WO2022010254A1 - 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도 - Google Patents

인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도 Download PDF

Info

Publication number
WO2022010254A1
WO2022010254A1 PCT/KR2021/008641 KR2021008641W WO2022010254A1 WO 2022010254 A1 WO2022010254 A1 WO 2022010254A1 KR 2021008641 W KR2021008641 W KR 2021008641W WO 2022010254 A1 WO2022010254 A1 WO 2022010254A1
Authority
WO
WIPO (PCT)
Prior art keywords
growth factor
factor receptor
cell growth
human epithelial
epithelial cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/KR2021/008641
Other languages
English (en)
French (fr)
Inventor
김학성
김태윤
최윤주
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Korea Advanced Institute of Science and Technology KAIST
Original Assignee
Korea Advanced Institute of Science and Technology KAIST
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Korea Advanced Institute of Science and Technology KAIST filed Critical Korea Advanced Institute of Science and Technology KAIST
Publication of WO2022010254A1 publication Critical patent/WO2022010254A1/ko
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/001Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/70Vectors or expression systems specially adapted for E. coli
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/575Immunoassay; Biospecific binding assay; Materials therefor for cancer

Definitions

  • the present invention relates to a novel polypeptide that specifically binds to domain 4 of human epithelial growth factor receptor type 2 (HER2) and uses thereof, and more specifically, to a specific location of human epithelial growth factor receptor 2 using computational biology methods. It relates to novel polypeptides designed to bind to domain 4 of its type, to methods for preparing said polypeptides and to uses of said polypeptides.
  • HER2 human epithelial growth factor receptor type 2
  • Human Epidermal Growth Factor Receptor 2 (HER2) is known as a protein overexpressed together with type 1 (EGFR) in many cancer cells. These human epithelial cell growth factor receptor protein families (ErbB Protein Family) are overexpressed in specific cancer cells to form a dimer with itself (homo) or heterogeneity, thereby promoting the differentiation and growth of cancer cells. For this reason, many pharmaceutical companies have developed antibodies to these phosphate epithelial cell growth factor receptor proteins. Among them, human epithelial growth factor receptor type 1 and type 2 research has been most actively conducted.
  • human epithelial cell growth factor receptor type 2 protein is specifically overexpressed in many cancer cells, including breast cancer cells, and thus It was intended to develop an antibody as a specific antigen for
  • this type 2 does not have a specific receptor (ligand) and is known to promote the growth and differentiation of cancer cells through the formation of a hetero-dimer with other receptors in the protein family. Domains 2 and 4 are involved in the formation of this heteroduplex. Therefore, when targeting the extracellular receptor of HER2, the cancer cell growth inhibitory effect can be obtained only when it binds to a specific site involved in the formation of a heterogeneous duplex.
  • a library-based method currently being used universally.
  • the repeat body is composed of a Leucine-rich repeat (LRR) module, has a size of 1/5 that of an antibody, and can be mass-produced in E. coli as well as has very excellent thermal and pH stability.
  • LRR Leucine-rich repeat
  • repeat bodies that specifically bind to a target substance can be easily selected using phage display, and the binding force to the target can be very easily increased to the pico-mole level.
  • the present inventors specifically bind to domain 4 of human epithelial cell growth factor receptor type 2 and at the same time to develop a new polypeptide capable of binding to a specific target position.
  • HER2 human epithelial cell growth factor receptor type 2
  • HER2 human epithelial cell growth factor receptor type 2
  • An object of the present invention is to provide a repebody that binds to domain 4 of human epithelial cell growth factor receptor type 2 by grafting a computational biological method and a library-based module expansion method.
  • Another object of the present invention is to provide a nucleotide encoding the repeat body and a recombinant vector comprising the nucleotide.
  • Another object of the present invention is to provide a recombinant microorganism into which the nucleotide or the recombinant vector is introduced.
  • Another object of the present invention is to provide a method for producing a repeat body using the recombinant microorganism.
  • Another object of the present invention is to provide a composition for treating cancer containing the Lipibody as an active ingredient.
  • Another object of the present invention is to provide a composition for diagnosing cancer containing the Lipibody as an active ingredient.
  • the present invention provides a repebody represented by the amino acid sequence of SEQ ID NO: 1 and selectively binding to domain 4 of human epithelial cell growth factor receptor type 2 (repebody).
  • the present invention also provides a polynucleotide encoding the repeat body.
