WO2022031756A1 - Csrp3 (cysteine and glycine rich protein 3) gene therapy - Google Patents

Csrp3 (cysteine and glycine rich protein 3) gene therapy Download PDF

Info

Publication number
WO2022031756A1
WO2022031756A1 PCT/US2021/044412 US2021044412W WO2022031756A1 WO 2022031756 A1 WO2022031756 A1 WO 2022031756A1 US 2021044412 W US2021044412 W US 2021044412W WO 2022031756 A1 WO2022031756 A1 WO 2022031756A1
Authority
WO
WIPO (PCT)
Prior art keywords
polynucleotide
vector
mlp
promoter
seq
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/044412
Other languages
English (en)
French (fr)
Inventor
Christopher Dean HERZOG
Chester Bittencort SACRAMENTO
Raj PRABHAKAR
David RICKS
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Spacecraft Seven LLC
Original Assignee
Spacecraft Seven LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Spacecraft Seven LLC filed Critical Spacecraft Seven LLC
Priority to EP21852527.7A priority Critical patent/EP4192962A4/en
Priority to JP2023507388A priority patent/JP2023536618A/ja
Priority to US18/019,396 priority patent/US20230257431A1/en
Priority to CA3184983A priority patent/CA3184983A1/en
Priority to MX2023000994A priority patent/MX2023000994A/es
Priority to AU2021321410A priority patent/AU2021321410A1/en
Priority to IL300187A priority patent/IL300187A/en
Priority to BR112023001336A priority patent/BR112023001336A2/pt
Priority to KR1020237003436A priority patent/KR20230042468A/ko
Priority to CN202180057650.8A priority patent/CN116234916A/zh
Publication of WO2022031756A1 publication Critical patent/WO2022031756A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/04Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4702Regulators; Modulating activity
    • C07K14/4705Regulators; Modulating activity stimulating, promoting or activating activity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4716Muscle proteins, e.g. myosin, actin
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/07Animals genetically altered by homologous recombination
    • A01K2217/072Animals genetically altered by homologous recombination maintaining or altering function, i.e. knock in
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2217/00Genetically modified animals
    • A01K2217/07Animals genetically altered by homologous recombination
    • A01K2217/075Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0306Animal model for genetic diseases
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2750/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
    • C12N2750/00011Details
    • C12N2750/14011Parvoviridae
    • C12N2750/14111Dependovirus, e.g. adenoassociated viruses
    • C12N2750/14141Use of virus, viral particle or viral elements as a vector
    • C12N2750/14143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • Cysteine and glycine rich protein 3 encodes Muscle LIM Protein (MLP).
  • MLP Muscle LIM Protein
  • HCM hypertrophic cardiomyopathy
  • DCM dilated cardiomyopathy
  • Changes in MLP levels or intracellular localization are also associated with skeletal myopathies, including facioscapulohumeral muscular dystrophy, nemaline myopathy, and limb girdle muscular dystrophy type 2B. Changes in levels of the isoform MLP-b protein or disregulation of the MLP:MLP-b ratio have been detected in limb girdle muscular dystrophy type 2A, Duchenne muscular dystrophy, and dermatomyositis patients.
  • CSRP3 patients exhibit variable symptoms depending on the specific mutation, but general symptoms include obstructive HCM or DCM, ventricular hypertrophy (with interventricular septum in the range of 14-32mm), ventricular tachycardia, exercise intolerance, angina. Mild NYHA (New York Heart Association) scores of I-II are common. Sudden cardiac death has been observed, for example in a family carrying the C58G mutation. In one study, the majority of C58G carriers who provided muscle biopsies complained of exertional myalgias and cramps at presentation.
  • the present invention relates generally to gene therapy for a disease or disorder, e.g., a cardiac disease or disorder, using a vector expressing MLP or a functional variant thereof.
  • the disclosure provides polynucleotide, comprising an expression cassette and optionally flanking adeno-associated virus (AAV) inverted terminal repeats (ITRs), wherein the polynucleotide comprises a polynucleotide sequence encoding Muscle LIM Protein (MLP) or a functional variant thereof, operatively linked to a promoter.
  • AAV adeno-associated virus
  • ITRs inverted terminal repeats
  • the promoter is a cardiac-specific promoter.
  • the promoter is a muscle-specific promoter.
  • the promoter is a cardiomyocyte-specific promoter.
  • the promoter is a MHCK7 promoter.
  • the MHCK7 promoter shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NO: 31.
  • the promoter is a cardiac troponin T (hTNNT2) promoter.
  • the hTNNT2 promoter shares at least 75%, 80%, 85%,
  • the expression cassette comprises exon 1 of the cardiac troponin T (hTNNT2) gene, wherein optionally the hTNNT2 promoter and exon 1 together share at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NO: 32.
  • the promoter is a ubiquitous promoter, optionally a CMV promoter or a CAG promoter.
  • the expression cassette comprises a polyA signal.
  • the polyA signal is a human growth hormone (hGH) polyA.
  • hGH human growth hormone
  • the expression cassette comprises a Woodchuck Hepatitis Virus Posttranscriptional Regulatory Element (WPRE), optionally a WPRE(x).
  • WPRE Woodchuck Hepatitis Virus Posttranscriptional Regulatory Element
  • the Muscle LIM Protein (MLP) or a functional variant thereof is an MLP.
  • the MLP is a human MLP.
  • the MLP is MLP isoform A.
  • the MLP shares at least 75%, 80%, 85%, 90%, 95%, 96%,
  • the MLP is MLP isoform B.
  • the MLP shares at least 75%, 80%, 85%, 90%, 95%, 96%,
  • the MLP shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NO: 3.
  • the MLP shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NO: 4.
  • the polynucleotide sequence encoding MLP is a Cysteine And Glycine Rich Protein 3 (CSRP3) polynucleotide.
  • CSRP3 Cysteine And Glycine Rich Protein 3
  • the CSRP3 polynucleotide is a human CSRP3 polynucleotide.
  • the polynucleotide sequence encoding MLP shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NO: 5.
  • the polynucleotide sequence encoding MLP shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NO: 7.
  • the polynucleotide comprises at least about 2.4 kb, at most about 2.6 kb, or between about 2.4 kb and about 2.6 kb.
  • the polynucleotide comprises at least about 3.0 kb, at most about 3.3 kb, or between about 3.0 kb and about 3.3 kb.
  • the polynucleotide comprises at least about 2.4 kb, least about 2.6 kb, least about 3.0 kb, at least about 3.3 kb, at least about 3.5 kb, at least about 3.7 kb, at least about 3.9 kb, at least about 4.1 kb., or at least about 4.3 kb.
  • the polynucleotide comprises least about 2.6 kb, least about 3.0 kb, at most about 3.3 kb, at most about 3.5 kb, at most about 3.7 kb, at most about 3.9 kb, at most about 4.1 kb., at most about 4.3 kb, or at most about 4.5 kb.
  • the expression cassette shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with any one of SEQ ID NOs: 8-11.
  • the polynucleotide shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with any one of SEQ ID NOs: 12-15.
  • the expression cassette is flanked by 5' and 3' inverted terminal repeats (ITRs), optionally AAV2 ITRs, optionally ITRs that shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with any one of SEQ ID NO: 20-26.
  • ITRs inverted terminal repeats
  • AAV2 ITRs optionally AAV2 ITRs that shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with any one of SEQ ID NO: 20-26.
  • the polynucleotide is self-complementary.
  • the polynucleotide comprises the expression cassette and a reverse complement of the expression cassette.
  • the expression cassette and the reverse complement of the expression cassette are flanked by 5' and 3' inverted terminal repeats (ITRs), optionally AAV2 ITRs, optionally an ITR that shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NO: 23 or SEQ ID NO: 26.
  • ITRs inverted terminal repeats
  • AAV2 ITRs optionally an ITR that shares at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% identity with SEQ ID NO: 23 or SEQ ID NO: 26.
