | Inovio As | Electroporation device and injection apparatus |
| US20050070841A1 (en) | 2002-07-04 | 2005-03-31 | Inovio As | Electroporation device and injection apparatus |
| US20070128708A1 (en) | 2005-12-07 | 2007-06-07 | Genetronics, Inc. | Variable volume electroporation chamber and methods therefore |
| WO2012088461A2 (en) | 2010-12-23 | 2012-06-28 | Biogen Idec Inc. | Linker peptides and polypeptides comprising same |
| WO2016014576A1 (en) * | 2014-07-21 | 2016-01-28 | Novartis Ag | Treatment of cancer using a cd33 chimeric antigen receptor |
| WO2017066760A1 (en) | 2015-10-16 | 2017-04-20 | The Trustees Of Columbia University In The City Of New York | Compositions and methods for inhibition of lineage specific antigens |
| WO2019178382A1 (en) | 2018-03-14 | 2019-09-19 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Anti-cd33 chimeric antigen receptors and their uses |
| WO2020052542A1 (en) * | 2018-09-10 | 2020-03-19 | Nanjing Legend Biotech Co., Ltd. | Single-domain antibodies against cll1 and constructs thereof |
Non-Patent Citations (49)
| Title |
|---|
| "Antibodies: a practice approach", 1988, IRL PRESS |
| "Cell and Tissue Culture: Laboratory Procedures", 1993, J. WILEY AND SONS |
| "Cell Biology: A Laboratory Notebook", 1989, ACADEMIC PRESS |
| "Current Protocols in Immunology", 1991 |
| "DNA Cloning: A practical Approach,", vol. 1, 2, 1985 |
| "Gene Transfer Vectors for Mammalian Cells", 1987 |
| "Handbook of Experimental Immunology", 1994, ACADEMIC PRESS, INC. |
| "Immobilized Cells and Enzymes", 1986, IRL PRESS |
| "Monoclonal antibodies: a practical approach", 2000, OXFORD UNIVERSITY PRESS |
| "The Antibodies", 1995, HARWOOD ACADEMIC PUBLISHERS |
| BUCK, D. W. ET AL., IN VITRO, vol. 18, 1982, pages 377 - 381 |
| BUCKLEY ET AL., CURR. HEMATOL. MALIG. REP., vol. 2, 2015, pages 65 |
| C. A. JANEWAYP. TRAVERS: "Immunobiology", 1997 |
| CHOW, MOLECULAR AND CELLULAR BIOLOGY, vol. 19, no. 3, 1999, pages 2300 - 7 |
| CLAY ET AL., J. IMMUNOL., vol. 163, 1999, pages 507 - 513 |
| CO ET AL., J. IMMUNOL., vol. 148, 1992, pages 1149 - 1154 |
| COWAN ET AL., FRONT BIOSCI, vol. 18, 2013, pages 1311 - 34 |
| COWAN ET AL., FRONT. BIOSCI., vol. 18, 2013, pages 1311 - 1334 |
| DE MUNTER STIJN ET AL: "Rapid and Effective Generation of Nanobody Based CARs using PCR and Gibson Assembly", INTERNATIONAL JOURNAL OF MOLECULAR SCIENCES, vol. 21, no. 3, 30 January 2020 (2020-01-30), Basel, CH, pages 883, XP055869289, ISSN: 1661-6596, DOI: 10.3390/ijms21030883 * |
| DINA SCHNEIDER ET AL: "A Unique Human Immunoglobulin Heavy Chain Variable Domain-Only CD33 CAR for the Treatment of Acute Myeloid Leukemia", FRONTIERS IN ONCOLOGY, vol. 8, 22 November 2018 (2018-11-22), CH, XP055737977, ISSN: 2234-943X, DOI: 10.3389/fonc.2018.00539 * |
| DOHNER ET AL., NEJM, vol. 373, 2015, pages 1136 |
| E. HARLOWD. LANE: "Using antibodies: a laboratory manual", 1999, COLD SPRING HARBOR LABORATORY PRESS |
| GHOSH ET AL., GLYCOBIOLOGY, vol. 5, 1991, pages 505 - 10 |
| HOGAN, CELL CALCIUM., vol. 63, 2017, pages 66 - 9 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| J. P. MATHERP. E. ROBERTS: "Introduction to Cell and Tissue Culture", 1998, PLENUM PRESS |
| KENDERIAN ET AL., LEUKEMIA, vol. 29, 2015, pages 1637 - 1647 |
| KOHLER. B.MILSTEIN. C., NATURE, vol. 256, 1975, pages 495 - 497 |
| LAMBA ET AL., J. CLIN. ONCOL., vol. 35, 2017, pages 2674 - 82 |
| LASZLO ET AL., ONCOTARGET, vol. 7, 2016, pages 43281 - 94 |
| MACIAN NAT. REV. IMMUNOL., vol. 5, 2005, pages 472 - 484 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 553 |
| MORRISON ET AL., PROC. NAT. ACAD. SCI., vol. 81, 1984, pages 6851 |
| MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 |
| NEUBERGER ET AL., NATURE, vol. 314, no. 604, 1984, pages 452 |