  • the present invention also provides a recombinant vector comprising the polynucleotide.
  • the present invention also provides a recombinant microorganism into which the polynucleotide or the recombinant vector is introduced.
  • the present invention also comprises the steps of (i) culturing the recombinant microorganism to generate a repibody; And (ii) it provides a method for producing the repeat body, comprising the step of recovering the produced repeat body.
  • the present invention also provides a composition for the treatment of cancer containing the repi body as an active ingredient.
  • the present invention also provides a composition for diagnosing cancer containing the Lipibody as an active ingredient.
  • the present invention also provides a method for treating cancer comprising administering the Lipibody.
  • the present invention also provides the use of the Lipibody for the treatment or prevention of cancer.
  • the present invention also provides the use of said Refibody for the manufacture of a medicament for the treatment of cancer.
  • 1 is a diagram showing the candidates selected in the order of the highest binding energy difference value ( ⁇ G) among the repeat bodies designed computationally biologically to bind to domain 4 of human epithelial cell growth factor receptor type 2 in the present invention.
  • Figure 2 shows the results of the enzyme-linked immunoprecipitation assay (Enzyme-Linked Immunosorbent Assay, ELISA) confirming whether or not the target competition with the existing antibody (trastuzumab) with a known binding position with the selected repeat body candidates.
  • enzyme-linked immunoprecipitation assay Enzyme-Linked Immunosorbent Assay, ELISA
  • FIG. 3 is a diagram showing a structural model of binding to human epithelial cell growth factor receptor type 2 predicted computationally for Rb-H0, a candidate refibody with the greatest competition for a target with an existing antibody.
  • Figure 4 is a schematic diagram showing the overall structure of a random library constructed with respect to the selected amino acids based on the binding structure predicted for the enhancement of the binding of the selected repeat body early candidates.
  • FIG. 5 is a view showing the results of measuring the change in the binding force of the repeat body having increased binding force by the phage display method by enzyme-linked immunoprecipitation assay (ELISA).
  • ELISA enzyme-linked immunoprecipitation assay
  • FIG. 6 shows the results of measuring the binding force of the repeat body specifically binding to the human epithelial cell growth factor receptor type 2 developed in the present invention by surface plasmon resonance (SPR).
  • SPR surface plasmon resonance
  • FIG. 7 shows the results measured by enzyme-linked immunoprecipitation assay (ELISA) in order to confirm that the selected repeat body clones maintain competition with the existing antibody and target protein as a result of a change in binding affinity.
  • ELISA enzyme-linked immunoprecipitation assay
  • Figure 10 shows the Rb-H2 repeater body developed in the present invention is labeled with a fluorescent substance (Fluorescein isothiocyanate, FITC) to specifically bind to the human epithelial cell growth factor receptor type 2 expressed on the surface of cancer cells, and to determine the expression level of the cell surface. The results confirming that different fluorescence intensities are shown are shown.
  • FITC Fluorescein isothiocyanate
  • FIG 11 shows the results of comparative analysis of cancer cell proliferation inhibitory efficacy by treating cancer cells with the Rb-H2 repeat body according to the present invention and the previously developed antibody (trastuzumab), respectively.
  • a novel polypeptide is developed by combining a computational biological method and a library-based phage display method with a polypeptide that specifically binds to domain 4 of the human epithelial cell growth factor receptor type 2, and the binding characteristics of the novel polypeptide and inhibition of cancer cell proliferation ability was confirmed.
  • the N-terminus of the internalin B protein in order to develop a novel polypeptide capable of specifically binding to domain 4 of the human epithelial cell growth factor receptor type 2, the N-terminus of the internalin B protein, the consensus design (consensus design) to design candidates capable of binding to a target position by computational biological methods in a structurally concave region of a polypeptide fused with a Leucine-rich repeat (LRR) module optimized by design), and select a desired position among these candidates
  • LRR Leucine-rich repeat
  • the library may be in the form of a phagemid including the polynucleotide.
  • phagemid refers to a circular polynucleotide molecule derived from a phage, which is a virus with E. coli as a host, and includes sequences of proteins and surface proteins necessary for propagation and proliferation.
  • Recombinant phagemids may be prepared using genetic recombination techniques well known in the art, and site-specific DNA cleavage and ligation may be performed using enzymes generally known in the art.