  • the disclosure provides a gene therapy vector, comprising a polynucleotide of the disclosure.
  • the gene therapy vector is a recombinant adeno-associated virus (rAAV) vector.
  • rAAV recombinant adeno-associated virus
  • the rAAV vector is an AAV9 or a functional variant thereof.
  • the rAAV vector comprises a capsid protein that shares 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to any one of SEQ ID NO: 77.
  • the rAAV vector is an AAVrhlO or a functional variant thereof.
  • the rAAV vector comprises a capsid protein that shares 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to any one of SEQ ID NO: 79.
  • the rAAV vector is an AAV6 or a functional variant thereof.
  • the rAAV vector comprises a capsid protein that shares 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to any one of SEQ ID NO: 78.
  • the rAAV vector is an AAVrh74 or a functional variant thereof.
  • the rAAV vector comprises a capsid protein that shares 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to any one of SEQ ID NO: 80.
  • the rAAV vector is a self-complementary AAV vector.
  • the disclosure provides a method of treating and/or preventing a disease or disorder in a subject in need thereof, comprising administering a vector of the disclosure to the subject.
  • the disease or disorder is a cardiac disorder.
  • the disease or disorder is heart failure.
  • the disease or disorder is hypertrophic cardiomyopathy.
  • the disease or disorder is dilated cardiomyopathy.
  • the subject is a mammal.
  • the subject is a primate.
  • the subject is a human.
  • the subject has a mutation in the CSRP3 gene that causes an amino acid substitution selected from C58G, L44P, S54R, E55G, and/or K69R, relative to a human CSRP3 encoding a human MLP having the sequence of SEQ ID NO: 1.
  • the vector is administered by intravenous injection, intracardiac injection, intracardiac infusion, and/or cardiac catheterization.
  • the administration increases MLP expression by at least about 5%.
  • the administration increases MLP expression by at least about 30%.
  • the administration increases MLP expression by at least about 70%.
  • the administration increases MLP expression by about 5% to about 10%.
  • the administration increases MLP expression by about 30% to about 50%. [0068] In some embodiments, the administration increases MLP expression by about 70% to about 100%.
  • the method treats and/or prevents the disease or disorder.
  • the disclosure provides a pharmaceutical composition comprising a vector of the disclosure.
  • the disclosure provides a kit comprising a vector or pharmaceutical composition of the disclosure, and optionally instructions for use.
  • the disclosure provides a use of a composition of the disclosure in treating a disease or disorder, optionally according to any of the methods disclosed herein.
  • the disclosure provides a composition of the disclosure for use in treating a disease or disorder, optionally according to any of the methods disclosed herein.
  • the disclosure provides a method of expressing Muscle LIM Protein (MLP) or a functional variant thereof, comprising contacting a cell with a vector of the disclosure.
  • MLP Muscle LIM Protein
  • the cell is a cardiomyocyte.
  • the cardiomyocyte is a human cardiomyocyte.
  • the promoter is an MHCK7 promoter and wherein the expression level of the MLP is at least 2-fold greater than the expression level of MLP in a cell transduced with a vector having an hTNNT2 promoter.
  • the promoter is an MHCK7 promoter and wherein the expression level of the MLP is between 2-fold greater and 10-fold greater than the expression level of MLP in a cell transduced with a vector having an hTNNT2 promoter.
  • FIG. 1 shows a vector diagram of a non-limiting example of a vector genome.
  • the full polynucleotide sequence of the vector genome is SEQ ID NO: 12.
  • the capitalized portion is the expression cassette (SEQ ID NO: 8).
  • FIG. 2 shows a vector diagram of a non-limiting example of a vector genome.
  • the full polynucleotide sequence of the vector genome is SEQ ID NO: 13.
  • the capitalized portion is the expression cassette (SEQ ID NO: 9).
  • FIG. 3 shows a vector diagram of a non-limiting example of a vector genome.
  • the full polynucleotide sequence of the vector genome is SEQ ID NO: 14.
  • the capitalized portion is the expression cassette (SEQ ID NO: 10).
  • FIG. 4 shows a vector diagram of a non-limiting example of a vector genome.
  • the full polynucleotide sequence of the vector genome is SEQ ID NO: 15.
  • the capitalized portion is the expression cassette (SEQ ID NO: 11).
  • FIG. 5A shows CSRP3 expression in transduced CHO-Lec2.
  • FIG. 5B shows CSRP3 expression in transduced cardiomyocytes (differentiated
  • the present disclosure provided gene therapy vectors for CSPRP3 that delivery a polynucleotide encoding MLP, along with method of use, and other compositions and methods.
  • Treatment of CSPRP3 -related disorder is complicated by autosomal dominant nature of most forms of CSPRP3-related disorders and evidence suggesting that the level of protein expression and balance between MLP isoforms is crucial to normal function in healthy subjects.
  • successful gene therapy in the heart is unpredictable. Cardiomyocytes are a particularly challenging cell type to target with gene therapy.
  • the compositions and methods disclosed herein address this problem. DEFINITIONS
  • any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated.
  • the term “about”, when immediately preceding a number or numeral, means that the number or numeral ranges plus or minus 10%.
  • the terms “a” and “an” as used herein refer to “one or more” of the enumerated components unless otherwise indicated.
  • the use of the alternative e.g., “or” should be understood to mean either one, both, or any combination thereof of the alternatives.
  • the term “and/or” should be understood to mean either one, or both of the alternatives.
  • the terms “include” and “comprise” are used synonymously.
  • the terms “identity” and “identical” refer, with respect to a polypeptide or polynucleotide sequence, to the percentage of exact matching residues in an alignment of that “query” sequence to a “subject” sequence, such as an alignment generated by the BLAST algorithm. Identity is calculated, unless specified otherwise, across the full length of the subject sequence.
  • a query sequence “shares at least x% identity to” a subject sequence if, when the query sequence is aligned to the subject sequence, at least x% (rounded down) of the residues in the subject sequence are aligned as an exact match to a corresponding residue in the query sequence.
  • the subject sequence has variable positions (e.g., residues denoted X), an alignment to any residue in the query sequence is counted as a match.
  • an “AAV vector” or “rAAV vector” refers to a recombinant vector comprising one or more polynucleotides of interest (or transgenes) that are flanked by AAV terminal repeat sequences (ITRs).
  • AAV vectors can be replicated and packaged into infectious viral particles when present in a host cell that has been transfected with a plasmid encoding and expressing rep and cap gene products.
  • AAV vectors can be packaged into infectious particles using a host cell that has been stably engineered to express rep and cap genes.
  • an “AAV virion” or “AAV viral particle” or “AAV vector particle” refers to a viral particle composed of at least one AAV capsid protein and an encapsidated polynucleotide AAV vector.
  • the particle comprises a heterologous polynucleotide (/. ⁇ e., a polynucleotide other than a wild-type AAV genome such as a transgene to be delivered to a mammalian cell)
  • it is typically referred to as an “AAV vector particle” or simply an “AAV vector.”
  • production of AAV vector particle necessarily includes production of AAV vector, as such a vector is contained within an AAV vector particle.
  • promoter refers to a polynucleotide sequence capable of promoting initiation of RNA transcription from a polynucleotide in a eukaryotic cell.
  • vector genome refers to the polynucleotide sequence packaged by the vector (e.g., an rAAV virion), including flanking sequences (in AAV, inverted terminal repeats).