| NISHIKAWA ET AL., HUM GENE THER., vol. 12, no. 8, 2001, pages 861 - 70 |
| QUEEN ET AL., PROC. NATL. ACAD. SCI. USA, vol. 86, 1989, pages 10029 - 10033 |
| ROONEY ET AL., MOLECULAR AND CELLULAR BIOLOGY, vol. 15, no. 11, 1995, pages 6299 - 310 |
| SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual,", 1984, COLD SPRING HARBOR PRESS |
| SAMBROOK ET AL.: "Remington: The Science and Practice of Pharmacy", vol. 1 -4, 2012, COLD SPRING HARBOR PRESS |
| SHAW ET AL., JOURNAL OF IMMUNOLOGY, vol. 185, no. 9, 2010, pages 4972 - 5 |
| SHIZHOU, BMC BIOINFORMATICS, 2006 |
| SKERRA ET AL., SCIENCE, vol. 242, 1988, pages 1038 - 1041 |
| WARD ET AL., NATURE, vol. 334, 1989, pages 54454 |
| WEAVER ET AL., MOL. IMMUNOL, vol. 44, no. 11, 2007, pages 2813 - 2819 |
| WEINKOVE ET AL.: "Selecting costimulatory domains for chimeric antigen receptors: functional and clinical considerations", CLIN TRANSL IMMUNOLOGY, vol. 8, no. 5, 2019, pages el049, XP055815493, DOI: 10.1002/cti2.1049 |
| WINTER ET AL., ANNU. REV. IMMUNOL., vol. 12, 1994, pages 433 - 455 |
| WRIGGERS ET AL., CURRENT TRENDS IN PEPTIDE SCIENCE, vol. 80, no. 6, 2005, pages 736 - 74 |
| ZHAO ET AL., J. IMMUNOL., vol. 174, 2005, pages 4415 - 4423 |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023010118A1 (en) * | 2021-07-29 | 2023-02-02 | Vor Biopharma Inc. | Nfat-responsive reporter systems for assessing chimeric antigen receptor activation and methods of making and using the same |
| WO2025030010A1 (en) | 2023-08-01 | 2025-02-06 | Vor Biopharma Inc. | Compositions comprising genetically engineered hematopoietic stem cells and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| US20230372484A1 (en) | 2023-11-23 |
| EP4210832A1 (en) | 2023-07-19 |
| JP2023541456A (ja) | 2023-10-02 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12139538B2 (en) | Chimeric antigen receptors targeting Fc receptor-like 5 and uses thereof | |
| JP2023085479A (ja) | 合成免疫受容体およびその使用方法 | |
| CN107208047B (zh) | 靶向b-细胞成熟抗原的嵌合抗原受体及其用途 | |
| AU2022200052A1 (en) | Chimeric antigen receptors targeting G-protein coupled receptor and uses thereof | |
| CN105392888B (zh) | 使用人源化抗cd19嵌合抗原受体治疗癌症 | |
| US20170369561A1 (en) | Glypican-3-specific antibody and uses thereof | |
| US12161668B2 (en) | T cells expressing a chimeric antigen receptor | |
| TW201930339A (zh) | 新型改造t細胞受體及其免疫治療 | |
| TW202023580A (zh) | 使用靶特異性融合蛋白進行tcr再程式化之組合物及方法 | |
| US20240352481A1 (en) | Nfat-responsive reporter systems for assessing chimeric antigen receptor activation and methods of making and using the same | |
| CA3201582A1 (en) | Compositions of guanylyl cyclase c (gcc) antigen binding agents and methods of use thereof | |
| US20230372484A1 (en) | Chimeric antigen receptors for treatment of cancer | |
| WO2019161133A1 (en) | Foxp3 targeting agent compositions and methods of use for adoptive cell therapy | |
| US20250082755A1 (en) | Chimeric antigen receptors for treatment of cancer | |
| WO2025016450A1 (en) | Combination of cldn18.2 and gucy2c targeted antagonist therapy | |
| WO2023246574A1 (zh) | 靶向gpc3的抗体及其用途 | |
| EA052459B1 (ru) | Синтетические иммунные рецепторы и способы их применения | |
| EA043737B1 (ru) | Композиции и способы репрограммирования т-клеточных рецепторов с помощью гибридных белков | |
| HK40001773A (en) | Chimeric antigen receptors targeting fc receptor-like 5 and uses thereof | |
| HK40001773B (en) | Chimeric antigen receptors targeting fc receptor-like 5 and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21799373 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2023516737 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2021799373 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021799373 Country of ref document: EP Effective date: 20230414 |