  • the phagemid may include a signal sequence or leader sequence for secretion in addition to expression control elements such as promoter, operator, initiation codon, stop codon, and enhancer. method can be used for The promoter of the phagemid is primarily inducible and may contain selectable markers for selecting host cells.
  • the phagemid includes MalEss, DsbAss or PelBss, which is a signal sequence or leader sequence for expressing and secreting a polynucleotide encoding a polypeptide constituting the library, and confirming the expression of the recombinant protein on the surface of the phage.
  • SEQ ID NO: 1 described in the present inventor's prior patent (Korean Patent No. 1,356,075) comprising a histidine-tag for expression and a polynucleotide encoding a gp3 domain, which is a kind of surface protein of M13 phage for expression on the phage surface. It may be a polynucleotide, but is not particularly limited thereto.
  • the present inventors can bind to domain 4 of human epithelial cell growth factor receptor type 2 using a computational biological method using a Lipibody corresponding to SEQ ID NO: 1 of the prior patent (Korean Patent No. 1,356,075) including the phagemid.
  • Possible repeat body candidates were designed, and among them, the top 10 novel polypeptide candidates (SEQ ID NOs: 2, 3, 4, 5, 6, 7, 8, 9, 10, 11) were selected based on the binding energy difference value. .
  • a candidate polypeptide SEQ ID NO: 6 whose binding site overlaps with trastuzumab was selected.
  • SEQ ID NO: 13 a novel polypeptide with increased binding power as a result of performing site directed mutagenesis (SEQ ID NO: 12) for 7 amino acids selected based on the predicted binding structure was selected.
  • SEQ ID NO: 14 site directed mutagenesis
  • the present invention relates to a repebody represented by the amino acid sequence of SEQ ID NO: 1 and selectively binding to a specific site of domain 4 of human epithelial cell growth factor receptor type 2 (repebody).
  • the term “repebody” refers to a polypeptide composed of an LRR (Leucine-rich repeat) module optimized by the N-terminus of internalin having an LRR structure and a consensus design.
  • the repeat body protein can be structurally divided into a concave region and a convex region (Fig. 4).
  • the concave region has high sequence diversity and is known to be an important site for protein interaction.
  • the convex region plays a role in stably maintaining the overall structure of the protein based on highly conserved sequences.
  • the repeat body protein may include all proteins belonging to the LRR family having a repeating module, including both fusion LRR family proteins with improved water-soluble expression and biophysiochemical properties of the protein by the above method.
  • LRR protein refers to a protein consisting of a combination of modules in which leucine is repeated at a certain position, (i) has one or more LRR repeat modules, (ii) the LRR The repeat module consists of 20 to 30 amino acids, and (iii) the LRR repeat module has "LxxLxxLxLxxN” as a conserved pattern, where L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine and tryptophan.
  • Hydrophobic amino acids such as N is asparagine, glutamine, serine, cysteine or threonine, x is any amino acid, and (iv) LRR family proteins refer to proteins having a three-dimensional structure such as a horseshoe.
  • the LRR family protein of the present invention has a sequence unknown to the natural world through design such as consensus design, in addition to those whose sequence is already known or found using newly induced mRNA or cDNA in vivo, and is a repeating module It may include all variants having a skeletal structure of
  • the term "internalin B protein” is a kind of LRR family protein expressed in Listeria strains, and has an N-terminal structure different from other LRR family proteins in which other hydrophobic cores are uniformly distributed throughout the molecule. is known to be stably expressed in microorganisms.
  • the N-terminus of these internalin proteins the most important N-terminal region for the folding of the repeat module is not only derived from microorganisms, but also has a stable shape including an alpha helix, so stable expression of LRR family proteins in microorganisms can be used effectively for
  • N-terminus of internalin protein refers to the N-terminus of internalin protein required for water-soluble expression and folding of the protein, and includes an alpha helical capping motif and repeating module of the internalin protein. it means.
  • the N-terminus of the internalin protein includes, without limitation, the N-terminus of the internalin protein required for soluble expression and folding of the protein, and examples thereof include an alpha helical capping motif "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" and a repeat module.
  • the repeating module pattern may include "LxxLxxLxLxxN".
  • L is alanine, glycine, phenylalanine, tyrosine, leucine, isoleucine, valine or tryptophan; N is asparagine, glutamine, serine, cysteine or threonine and x is any hydrophilic amino acid.