  • expression cassette and “polynucleotide cassette” refer to the portion of the vector genome between the flanking ITR sequences. “Expression cassette” implies that the vector genome comprises at least one gene encoding a gene product operable linked to an element that drives expression (e.g., a promoter).
  • the term “patient in need” or “subject in need” refers to a patient or subject at risk of, or suffering from, a disease, disorder or condition that is amenable to treatment or amelioration with a recombinant gene therapy vector or gene editing system disclosed herein.
  • a patient or subject in need may, for instance, be a patient or subject diagnosed with a disorder associated with heart.
  • a subject may have a mutation in an CSRP3 gene or deletion of all or a part of CSRP3 gene, or of gene regulatory sequences, that causes aberrant expression of the MLP protein.
  • Subject and “patient” are used interchangeably herein.
  • the subject treated by the methods described herein may be an adult or a child. Subjects may range in age.
  • variant or “functional variant” refer, interchangeably, to a protein that has one or more amino-acid substitutions, insertions, or deletion compared to a parental protein that retains one or more desired activities of the parental protein.
  • genetic disruption refers to a partial or complete loss of function or aberrant activity in a gene.
  • a subject may suffer from a genetic disruption in expression or function in the CSRP3 gene that decreases expression or results in loss or aberrant function of the MLP protein in at least some cells (e.g., cardiac cells) of the subject.
  • treating refers to ameliorating one or more symptoms of a disease or disorder.
  • preventing refers to delaying or interrupting the onset of one or more symptoms of a disease or disorder or slowing the progression of CSRP3 -related disease or disorder, e.g., hypertrophic cardiomyopathy (HCM), dilated cardiomyopathy (DCM), or skeletal myopathy.
  • HCM hypertrophic cardiomyopathy
  • DCM dilated cardiomyopathy
  • MLP Muscle LIM Protein
  • HCM hypertrophic cardiomyopathy
  • DCM dilated cardiomyopathy
  • polypeptide sequence of MLP is as follows:
  • a second isoform of MLP has the following polypeptide sequence:
  • Another isoform of MLP has the following polypeptide sequence:
  • Another isoform of MLP has the following polypeptide sequence:
  • the MLP protein comprises a polypeptide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOs: 1-4.
  • the disclosure provides a recombinant adeno-associated virus (rAAV) virion, comprising a capsid and a vector genome, wherein the vector genome comprises a polynucleotide sequence encoding an MLP or a functional variant thereof, operatively linked to a promoter.
  • the disclosure provides a recombinant adeno-associated virus (rAAV) virion, comprising a capsid and a vector genome, wherein the vector genome comprises a polynucleotide sequence encoding an MLP, operatively linked to a promoter.
  • the polynucleotide encoding the MLP may comprise a polynucleotide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to:
  • the polynucleotide sequence encoding the vector genome may comprise a Kozak sequence, including but not limited to GCCACCATGG (SEQ ID NO: 6).
  • Kozak sequence may overlap the polynucleotide sequence encoding an MLP protein or a functional variant thereof.
  • the vector genome may comprise a polynucleotide sequence (with Kozak underlined) at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to: gccaccATGCCAAACTGGGGCGGAGGCGCAAAATGTGGAGCCTGTGAAAAGACCGT CTACCATGCAGAAGAAATCCAGTGCAATGGAAGGAGTTTCCACAAGACGTGTTT CCACTGCATGGCCTGCAGGAAGGCTCTTGACAGCACGACAGTCGCGGCTCATGA GTCGGAGATCTACTGCAAGGTGTGCTATGGGCGCAGATATGGCCCCAAAGGGAT CGGGTATGGACAAGGCTGGCTGTCTCAGCACAGACACGGGCGAGCATCTCGG CCTGCAGTTCCAACAGTCCCCAAAGCCGGCACGCTCAGTTACCACCAGCAACCCT TCCAAATTCACTGCGAAGTTTGGAGAGTCCGAGAAGTGCCCTCG
  • the Kozak sequence is an alternative Kozak sequence comprising or consisting of any one of:
  • GAC ACCAUGG SEQ ID NO: 18
  • the vector genome comprises no Kozak sequence.
  • the AAV virions of the disclosure comprise a vector genome.
  • the vector genome may comprise an expression cassette (or a polynucleotide cassette for gene-editing applications not requiring expression of the polynucleotide sequence). Any suitable inverted terminal repeats (ITRs) may be used.
  • ITRs may be from the same serotype as the capsid or a different serotype (e.g., AAV2 ITRs may be used).
  • the 3' ITR comprises a polynucleotide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to:
  • the polynucleotide sequence encoding an MLP protein or functional variant thereof is operably linked to a promoter.
  • the present disclosure contemplates use of various promoters.
  • Promoters useful in embodiments of the present disclosure include, without limitation, a cytomegalovirus (CMV) promoter, phosphoglycerate kinase (PGK) promoter, or a promoter sequence comprised of the CMV enhancer and portions of the chicken beta-actin promoter and the rabbit beta-globin gene (CAG).
  • CMV cytomegalovirus
  • PGK phosphoglycerate kinase
  • CAG rabbit beta-globin gene
  • the promoter may be a synthetic promoter. Exemplary synthetic promoters are provided by Schlabach et al. PNAS USA. 107(6):2538-43 (2010).
  • the promoter comprises a polynucleotide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to:
  • a polynucleotide sequence encoding an MLP protein or functional variant thereof is operatively linked to an inducible promoter.
  • An inducible promoter may be configured to cause the polynucleotide sequence to be transcriptionally expressed or not transcriptionally expressed in response to addition or accumulation of an agent or in response to removal, degradation, or dilution of an agent.
  • the agent may be a drug.
  • the agent may be tetracycline or one of its derivatives, including, without limitation, doxycycline.
  • the inducible promoter is a tet-on promoter, a tet-off promoter, a chemically -regulated promoter, a physically-regulated promoter (i.e., a promoter that responds to presence or absence of light or to low or high temperature).
  • Inducible promoters include heavy metal ion inducible promoters (such as the mouse mammary tumor virus (mMTV) promoter or various growth hormone promoters), and the promoters from T7 phage which are active in the presence of T7 RNA polymerase. This list of inducible promoters is non-limiting.
  • the promoter is a tissue-specific promoter, such as a promoter capable of driving expression in a cardiac cell to a greater extent than in a non-cardiac cell.
  • tissue-specific promoter is a selected from any various cardiac cellspecific promoters including but not limited to, desmin (Des), alpha-myosin heavy chain (a- MHC), myosin light chain 2 (MLC-2), cardiac troponin C (cTnC), cardiac troponin T (hTNNT2), muscle creatine kinase (CK) and combinations of promoter/enhancer regions thereof, such as MHCK7.
  • the promoter is a ubiquitous promoter.
  • a “ubiquitous promoter” refers to a promoter that is not tissue-specific under experimental or clinical conditions.
  • the ubiquitous promoter is any one of CMV, CAG, UBC, PGK, EFl -alpha, GAPDH, SV40, HBV, chicken beta-actin, and human beta-actin promoters.
  • the promoter sequence is selected from Table 3.
  • the promoter comprises a polynucleotide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOS 31-51.
  • the vector genome comprises a polynucleotide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 31.
  • the vector genome comprises a polynucleotide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 32.
  • the vector genome comprises a polynucleotide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 33.
  • promoters are the SV40 late promoter from simian virus 40, the Baculovirus polyhedron enhancer/promoter element, Herpes Simplex Virus thymidine kinase (HSV tk), the immediate early promoter from cytomegalovirus (CMV) and various retroviral promoters including LTR elements.
  • HSV tk Herpes Simplex Virus thymidine kinase
  • CMV cytomegalovirus
  • LTR elements various retroviral promoters including LTR elements
  • vectors of the present disclosure further comprise one or more regulatory elements selected from the group consisting of an enhancer, an intron, a poly-A signal, a 2A peptide encoding sequence, a WPRE (Woodchuck hepatitis virus posttranscriptional regulatory element), and a HPRE (Hepatitis B posttranscriptional regulatory element).
  • regulatory elements selected from the group consisting of an enhancer, an intron, a poly-A signal, a 2A peptide encoding sequence, a WPRE (Woodchuck hepatitis virus posttranscriptional regulatory element), and a HPRE (Hepatitis B posttranscriptional regulatory element).
  • the vector comprises a CMV enhancer.
  • the vectors comprise one or more enhancers.
  • the enhancer is a CMV enhancer sequence, a GAPDH enhancer sequence, a P- actin enhancer sequence, or an EFl -a enhancer sequence. Sequences of the foregoing are known in the art. For example, the sequence of the CMV immediate early (IE) enhancer is:
  • the vectors comprise one or more introns.
  • the intron is a rabbit globin intron sequence, a chicken P-actin intron sequence, a synthetic intron sequence, an SV40 intron, or an EFl -a intron sequence.
  • the vectors comprise a polyA sequence.
  • the polyA sequence is a rabbit globin polyA sequence, a human growth hormone polyA sequence, a bovine growth hormone polyA sequence, a PGK polyA sequence, an SV40 polyA sequence, or a TK polyA sequence.
  • the poly-A signal may be a bovine growth hormone polyadenylation signal (bGHpA).
  • the vectors comprise one or more transcript stabilizing element.
  • the transcript stabilizing element is a WPRE sequence, a HPRE sequence, a scaffold-attachment region, a 3' UTR, or a 5' UTR.
  • the vectors comprise both a 5' UTR and a 3' UTR.
  • the vector comprises a 5' untranslated region (UTR) selected from Table 4.
  • the vector genome comprises a polynucleotide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOS 51-61.
  • the vector comprises a 3' untranslated region selected from Table 5.
  • the vector genome comprises a polynucleotide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOS 62-70.
  • the vector comprises a polyadenylation (poly A) signal selected from Table 6.
  • the polyA signal comprises a polynucleotide sequence at least 75%, 80%, 85%, 90%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to any one of SEQ ID NOS 71-75.
  • Illustrative vector genomes are depicted in FIG. 1-4 and provided as SEQ ID NOs: 12-15.
  • the expression cassette of each sequence, capitalized, is SEQ ID NOs: 8-11.
  • the vector genome comprises, consists essentially of, or consists of a polynucleotide sequence that shares at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to any one of SEQ ID NOs: 8-11, optionally with or without the ITR sequences in lowercase.
  • the coding sequence is capitalized.
  • Adeno-associated virus is a replication-deficient parvovirus, the singlestranded DNA genome of which is about 4.7 kb in length including two -145 -nucleotide inverted terminal repeat (ITRs).
  • ITRs inverted terminal repeat
  • AAV serotypes when classified by antigenic epitopes.
  • the nucleotide sequences of the genomes of the AAV serotypes are known.
  • the complete genome of AAV-1 is provided in GenBank Accession No. NC_002077; the complete genome of AAV-2 is provided in GenBank Accession No. NC_001401 and Srivastava et al., J.
  • the sequence of the AAVrh.74 genome is provided in U.S. Patent 9,434,928, incorporated herein by reference.
  • Cis-acting sequences directing viral DNA replication (rep), encapsidation/packaging and host cell chromosome integration are contained within the AAV ITRs.
  • Three AAV promoters (named p5, pl 9, and p40 for their relative map locations) drive the expression of the two AAV internal open reading frames encoding rep and cap genes.
  • the two rep promoters (p5 and pl 9), coupled with the differential splicing of the single AAV intron (at nucleotides 2107 and 2227), result in the production of four rep proteins (rep78, rep68, rep52, and rep40) from the rep gene.
  • Rep proteins possess multiple enzymatic properties that are ultimately responsible for replicating the viral genome.
  • the cap gene is expressed from the p40 promoter and it encodes the three capsid proteins VP1, VP2, and VP3.
  • Alternative splicing and nonconsensus translational start sites are responsible for the production of the three related capsid proteins.
  • a single consensus polyadenylation site is located at map position 95 of the AAV genome. The life cycle and genetics of AAV are reviewed in Muzyczka, Current Topics in Microbiology and Immunology, 158: 97-129 (1992).
  • AAV possesses unique features that make it attractive as a vector for delivering foreign DNA to cells, for example, in gene therapy.
  • AAV infection of cells in culture is noncytopathic, and natural infection of humans and other animals is silent and asymptomatic.
  • AAV infects many mammalian cells allowing the possibility of targeting many different tissues in vivo.
  • AAV transduces slowly dividing and non-dividing cells, and can persist essentially for the lifetime of those cells as a transcriptionally active nuclear episome (extrachromosomal element).
  • the AAV proviral genome is inserted as cloned DNA in plasmids, which makes construction of recombinant genomes feasible.
  • the signals directing AAV replication and genome encapsidation are contained within the ITRs of the AAV genome, some or all of the internal approximately 4.3 kb of the genome (encoding replication and structural capsid proteins, rep-cap) may be replaced with foreign DNA.
  • the rep and cap proteins may be provided in trans.
  • Another significant feature of AAV is that it is an extremely stable and hearty virus. It easily withstands the conditions used to inactivate adenovirus (56° to 65°C for several hours), making cold preservation of AAV less critical. AAV may even be lyophilized. Finally, AAV- infected cells are not resistant to superinfection.
  • Gene delivery viral vectors useful in the practice of the present invention can be constructed utilizing methodologies well known in the art of molecular biology.
  • viral vectors carrying transgenes are assembled from polynucleotides encoding the transgene, suitable regulatory elements and elements necessary for production of viral proteins, which mediate cell transduction.
  • Such recombinant viruses may be produced by techniques known in the art, e.g., by transfecting packaging cells or by transient transfection with helper plasmids or viruses.
  • Typical examples of virus packaging cells include but are not limited to HeLa cells, SF9 cells (optionally with a baculovirus helper vector), 293 cells, etc.
  • a Herpesvirus-based system can be used to produce AAV vectors, as described in US20170218395A1.
  • Detailed protocols for producing such replication-defective recombinant viruses may be found for instance in W095/14785, W096/22378, U.S. Pat. No. 5,882,877, U.S. Pat. No. 6,013,516, U.S. Pat. No. 4,861,719, U.S. Pat. No. 5,278,056 and W094/19478, the complete contents of each of which is hereby incorporated by reference.
  • AAV vectors useful in the practice of the present invention can be packaged into AAV virions (viral particles) using various systems including adenovirus-based and helper- free systems.
  • Standard methods in AAV biology include those described in Kwon and Schaffer. Pharm Res. (2008) 25(3):489-99; Wu et al. Mol. Ther. (2006) 14(3):316-27. Burger et al. Mol. Ther. (2004) 10(2):302-17; Grimm et al. Curr Gene Ther. (2003) 3(4):281-304; Deyle DR, Russell DW. Curr OpinMol Ther. (2009) 11(4):442-447; McCarty et al. Gene Ther.
  • AAV DNA in the rAAV genomes may be from any AAV variant or serotype for which a recombinant virus can be derived including, but not limited to, AAV variants or serotypes AAV-1, AAV-2, AAV-3, AAV-4, AAV-5, AAV-6, AAV-7, AAV-8, AAV-9, AAV- 10, AAV-11, AAV- 12, AAV-13 and AAVrhlO.
  • Production of pseudotyped rAAV is disclosed in, for example, WO 01/83692.
  • Other types of rAAV variants, for example rAAV with capsid mutations, are also contemplated. See, for example, Marsic et al., Molecular Therapy, 22(11): 1900-1909 (2014).
  • the nucleotide sequences of the genomes of various AAV serotypes are known in the art.
  • the rAAV comprises a self-complementary genome.