  • N-terminus of the internalin protein the N-terminus with high structural similarity can be selected depending on the type of LRR family protein to which it can be fused, and the most stable amino acid is selected through calculation of binding energy, etc. Variation is possible
  • human epithelial cell growth factor receptor type 2 is a protein overexpressed on the surface of cancer cells, and instead of having a ligand, it interacts with itself (homo) or other receptors belonging to the human epithelial cell growth factor receptor protein family. It promotes the differentiation and proliferation of cancer cells by forming a hetero-dimer. Therefore, in order to inhibit the growth of cancer cells overexpressing these human epithelial cell growth factor receptor type 2, the dimer formation must be prevented by targeting the domain involved in the dimer formation.
  • the extracellular part of human epithelial cell growth factor receptor type 2 consists of a total of four protein domains, and it is known that domains 2 and 4 are involved in dimer formation.
  • the present invention provides a polynucleotide encoding the repeat body; It relates to a recombinant vector and a recombinant microorganism comprising the polynucleotide.
  • the polynucleotide is not particularly limited thereto, but may be a polynucleotide encoding the amino acid sequence of SEQ ID NO: 1, and 70% or more, more preferably 80% or more, more preferably with the polynucleotide It may be a polynucleotide having a nucleotide sequence having a homology of 90% or more, but is not particularly limited thereto.
  • the term "vector” refers to a DNA preparation containing the nucleotide sequence of a polynucleotide encoding the target protein operably linked to a suitable regulatory sequence so that the target protein can be expressed in a suitable host.
  • suitable regulatory sequences include promoters capable of initiating transcription, optional operator sequences for regulating such transcription, sequences encoding suitable mRNA ribosome binding sites, and sequences regulating the termination of transcription and translation.
  • the vector After transformation into an appropriate host, the vector can replicate or function independently of the host genome, and can be integrated into the genome itself.
  • the vector used in the present invention is not particularly limited as long as it can replicate in a host, and any vector known in the art may be used.
  • Examples of commonly used vectors include plasmids, phagemids, cosmids, viruses and bacteriophages in a natural or recombinant state.
  • pWE15, M13, ⁇ MBL3, ⁇ MBL4, ⁇ IXII, ⁇ ASHII, ⁇ APII, ⁇ t10, ⁇ t11, Charon4A, and Charon21A can be used as phage vectors or cosmid vectors, and pBR-based, pUC-based, and pBluescriptII-based plasmid vectors can be used.
  • pGEM-based, pTZ-based, pCL-based and pET-based and the like can be used.
  • the vector usable in the present invention is not particularly limited, and a known expression vector may be used.
  • pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a, pcDNA3.1 vector and the like can be used.
  • pET-21a, pET-32a, pcDNA3.1 vectors can be used.
  • the term "recombinant microorganism” refers to a cell transfected with a vector having a gene encoding one or more target proteins introduced into a host cell to express the target protein, and all cells such as eukaryotic cells and prokaryotic cells It may be, but is not particularly limited thereto, bacterial cells such as E. coli, Streptomyces, Salmonella typhimurium; yeast cells; fungal cells such as Pichia pastoris; insect cells such as Drosophila and Spodoptera Sf9 cells; animal cells such as CHO, COS, NSO, 293, and Bow melanoma cells; or plant cells.
  • bacterial cells such as E. coli, Streptomyces, Salmonella typhimurium
  • yeast cells fungal cells such as Pichia pastoris
  • insect cells such as Drosophila and Spodoptera Sf9 cells
  • animal cells such as CHO, COS, NSO, 293, and Bow melanoma cells; or plant cells.
  • the host cells usable in the present invention are not particularly limited, but preferably Escherichia coli can be used as the host cell. Most preferably, Escherichia coli BL21 (DE3) and OrigamiB (DE3) can be used as host cells.
  • the term “transformation” refers to introducing a vector including a polynucleotide encoding a target protein into a host cell so that the protein encoded by the polynucleotide can be expressed in the host cell.
  • Transformed polynucleotides include all of them regardless of whether they are inserted into the chromosome of the host cell or located extrachromosomally, as long as they can be expressed in the host cell.
  • the polynucleotide includes DNA and RNA encoding a target protein. The polynucleotide may be introduced in any form as long as it can be expressed and introduced into a host cell.
  • the polynucleotide may be introduced into a host cell in the form of an expression cassette, which is a gene construct including all elements necessary for self-expression.