  • an rAAV comprising a “self-complementary” or “double stranded” genome refers to an rAAV which has been engineered such that the coding region of the rAAV is configured to form an intra-molecular double-stranded DNA template, as described in McCarty et al.
  • Self-complementary recombinant adeno-associated virus (scAAV) vectors promote efficient transduction independently of DNA synthesis. Gene Therapy. 8 (16): 1248-54 (2001).
  • the present disclosure contemplates the use, in some cases, of an rAAV comprising a self- complementary genome because upon infection (such transduction), rather than waiting for cell mediated synthesis of the second strand of the rAAV genome, the two complementary halves of scAAV will associate to form one double stranded DNA (dsDNA) unit that is ready for immediate replication and transcription.
  • dsDNA double stranded DNA
  • the rAAV vector comprises a single stranded genome.
  • a “single standard” genome refers to a genome that is not self-complementary. In most cases, non-recombinant AAVs are have singled stranded DNA genomes. There have been some indications that rAAVs should be sc AAVs to achieve efficient transduction of cells. The present disclosure contemplates, however, rAAV vectors that maybe have singled stranded genomes, rather than self-complementary genomes, with the understanding that other genetic modifications of the rAAV vector may be beneficial to obtain optimal gene transcription in target cells.
  • the present disclosure relates to single-stranded rAAV vectors capable of achieving efficient gene transfer to anterior segment in the mouse eye. See Wang et al. Single stranded adeno-associated virus achieves efficient gene transfer to anterior segment in the mouse eye. PLoS ONE 12(8): e0182473 (2017).
  • the rAAV vector is of the serotype AAV1, AAV2, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAV11, AAV12, AAV13, AAVrhlO, or AAVrh74.
  • Production of pseudotyped rAAV is disclosed in, for example, WO 01/83692.
  • Other types of rAAV variants, for example rAAV with capsid mutations, are also contemplated. See, for example, Marsic et al., Molecular Therapy, 22(11): 1900-1909 (2014).
  • the rAAV vector is of the serotype AAV9.
  • said rAAV vector is of serotype AAV9 and comprises a single stranded genome. In some embodiments, said rAAV vector is of serotype AAV9 and comprises a self-complementary genome. In some embodiments, a rAAV vector comprises the inverted terminal repeat (ITR) sequences of AAV2. In some embodiments, the rAAV vector comprises an AAV2 genome, such that the rAAV vector is an AAV-2/9 vector, an AAV-2/6 vector, or an AAV-2/8 vector.
  • ITR inverted terminal repeat
  • AAV vectors may comprise wild-type AAV sequence or they may comprise one or more modifications to a wild-type AAV sequence.
  • an AAV vector comprises one or more amino acid modifications, e.g., substitutions, deletions, or insertions, within a capsid protein, e.g., VP1, VP2 and/or VP3.
  • the modification provides for reduced immunogenicity when the AAV vector is provided to a subject.
  • Capsid proteins of a rAAV may be modified so that the rAAV is targeted to a particular target tissue of interest such as endothelial cells or more particularly endothelial tip cells.
  • the rAAV is directly injected into the intracerebroventricular space of the subject.
  • the rAAV virion is an AAV2 rAAV virion.
  • the capsid many be an AAV2 capsid or functional variant thereof.
  • the AAV2 capsid shares at least 98%, 99%, or 100% identity to a reference AAV2 capsid, e.g.,
  • the rAAV virion is an AAV9 rAAV virion.
  • the capsid many be an AAV9 capsid or functional variant thereof.
  • the AAV9 capsid shares at least 98%, 99%, or 100% identity to a reference AAV9 capsid, e.g., SGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQI SNGTSGGSTNDNTYFGYSTPWGYFDFNRFHCHFSPRDWQ RLINNNWGFRPKRLNFKLFNIQVKEVTQNEGTKTIANNLTSTIQVFTDSEYQLPYVLGSAHQGCLPPFPADVFMI PQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFEFSYQFEDVPFHSSYAHSQSLDRLMNPLIDQYLYYLSR TQSTGGTAGTQQLLFSQAGPNNMSAQAKNWLPGPCYRQQRVS
  • the capsid protein is encoded by a polynucleotide supplied on a plasmid in trans to the transfer plasmid.
  • the polynucleotide sequence of wild-type AAVrh74 cap is as follows:
  • AAVrh74 capsid coding sequence (SEQ ID NO: 80)
  • the disclosure further provides protein sequences for AAVrh74 VP1, VP2, and VP3, including SEQ ID NOs: 2-4, and homologs or functional variants thereof.
  • AAVrh74 VP1 (SEP ID NO: 81)
  • AAVrh74 VP2 (SEQ ID NO: 82)
  • AAVrh74 VP3 (SEP ID NO: 83)
  • the AAVrh74 capsid comprises the amino acid sequence set forth in SEQ ID NO: 2.
  • the rAAV vector comprises a polypeptide that comprises, or consists essentially of, or yet further consists of a sequence, e.g., at least 65%, at least 70%, at least 75%, at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89%, more typically 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to amino acid sequence of AAVrh74 VP1 which is set forth in SEQ ID NO: 2.
  • the rAAV vector comprises a polypeptide that comprises, or consists essentially of, or yet further consists of a sequence, e.g., at least 65%, at least 70%, at least 75%, at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89%, more typically 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to amino acid sequence of AAVrh74 VP2 which is set forth in SEQ ID NO: 3.
  • the rAAV vector comprises a polypeptide that comprises, or consists essentially of, or yet further consists of a sequence, e.g., at least 65%, at least 70%, at least 75%, at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, or 89%, more typically 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more identical to amino acid sequence of AAVrh74 VP3 which is set forth in SEQ ID NO: 4.
  • the rAAV virion is an AAV-PHP.B rAAV virion or a neutrotrophic variant thereof, such as, without limitation, those disclosed in Int’l Pat. Pub. Nos. WO 2015/038958 Al and WO 2017/100671 Al.
  • the AAV capsid may comprise at least 4 contiguous amino acids from the sequence TLAVPFK (SEQ ID NO:85) or KFPVALT (SEQ ID NO: 86), e.g., inserted between a sequence encoding for amino acids 588 and 589 of AAV9.
  • the capsid many be an AAV-PHP.B capsid or functional variant thereof.
  • the AAV-PHP.B capsid shares at least 98%, 99%, or 100% identity to a reference AAV-PHP.B capsid, e.g.,
  • AAV capsids used in the rAAV virions of the disclosure include those disclosed in Pat. Pub. Nos. WO 2009/012176 A2 and WO 2015/168666 A2.
  • an AAV9 vector, AAVrh.74, or an AAVrh.10 vector will confer desirable cardiac tropism on the vector.
  • the present inventors have further determined that an AAV9 vector, AAVrh.74, or an AAVrh.10 vector may provide desired specificity to cardiac cells.
  • the disclosure provides pharmaceutical compositions comprising the rAAV virion of the disclosure and one or more pharmaceutically acceptable carriers, diluents, or excipients.
  • aqueous solutions For purposes of administration, e.g., by injection, various solutions can be employed, such as sterile aqueous solutions. Such aqueous solutions can be buffered, if desired, and the liquid diluent first rendered isotonic with saline or glucose.
  • Solutions of rAAV as a free acid (DNA contains acidic phosphate groups) or a pharmacologically acceptable salt can be prepared in water suitably mixed with a surfactant such as Poloxamer 188, e.g., at 0.001% or 0.01%.
  • a dispersion of rAAV can also be prepared in glycerol, liquid polyethylene glycols and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms.
  • the sterile aqueous media employed are all readily obtainable by standard techniques well-known to those skilled in the art.
  • the pharmaceutical forms suitable for injectable use include but are not limited to sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
  • the form is sterile and must be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating actions of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol and the like), suitable mixtures thereof, and vegetable oils.
  • the proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of a dispersion and by the use of surfactants.
  • the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal and the like. In many cases it will be preferable to include isotonic agents, for example, sugars or sodium chloride.
  • Prolonged absorption of the injectable compositions can be brought about by use of agents delaying absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions may be prepared by incorporating rAAV in the required amount in the appropriate solvent with various other ingredients enumerated above, as required, followed by filter sterilization.
  • dispersions are prepared by incorporating the sterilized active ingredient into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum drying and the freeze-drying technique that yield a powder of the active ingredient plus any additional desired ingredient from the previously sterile-filtered solution thereof.
  • the disclosure comprises a kit comprising an rAAV virion of the disclosure and instructions for use.
  • the disclosure provides a method of increasing MLP activity in a cell, comprising contacting the cell with an rAAV of the disclosure.
  • the disclosure provides a method of increasing MLP activity in a subject, comprising administering to an rAAV of the disclosure.
  • the cell and/or subject is deficient in CSRP3 messenger RNA or MLP protein expression levels and/or activity and/or comprises a loss-of-function mutation in CSRP3.
  • the cell may be a cardiac cell, e.g. a cardiomyocyte cell.
  • the method promotes survival of cardiac cell, e.g. a cardiomyocyte cell, in cell culture and/or in vivo. In some embodiments, the method promotes and/or restores function of the heart.
  • cardiac cell e.g. a cardiomyocyte cell
  • the method promotes and/or restores function of the heart.
  • the disclosure provides a method of treating a disease or disorder in a subject in need thereof, comprising administering to the subject an effective amount of an rAAV virion of the disclosure.
  • the disease or disorder is a cardiac disease or disorder.
  • Illustrative cardiac disorders include heart failure, hypertrophic cardiomyopathy, and dilated cardiomyopathy.
  • the subject suffers from a genetic disruption in CSRP3 expression or function.
  • the disease or disorder is HCM or DCM.
  • the disease or disorder is familial hypertrophic cardiomyopathy- 12 (CMH12).
  • the disease or disorder is dilated cardiomyopathy-lM (CMD1M).
  • the disease or disorder is a skeletal myopathy. In some embodiments, the disease or disorder is facioscapulohumeral muscular dystrophy, nemaline myopathy, or limb girdle muscular dystrophy type 2B. In some embodiments, the disease or disorder is limb girdle muscular dystrophy type 2A, Duchenne muscular dystrophy, or dermatomyositis.
  • the AAV-mediated delivery of MLP protein to the heart may increase life span, prevent or attenuate cardiac cell degeneration, heart failure, scarring, reduced ejection fraction, arrythmia, angina, obstructive HCM or DCM, ventricular hypertrophy (IVS: range 14-32mm), ventricular tachycardia, Mild NYHA scores I-II common, exercise intolerance, angina (chest pain), sudden cardiac death , exertional myalgias and cramps.
  • the methods disclosed herein may provide efficient biodistribution in the heart. They may result in sustained in expression in all, or a substantial fraction of, cardiac cells, e.g., cardiomyocytes. Notably, the methods disclosed herein may provide long-lasting expression of MLP protein throughout the life of the subject following AAV vector administration.
  • Combination therapies are also contemplated by the invention. Combinations of methods of the invention with standard medical treatments (e.g., corticosteroids or topical pressure reducing medications) are specifically contemplated, as are combinations with novel therapies.
  • a subject may be treated with a steroid and/or combination of immune suppressing agents to prevent or to reduce an immune response to administration of a rAAV described herein.
  • the AAV vector is administered at a dose of between about 1 x 10 12 and 5* 10 14 vector genomes (vg) of the AAV vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the AAV vector is administered at a dose of between about 1 * 10 13 and 5* 10 14 vg/kg. In some embodiments, the AAV vector is administered at a dose of between about 5* 10 13 and 3* 10 14 vg/kg. In some embodiments, the AAV vector is administered at a dose of between about 5* 10 13 and 1 x 10 14 vg/kg.
  • the AAV vector is administered at a dose of less than about 1 * 10 12 vg/kg, less than about 3* 10 12 vg/kg, less than about 5* 10 12 vg/kg, less than about 7* 10 12 vg/kg, less than about I MO 13 vg/kg, less than about 3x l0 13 vg/kg, less than about 5x l0 13 vg/kg, less than about 7*10 13 vg/kg, less than about l> ⁇ 10 14 vg/kg, less than about 3*10 14 vg/kg, less than about 5* 10 14 vg/kg, less than about 7* 10 14 vg/kg, less than about 1 x 10 15 vg/kg, less than about 3*10 15 vg/kg, less than about 5*10 15 vg/kg, or less than about 7*10 15 vg/kg.
  • the AAV vector is administered at a dose of about 1 x 10 12 vg/kg, about 3xl0 12 vg/kg, about 5xl0 12 vg/kg, about 7xl0 12 vg/kg, about IxlO 13 vg/kg, about 3xl0 13 vg/kg, about 5xl0 13 vg/kg, about 7xl0 13 vg/kg, about IxlO 14 vg/kg, about 3xl0 14 vg/kg, about 5xl0 14 vg/kg, about 7xl0 14 vg/kg, about IxlO 15 vg/kg, about 3xl0 15 vg/kg, about 5x 10 15 vg/kg, or about 7x 10 15 vg/kg.
  • the AAV vector is administered at a dose of IxlO 12 vg/kg, 3xl0 12 vg/kg, 5xl0 12 vg/kg, 7xl0 12 vg/kg, IxlO 13 vg/kg, 3xl0 13 vg/kg, 5xl0 13 vg/kg, 7xl0 13 vg/kg, IxlO 14 vg/kg, 3xl0 14 vg/kg, 5xl0 14 vg/kg, 7xl0 14 vg/kg, IxlO 15 vg/kg, 3xl0 15 vg/kg, 5xl0 15 vg/kg, or7xl0 15 vg/kg.
  • the AAV vector is administered systemically at a dose of between about 1 x 10 12 and 5x 10 14 vector genomes (vg) of the AAV vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the AAV vector is administered systemically at a dose of between about IxlO 13 and 5xl0 14 vg/kg. In some embodiments, the AAV vector is administered systemically at a dose of between about 5xl0 13 and 3xl0 14 vg/kg. In some embodiments, the AAV vector is administered systemically at a dose of between about 5xl0 13 and IxlO 14 vg/kg.
  • the AAV vector is administered systemically at a dose of less than about IxlO 12 vg/kg, less than about 3xl0 12 vg/kg, less than about 5xl0 12 vg/kg, less than about 7xl0 12 vg/kg, less than about IxlO 13 vg/kg, less than about 3xl0 13 vg/kg, less than about 5xl0 13 vg/kg, less than about 7xl0 13 vg/kg, less than about IxlO 14 vg/kg, less than about 3xl0 14 vg/kg, less than about 5x 10 14 vg/kg, less than about 7x 10 14 vg/kg, less than about 1 x 10 15 vg/kg, less than about 3xl0 15 vg/kg, less than about 5xl0 15 vg/kg, or less than about 7xl0 15 vg/kg.
  • the AAV vector is administered systemically at a dose of about IxlO 12 vg/kg, about 3xl0 12 vg/kg, about 5xl0 12 vg/kg, about 7xl0 12 vg/kg, about IxlO 13 vg/kg, about 3xl0 13 vg/kg, about 5xl0 13 vg/kg, about 7xl0 13 vg/kg, about IxlO 14 vg/kg, about 3xl0 14 vg/kg, about 5xl0 14 vg/kg, about 7xl0 14 vg/kg, about IxlO 15 vg/kg, about 3xl0 15 vg/kg, about 5xl0 15 vg/kg, or about 7xl0 15 vg/kg.
  • the AAV vector is administered systemically at a dose of IxlO 12 vg/kg, 3xl0 12 vg/kg, 5xl0 12 vg/kg, 7xl0 12 vg/kg, IxlO 13 vg/kg, 3xl0 13 vg/kg, 5xl0 13 vg/kg, 7xl0 13 vg/kg, IxlO 14 vg/kg, 3xl0 14 vg/kg, 5xl0 14 vg/kg, 7xl0 14 vg/kg, IxlO 15 vg/kg, 3xl0 15 vg/kg, 5xl0 15 vg/kg, or7xl0 15 vg/kg.
  • the AAV vector is administered intravenously at a dose of between about 1 x 10 12 and 5* 10 14 vector genomes (vg) of the AAV vector per kilogram (vg) of total body mass of the subject (vg/kg). In some embodiments, the AAV vector is administered intravenously at a dose of between about 1 x 10 13 and 5x 10 14 vg/kg. In some embodiments, the AAV vector is administered intravenously at a dose of between about 5xl0 13 and 3xl0 14 vg/kg. In some embodiments, the AAV vector is administered intravenously at a dose of between about 5xl0 13 and IxlO 14 vg/kg.
  • the AAV vector is administered intravenously at a dose of less than about 1 x 10 12 vg/kg, less than about 3xl0 12 vg/kg, less than about 5xl0 12 vg/kg, less than about 7xl0 12 vg/kg, less than about IxlO 13 vg/kg, less than about 3xl0 13 vg/kg, less than about 5xl0 13 vg/kg, less than about 7xl0 13 vg/kg, less than about IxlO 14 vg/kg, less than about 3xl0 14 vg/kg, less than about 5x 10 14 vg/kg, less than about 7x 10 14 vg/kg, less than about 1 x 10 15 vg/kg, less than about 3xl0 15 vg/kg, less than about 5xl0 15 vg/kg, or less than about 7xl0 15 vg/kg.