  • the expression cassette usually includes a promoter operably linked to the polynucleotide, a transcription termination signal, a ribosome binding site, and a translation termination signal.
  • the expression cassette may be in the form of an expression vector capable of self-replication.
  • the polynucleotide may be introduced into a host cell in its own form and operably linked to a sequence required for expression in the host cell.
  • the present invention comprises the steps of: (i) culturing the recombinant microorganism to generate a repeati body; And (ii) relates to a method for producing a repeati body comprising the step of recovering the produced repeati body.
  • the step of culturing the recombinant microorganism is not particularly limited thereto, but is preferably performed by a known batch culture method, a continuous culture method, a fed-batch culture method, etc., and the culture conditions are not particularly limited thereto,
  • a suitable pH pH 5-9, preferably pH 6-8, most preferably pH 6.8 is adjusted using a basic compound (eg sodium hydroxide, potassium hydroxide or ammonia) or an acidic compound (eg phosphoric acid or sulfuric acid).
  • aerobic conditions can be maintained by introducing oxygen or oxygen-containing gas mixture into the culture, and the culture temperature can be maintained at 20 to 45 °C, preferably 25 to 40 °C, and for about 10 to 160 hours Cultivation is preferred.
  • the polypeptide produced by the culture may be secreted into the medium or remain in the cell.
  • the culture medium used includes sugars and carbohydrates (eg, glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose), oils and fats (eg, soybean oil, sunflower seed) as carbon sources.
  • sugars and carbohydrates eg, glucose, sucrose, lactose, fructose, maltose, molasses, starch and cellulose
  • oils and fats eg, soybean oil, sunflower seed
  • Nitrogen sources include nitrogen-containing organic compounds such as peptone, yeast extract, broth, malt extract, corn steep liquor, soy meal and urea, or inorganic compounds such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and ammonium nitrate) may be used individually or in combination;
  • As the phosphorus source potassium dihydrogen phosphate, dipotassium hydrogen phosphate, sodium-containing salts corresponding thereto, etc. may be used individually or in combination; It may contain essential growth-promoting substances such as other metal salts (eg magnesium sulfate or iron sulfate), amino acids and vitamins.
  • the method of recovering the polypeptide produced in the culturing step of the present invention is a culture method, for example, using a suitable method known in the art according to a batch, continuous, or fed-batch culture method to recover the target repeater body from the culture medium. can do.
  • the Lipibody of the present invention when using the Lipibody of the present invention, it can be used to treat cancer cells overexpressing human epithelial cell growth factor receptor type 2 by replacing the existing antibody.
  • the present invention relates to a composition for treating cancer containing the Lipibody as an active ingredient.
  • Lipibody of the present invention cancer cells overexpressing human epithelial cell growth factor receptor type 2 can be diagnosed.
  • cancer cells (Sk-Br3, Sk-Ov3 and MCF-7) were treated with Rb-H2 repeat body according to the present invention and trastuzumab as a positive control, and the ability to inhibit the growth of cancer cells was confirmed, as a result, It was confirmed that the Rb-H2 repeat body had the ability to inhibit cancer cell growth similar to that of trastuzumab (FIG. 11), and through this, it was confirmed that the Rb-H2 repeat body inhibited the proliferation of cancer cells by interfering with dimer formation similar to trastuzumab.
  • the present invention relates to a method of treating cancer comprising administering the Lipibody.
  • the present invention relates to the use of the Lipibody for the treatment or prevention of cancer.
  • the present invention relates to the use of the Lipibody for the manufacture of a medicament for the treatment of cancer.
  • the present invention relates to a composition for diagnosing cancer containing the Lipibody as an active ingredient.
  • the cancer in which the human epithelial cell growth factor receptor type 2 is overexpressed includes breast cancer, colorectal cancer, ovarian cancer, gastric cancer, and the like, but is not limited thereto.
  • cancer cells can be diagnosed by labeling the repeat body with a fluorescent material or a radioactive isotope and then injecting it into the body to measure the fluorescence or radioactive isotope.
  • the cancer in which the human epithelial cell growth factor receptor type 2 is overexpressed includes breast cancer, colorectal cancer, ovarian cancer, gastric cancer, and the like, but is not limited thereto.