  • the AAV vector is administered intravenously at a dose of about IxlO 12 vg/kg, about 3xl0 12 vg/kg, about 5xl0 12 vg/kg, about 7xl0 12 vg/kg, about IxlO 13 vg/kg, about 3xl0 13 vg/kg, about 5xl0 13 vg/kg, about 7xl0 13 vg/kg, about IxlO 14 vg/kg, about 3xl0 14 vg/kg, about 5xl0 14 vg/kg, about 7xl0 14 vg/kg, about IxlO 15 vg/kg, about 3xl0 15 vg/kg, about 5xl0 15 vg/kg, or about 7xl0 15 vg/kg.
  • the AAV vector is administered intravenously at a dose of IxlO 12 vg/kg, 3xl0 12 vg/kg, 5xl0 12 vg/kg, 7xl0 12 vg/kg, IxlO 13 vg/kg, 3xl0 13 vg/kg, 5xl0 13 vg/kg, 7xl0 13 vg/kg, IxlO 14 vg/kg, 3xl0 14 vg/kg, 5xl0 14 vg/kg, 7xl0 14 vg/kg, IxlO 15 vg/kg, 3xl0 15 vg/kg, 5xl0 15 vg/kg, or7xl0 15 vg/kg.
  • AAV-mediated MLP benefit showing reduction in hypertrophy of cardiomyocytes, reduced myocyte array and reduced interstitial and perivascular fibrosis and scaring compared to baseline or disease-matched control patients.
  • Administration of an effective dose of the compositions may be by routes standard in the art including, but not limited to, systemic, local, direct injection, intravenous, intracardiac administration. In some cases, administration comprises systemic, local, direct injection, intravenous, intracardiac injection. Administration may be performed by cardiac catheterization.
  • systemic administration may be administration into the circulatory system so that the entire body is affected.
  • Systemic administration includes parental administration through injection, infusion or implantation.
  • Routes of administration for the compositions disclosed herein include intravenous (“IV”) administration, intraperitoneal (“IP”) administration, intramuscular (“IM”) administration, intralesional administration, or subcutaneous (“SC”) administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, a depot formulation, etc.
  • the methods of the disclosure comprise administering an AAV vector of the disclosure, or pharmaceutical composition thereof by intravenous, intramuscular, intraarterial, intrarenal, intraurethral, intracardiac, intracoronary, intramyocardial, intradermal, epidural, subcutaneous, intraperitoneal, intraventricular, ionophoretic or intracranial administration.
  • administration of rAAV of the present invention may be accomplished by using any physical method that will transport the rAAV recombinant vector into the target tissue of an animal. Administration includes, but is not limited to, injection into the heart.
  • the methods of the disclosure comprise intracardiac delivery.
  • Infusion may be performed using specialized cannula, catheter, syringe/needle using an infusion pump.
  • Administration may comprise delivery of an effective amount of the rAAV virion, or a pharmaceutical composition comprising the rAAV virion, to the heart. These may be achieved, e.g., via intravenous, intramuscular, intraarterial, intrarenal, intraurethral, intracardiac, intracoronary, intramyocardial, intradermal, epidural, subcutaneous, intraperitoneal, intraventricular, ionophoretic or intracranial administration.
  • the compositions of the disclosure may further be administered intravenously.
  • the method of treatment disclosed herein may reduce and/or prevent one or more symptoms including but not limited to ventricular hypertrophy, ventricular tachycardia, mild NYHA scores I-II common, exercise intolerance, and angina.
  • FIGs. 1-4 Vectors illustrated in FIGs. 1-4 are tested in vitro using cultured cardiomyocytes (e.g., induced pluripotent stem cell cardiomyocytes, iPSC-CMs). Expression of MLP is assessed by immunofluorescence and Western blot. Phosphorylation assays reveal a reduction in protein kinase C-alpha (PKC-A) autophosphorylation.
  • cultured cardiomyocytes e.g., induced pluripotent stem cell cardiomyocytes, iPSC-CMs.
  • iPSC-CMs induced pluripotent stem cell cardiomyocytes
  • Selected vectors are tested in vivo using an MLP-deficient or MLP-mutant mouse models of cardiomyopathy (e.g., C58G knock-in (KI) model or W4R KI model).
  • Efficacy is determined by measuring left ventricular ejection fraction (LVEF) and/or left ventricular end- diastolic dimension (LVED) using echocardiography, reduction in overall heart weight (e.g., normalized to tibia length), invasive haemodynamic assessments of left ventricular performance on dP/dtmax , dP/dtmin, and relaxation constant Tau, or reduction in left and/or right ventricular hypertrophy upon histologic evaluation.
  • LVEF left ventricular ejection fraction
  • LVED left ventricular end- diastolic dimension
  • in vivo efficacy in the mouse model is assessed by measuring biomarkers including but not limited to atrial natriuretic factor (Nppa) gene expression, brain natriuretic peptide (Nppb) gene expression, and beta-myosin heavy chain protein expression.
  • biomarkers including but not limited to atrial natriuretic factor (Nppa) gene expression, brain natriuretic peptide (Nppb) gene expression, and beta-myosin heavy chain protein expression.
  • Physiological efficacy is determined by testing for protein kinase C-alpha (PKC-A) activity, phosphorylated MLP in heart, ubiquitin proteasome degradation activity. Normalization or mitigation in response to treatment is observed for AAV vectors.
  • PDC-A protein kinase C-alpha
  • FIGs. 1-4 Vectors illustrated in FIGs. 1-4 were tested in vitro using a control cell line (CHO- Lec2; FIG. 5A) and cultured cardiomyocytes (differentiated AC 16 cell line; FIG. 5B ). Expression of muscle LIM protein (MLP;the protein encoded by CSRP3) was assessed by Western blot.
  • MLP muscle LIM protein
  • FIG. 5A shows CSRP3 expression in transduced CHO-Lec2.
  • FIG. 5B shows CSRP3 expression in transduced cardiomyocytes (differentiated AC 16 cell line - Sigma- Aldrich® cat# SCC 109). The cells were transduced with 3E5 MOI from each vector; after 6 days the cells lysates were collected, and a Western Blot performed using an anti-CSRP3 Polyclonal antibody (Thermo-Fisher® PA5-29155 1 : 1000).
  • Expression of the MLP protein from the CSRP3 transgene is higher when the MHCK7 promoter is used than when the hTNNT2 (“hTnT”) promoter is used.
  • Both AAV9 and AAVrh74 serotypes of AAV vector are capable of transducing the cardiomyocyte cell line. Expression of the MLP protein is apparently higher with the AAVrh74 vector than with the AAV9 vector based on data in FIG 5B.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Health & Medical Sciences (AREA)
  • Zoology (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Biotechnology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Cardiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Microbiology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Hospice & Palliative Care (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Immunology (AREA)
PCT/US2021/044412 2020-08-05 2021-08-03 Csrp3 (cysteine and glycine rich protein 3) gene therapy Ceased WO2022031756A1 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
EP21852527.7A EP4192962A4 (en) 2020-08-05 2021-08-03 CSRP3 (CYSTEINE-GLYCINE RICH PROTEIN 3) GENE THERAPY
JP2023507388A JP2023536618A (ja) 2020-08-05 2021-08-03 Csrp3(システイン及びグリシンリッチタンパク質3)遺伝子治療
US18/019,396 US20230257431A1 (en) 2020-08-05 2021-08-03 Csrp3 (cysteine and glycine rich protein 3) gene therapy
CA3184983A CA3184983A1 (en) 2020-08-05 2021-08-03 Csrp3 (cysteine and glycine rich protein 3) gene therapy
MX2023000994A MX2023000994A (es) 2020-08-05 2021-08-03 Genoterapia con csrp3 (proteina 3 rica en cisteina y glicina).
AU2021321410A AU2021321410A1 (en) 2020-08-05 2021-08-03 CSRP3 (Cysteine and Glycine Rich Protein 3) gene therapy
IL300187A IL300187A (en) 2020-08-05 2021-08-03 Gene therapy CSRP3 (protein 3 rich in cysteine and glycine)
BR112023001336A BR112023001336A2 (pt) 2020-08-05 2021-08-03 Terapia gênica de csrp3 (proteína 3 rica em cisteína e glicina)
KR1020237003436A KR20230042468A (ko) 2020-08-05 2021-08-03 Csrp3 (시스테인 및 글리신 풍부 단백질 3) 유전자 요법
CN202180057650.8A CN116234916A (zh) 2020-08-05 2021-08-03 Csrp3(富含半胱氨酸和甘氨酸的蛋白质3)基因疗法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US202063061727P 2020-08-05 2020-08-05
US63/061,727 2020-08-05