  • Example 1 Selection of Lipibody candidates that specifically bind to domain 4 of human epithelial cell growth factor receptor type 2 using computational biological method
  • the binding energy difference value among the candidates obtained by the computational biological method (ClusPro webserver) using the repeater body structure of SEQ ID NO: 2 was calculated. Based on the top 10 candidates were selected (FIG. 1). After expressing each of the 10 candidates, trastuzumab (Roach, Seoul, Korea), an antibody known to bind to domain 4, and c-Myc antibody with HRP (Santa Cruz Biotechnology, TX, USA) were used to determine whether or not to compete for the target. was used and the final candidate (Rb-H0) was selected (FIG. 2).
  • Example 2 Fabrication of a module-based library for increasing the binding force of the repeat body
  • Rb-H1 was predicted by computational biological methods, and 7 amino acids located in modules (LRR1, LRRV1, LRRV2) were selected based on this and mutated in the same manner as above.
  • Example 3 Enhancement of binding affinity to human epithelial cell growth factor receptor type 2 through panning process of the Lipibody library
  • a polypeptide capable of binding to human epithelial growth factor receptor type 2 was selected and purified.
  • biotinylated human epithelial cell growth factor receptor type 2 extracellular domain was added to 10 ⁇ L of streptavidin-labeled Dynabead at a concentration of 4 ⁇ g/mL, and then at 4 °C. coated for 2 hours.
  • the coated Dynabead was washed 3 times with PBS, and blocked with a PBS solution (TPBSA) containing 1% BSA and 0.05% Tween 20 at 4° C. for 2 hours.
  • TPBSA PBS solution
  • the purified phage was prepared in a PBS solution containing 1% BSA and 0.05% Tween 20 at a concentration of 10 12 cfu/ml and purified Rb-H0 or Rb-H1 repibody at a concentration of 1 ⁇ M (TPBSA). ), added to 40 ⁇ L of Dynabead, and negative selection was performed at 4 °C for 2 hours. After separating the phage and the Dynabead using a magnet, the phage solution was mixed with the coated Dynabead and reacted at room temperature for 2 hours.
  • Example 4 Confirmation and sequence analysis of whether the selected phage binds to human epithelial cell growth factor receptor type 2
  • Enzyme-linked immunosorbent assay was performed on the phages selected by the method of Example 3 using a 96-well plate coated with human epithelial cell growth factor receptor type 2 and bovine serum albumin (BSA). 100 ⁇ L of each phage was mixed with 100 ⁇ L of PBS solution (TPBSA) containing 1% BSA and 0.05% Tween 20 and reacted at room temperature for 1 hour. In addition, blocking was performed in each well with a PBS solution (TPBSA) containing 1% BSA and 0.05% Tween 20. After that, 100 ⁇ L of phage was put into each well and reacted at room temperature for 1 hour, followed by washing with TPBS 5 times.
  • PBSA PBS solution
  • OD 450 Absorbance (OD 450 ) was measured using HRP-linked antibody to M13 phage.
  • Refibody candidates with the highest absorbance (OD 450 ) of wells coated with human epithelial cell growth factor receptor type 2 compared to BSA were selected, and as a result of confirming the amino acid sequence of each of these, after excluding the phage into which cysteine was inserted, one type of Repeat body phage (Rb-H1) was selected (SEQ ID NO: 13).
  • Example 3 After preparing a library based on Rb-H1 by the method of Example 2, the method of Example 3 and the above method were additionally performed to further enhance the binding affinity to human epithelial cell growth factor receptor type 2 (Rb- H2) was selected (SEQ ID NO: 14).
  • Rb-H0, Rb-H1, Rb-H2 Lipibody alone is mixed with 10 ⁇ g/mL or trastuzumab 100 ⁇ g/mL, treated with 100 ⁇ L in each well, reacted at room temperature for 1 hour, and then 5 with TPBS. washed once.
  • Each well of the biotin-linked antibody capable of capturing the repeat body was treated with 100 ⁇ L of 1 ⁇ g/mL in each well, reacted at room temperature for one hour, and then washed 5 times with TPBS. After that, it is treated with streptavidin-horseradish peroxidase (HRP) and reacted at room temperature for another hour.
  • HRP streptavidin-horseradish peroxidase
  • Example 7 Confirmation of stable binding ability of the selected Lipibody to human epithelial cell growth factor receptor type 2
  • Example 8 Confirmation of the discrimination ability of the selected repibody against the human epithelial cell growth factor receptor protein family
  • Example 9 Confirmation of binding ability to human epithelial cell growth factor receptor type 2 expressed on the surface of cancer cells of the selected Lipibody
  • each cancer cell was grown on an 8-well slide glass, treated with FITC-labeled Rb-H2 at 1 ⁇ g/mL, reacted at 37 °C, 5% CO 2 chamber for 30 minutes, and washed 5 times with DPBS. .