Publications (1)

Publication Number Publication Date
WO2022031756A1 true WO2022031756A1 (en) 2022-02-10

Family

ID=80118758

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/044412 Ceased WO2022031756A1 (en) 2020-08-05 2021-08-03 Csrp3 (cysteine and glycine rich protein 3) gene therapy

Country Status (11)

Country Link
US (1) US20230257431A1 (https=)
EP (1) EP4192962A4 (https=)
JP (1) JP2023536618A (https=)
KR (1) KR20230042468A (https=)
CN (1) CN116234916A (https=)
AU (1) AU2021321410A1 (https=)
BR (1) BR112023001336A2 (https=)
CA (1) CA3184983A1 (https=)
IL (1) IL300187A (https=)
MX (1) MX2023000994A (https=)
WO (1) WO2022031756A1 (https=)

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023159190A1 (en) * 2022-02-18 2023-08-24 Ginkgo Bioworks, Inc. Gene therapy for arrhythmogenic cardiomyopathy
WO2023178337A3 (en) * 2022-03-18 2023-11-23 University Of Florida Research Foundation, Incorporated Methods and compositions for treating rbm20 related cardiomyopathy with a viral vector
US11883506B2 (en) 2020-08-07 2024-01-30 Spacecraft Seven, Llc Plakophilin-2 (PKP2) gene therapy using AAV vector
US12163151B2 (en) 2016-04-20 2024-12-10 Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas O.A, M.P. Methods of treating or preventing pyruvate kinase deficiency
US12378576B2 (en) 2018-04-27 2025-08-05 Spacecraft Seven, Llc Gene therapy for CNS degeneration
US12478691B2 (en) 2020-02-13 2025-11-25 Tenaya Therapeutics, Inc. Gene therapy vectors for treating heart disease
US12496359B2 (en) 2017-10-16 2025-12-16 Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, O.A, M.P. Lentiviral vectors for delivery of PKLR to treat Pyruvate Kinase Deficiency
US12539316B2 (en) 2018-04-11 2026-02-03 Spacecraft Seven, Llc Compositions and methods for stem cell transplant

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009012176A2 (en) 2007-07-14 2009-01-22 The University Of Iowa Research Foundation Methods and compositions for treating brain diseases
WO2015038958A1 (en) 2013-09-13 2015-03-19 California Institute Of Technology Selective recovery
WO2015168666A2 (en) 2014-05-02 2015-11-05 Genzyme Corporation Aav vectors for retinal and cns gene therapy
WO2017100671A1 (en) 2015-12-11 2017-06-15 California Institute Of Technology TARGETING PEPTIDES FOR DIRECTING ADENO-ASSOCIATED VIRUSES (AAVs)
WO2019237067A1 (en) * 2018-06-08 2019-12-12 University Of Florida Research Foundation, Incorporated Aav cardiac gene therapy for cardiomyopathy

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE10004857A1 (de) * 2000-02-03 2001-08-16 Schering Ag MLP-Gen, Nukleinsäuren, Polypeptide und deren Verwendung
EP2792742A1 (en) * 2013-04-17 2014-10-22 Universitätsklinikum Hamburg-Eppendorf (UKE) Gene-therapy vectors for treating cardiomyopathy
JP7676111B2 (ja) * 2017-03-17 2025-05-14 リサーチ インスティチュート アット ネイションワイド チルドレンズ ホスピタル 筋ジストロフィーを治療するための筋肉特異的マイクロジストロフィンのアデノ随伴ウイルスベクター送達
RU2770922C2 (ru) * 2017-09-20 2022-04-25 4Д Молекьюлар Терапьютикс Инк. Капсиды вариантов аденоассоциированных вирусов и методы их применения
US20210363193A1 (en) * 2018-04-27 2021-11-25 Universität Heidelberg Modified aav capsid polypeptides for treatment of muscular diseases
EP3947700A4 (en) * 2019-04-01 2023-01-04 Tenaya Therapeutics, Inc. Adeno-associated virus with engineered capsid

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009012176A2 (en) 2007-07-14 2009-01-22 The University Of Iowa Research Foundation Methods and compositions for treating brain diseases
WO2015038958A1 (en) 2013-09-13 2015-03-19 California Institute Of Technology Selective recovery
WO2015168666A2 (en) 2014-05-02 2015-11-05 Genzyme Corporation Aav vectors for retinal and cns gene therapy
WO2017100671A1 (en) 2015-12-11 2017-06-15 California Institute Of Technology TARGETING PEPTIDES FOR DIRECTING ADENO-ASSOCIATED VIRUSES (AAVs)
WO2019237067A1 (en) * 2018-06-08 2019-12-12 University Of Florida Research Foundation, Incorporated Aav cardiac gene therapy for cardiomyopathy

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
See also references of EP4192962A4
VAFIADAKI ET AL.: "Muscle LIM Protein: Master regulator of cardiac and skeletal muscle functions", GENE, vol. 566, no. 1, 15 July 2015 (2015-07-15), pages 1 - 7, XP029232379, DOI: 10.1016/j.gene.2015.04.077 *

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12163151B2 (en) 2016-04-20 2024-12-10 Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas O.A, M.P. Methods of treating or preventing pyruvate kinase deficiency
US12496359B2 (en) 2017-10-16 2025-12-16 Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, O.A, M.P. Lentiviral vectors for delivery of PKLR to treat Pyruvate Kinase Deficiency
US12539316B2 (en) 2018-04-11 2026-02-03 Spacecraft Seven, Llc Compositions and methods for stem cell transplant
US12378576B2 (en) 2018-04-27 2025-08-05 Spacecraft Seven, Llc Gene therapy for CNS degeneration
US12478691B2 (en) 2020-02-13 2025-11-25 Tenaya Therapeutics, Inc. Gene therapy vectors for treating heart disease
US11883506B2 (en) 2020-08-07 2024-01-30 Spacecraft Seven, Llc Plakophilin-2 (PKP2) gene therapy using AAV vector
WO2023159190A1 (en) * 2022-02-18 2023-08-24 Ginkgo Bioworks, Inc. Gene therapy for arrhythmogenic cardiomyopathy
WO2023178337A3 (en) * 2022-03-18 2023-11-23 University Of Florida Research Foundation, Incorporated Methods and compositions for treating rbm20 related cardiomyopathy with a viral vector

Also Published As

Publication number Publication date
CA3184983A1 (en) 2022-02-10
JP2023536618A (ja) 2023-08-28
EP4192962A1 (en) 2023-06-14
AU2021321410A1 (en) 2023-04-06
MX2023000994A (es) 2023-03-01
KR20230042468A (ko) 2023-03-28
CN116234916A (zh) 2023-06-06
EP4192962A4 (en) 2025-04-23
BR112023001336A2 (pt) 2023-02-14
US20230257431A1 (en) 2023-08-17
IL300187A (en) 2023-03-01

Similar Documents

Publication Publication Date Title
US11883506B2 (en) Plakophilin-2 (PKP2) gene therapy using AAV vector
US12257317B2 (en) Adeno-associated virus vector delivery of a fragment of micro-dystrophin to treat muscular dystrophy
US20230257431A1 (en) Csrp3 (cysteine and glycine rich protein 3) gene therapy
US12491265B2 (en) Adeno-associated virus vector delivery of muscle specific micro-dystrophin to treat muscular dystrophy
JP7853952B2 (ja) Glut1発現のためのアデノ随伴ウイルスベクターおよびその使用
KR20250012749A (ko) Aav 벡터를 사용한 b-세포 림프종 2-관련 안타노겐 3(bag3) 유전자 요법
US20250135040A1 (en) Adeno-associated viral vector for glut1 expression and uses thereof
US20240335566A1 (en) Troponin c (tnnc1) gene therapy using aav vector
WO2022017630A1 (en) GENE THERAPY VECTOR FOR eEF1A2 AND USES THEREOF
CN118660969A (zh) 使用aav载体的亲联蛋白-2(jph2)基因疗法

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21852527

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3184983

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 20237003436

Country of ref document: KR

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112023001336

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2023507388

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112023001336

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20230124

WWE Wipo information: entry into national phase

Ref document number: 202347010923

Country of ref document: IN

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021852527

Country of ref document: EP

Effective date: 20230306

ENP Entry into the national phase

Ref document number: 2021321410

Country of ref document: AU

Date of ref document: 20210803

Kind code of ref document: A

WWG Wipo information: grant in national office

Ref document number: 2023104389

Country of ref document: RU