  • Cancer cells included Sk-Br3 (ATCC, VA, USA; human breast cancer cells) with the highest expression of human epithelial growth factor receptor type 2, intermediate level Sk-Ov3 (ATCC, VA, USA; human ovarian cancer cells), and the most Three types of low-level MCF-7 (ATCC, VA, USA; human breast cancer cells) were used. Fluorescent cells were photographed using confocal microscopy.
  • the proliferation inhibitory ability of the selected Rb-H2 repeat bodies against cancer cells (Sk-Br3, Sk-Ov3 and MCF-7) used in Example 9 was confirmed.
  • Trastuzumab was used as a control group. After each cancer cell was grown in a 96-well plate, Rb-H2 refibody or trastuzumab was diluted by 1/10 starting with a concentration of 1 ⁇ M and provided to each well. As a result, it was confirmed that the Rb-H2 repibody had a cancer cell growth inhibitory ability similar to that of trastuzumab ( FIG. 11 ). In addition, it was confirmed that the Rb-H2 repibody inhibited cancer cell proliferation by interfering with dimer formation like trastuzumab.
  • novel polypeptide that specifically binds to domain 4 of the human epithelial cell growth factor receptor type 2 replaces the existing antibody for cancer treatment and is used not only for cancer treatment but also for diagnosis of specific cancer by labeling fluorescent or radioactive material. can also be used

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Plant Pathology (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pathology (AREA)
  • Cell Biology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Peptides Or Proteins (AREA)
  • Hospice & Palliative Care (AREA)

Abstract

본 발명은 계산생물학 방법을 이용해 인간 상피세포 증식인자 수용체 2형의 도메인 4의 특정 위치에 결합하도록 설계된 신규 폴리펩티드, 상기 폴리펩티드의 제조방법 및 상기 폴리펩티드의 용도에 관한 것으로, 본 발명에 따른 신규 폴리펩티드는 새로운 암 진단 및 치료제로써 기존의 항체를 대체할 수 있을 것으로 기대된다.

Description

인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도
본 발명은 인간 상피세포 증식인자 수용체 2형(HER2)의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도에 관한 것으로, 보다 구체적으로 계산생물학 방법을 이용해 특정 위치인 인간 상피세포 증식인자 수용체 2형의 도메인 4에 결합하도록 설계된 신규 폴리펩티드, 상기 폴리펩티드의 제조방법 및 상기 폴리펩티드의 용도에 관한 것이다.
인간 상피세포 증식인자 수용체 2형(Human Epidermal Growth Factor Receptor 2, HER2)은 많은 암세포에서 1형(EGFR)과 함께 과발현되는 단백질로 알려져 있다. 이들 인간 상피세포 증식인자 수용체 단백질족(ErbB Protein Family)들은 특정 암세포에서 과발현되어 자기 자신(homo) 혹은 이형(hetero)과 이합체(dimer)를 형성하여 암세포의 분화와 성장을 촉진한다. 이러한 이유로 많은 제약회사에는 이러한 인산 상피세포 증식인자 수용체 단백질들에 대한 항체를 개발해 왔다. 그 중에서 인간 상피세포 증식인자 수용체 1형과 2형에 대한 연구가 가장 활발하게 진행되었다, 특별히, 인간 상피세포 증식인자 수용체 2형 단백질은 유방암 세포를 포함한 많은 암세포에서 특이적으로 과발현되어 이들 암세포에 대한 특이적인 항원으로써 항체를 개발하고자 하였다. 그런데, 이 2형은 1형과는 다르게 특정한 수용인자(ligand)가 존재하지 않으며 단백질 족 내의 다른 수용체와의 이질 이합체(hetero-dimer) 형성을 통하여 암세포의 성장과 분화를 촉진하는 것으로 알려져 있다. 이러한 이질이중체의 형성에는 도메인 2와 4가 관여하고 있다. 따라서, HER2의 세포 밖 수용체를 표적 시 이질 이중체의 형성에 관여하는 특정 위치에 결합할 경우에만 암세포 성장 억제 효과를 얻을 수 있다. 하지만, 이러한 특정위치를 표적하는 단백질을 개발하는 것은 현재 범용적으로 이용되고 있는 라이브러리에 기반한 방법으로는 많은 어려움이 따른다.
다양한 질병의 치료제 개발을 위하여 질병에 특이적인 항원에 결합하는 항체나 단백질을 개발하려는 연구가 지속되고 있다. 그러나, 이러한 특이적 결합체들은 많은 시간과 실험이 요구되며 또한 대부분의 경우 라이브러리에 기반한 무작위 선택에 의존하고 있기에 선택된 결합 단백질이 결합하는 위치가 생물학적으로 혹은 의학적으로 효과가 없는 위치인 경우가 많이 발생한다. 이로 인하여, 원하는 특정 위치에 특이적으로 결합할 수 있는 단백질의 개발이 요구되고 있다.
계산생물학의 발전으로 인하여 특정 단백질에 결합하는 단백질의 개발 기술도 점점 고도화되고 있다. 이러한 기술을 이용하여 치료용 단백질을 설계하고 개발하는 연구가 활발히 진행 중이며 이를 실제 치료제 개발에 적용하려는 노력이 최근 들어 많아지고 있다. 하지만, 아직까지 컴퓨터의 계산능력의 한계 및 에너지 함수의 부정확성으로 인하여 많은 어려움을 갖고 있다. 특히, 구조가 매우 단단한 단백질에 대해서는 많은 성과를 이루고 있지만 아직까지 많은 loop로 이루어져 매우 유동적인 단백질에 대한 결합 단백질 설계와 개발은 많은 어려움을 가지고 있다.
이러한 배경하에, 본 발명자들은 리피바디(repebody)라는 신규 단백질 골격을 이용하여 다양한 질병 표적 단백질에 특이적으로 결합하는 새로운 폴리펩티드를 개발하였다. 상기 리피바디는 LRR (Leucine-rich repeat) 모듈로 구성되어 있고 크기가 항체의 1/5 수준이며 대장균에서 대량생산이 가능할 뿐만 아니라 열 및 pH 안정성이 매우 우수한 특징을 가지고 있다. 또한 표적 물질에 대해 특이적으로 결합하는 리피바디를 파지 디스플레이(Phage display)를 이용하여 쉽게 선별할 수 있고 표적에 대한 결합력을 pico-mole 수준까지 매우 용이하게 증가시킬 수 있다.
이에, 본 발명자들은 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하며 동시에 목표하는 특정한 위치에 결합할 수 있는 새로운 폴리펩티드를 개발하기 위해, 예의 노력한 결과, 계산생물학적 방법을 이용하여 기존에 결합하는 위치가 알려진 치료용 항체(trastuzumab)와 결합위치가 겹치는 리피바디를 디자인하고, 파지 디스플레이 방법을 이용한 모듈 기반 결합력 증대를 통해 인간 상피세포 증식인자 수용체 2형(HER2)의 도메인 4에 특이적인 결합력을 갖는 신규한 폴리펩티드를 개발하고, 상기 신규 폴리펩티드가 인간 상피세포 증식인자 수용체 2형에 대한 특이성과 결합력이 매우 높으며 기존에 개발된 도메인 4에 결합하는 항체(trastuzumab)와의 결합 위치가 겹치는 것을 확인하였고, 세포막에 발현되어 있는 인간 상피세포 증식인자 수용체 2형과도 특이적으로 결합하는 것을 확인하였으며, 기존의 개발된 항체와 유사한 암세포 증식 억제 효능을 보이는 것을 통해 이합체 형성을 억제할 수 있는 것을 확인하고, 본 발명을 완성하게 되었다.
발명의 요약
본 발명의 목적은 계산생물학적인 방법과 라이브러리 기반 모듈 증대 방법을 접목하여 인간 상피세포 증식인자 수용체 2형의 도메인 4에 결합하는 리피바디(Repebody)를 제공하는데 있다.
본 발명의 다른 목적은 상기 리피바디를 코딩하는 뉴클레오티드 및 상기 뉴클레오티드를 포함하는 재조합 벡터를 제공하는데 있다.
본 발명의 또 다른 목적은 상기 뉴클레오티드 또는 재조합 벡터가 도입된 재조합 미생물을 제공하는데 있다.
본 발명이 또 다른 목적은 상기 재조합 미생물을 이용한 리피바디의 제조방법을 제공하는데 있다.
본 발명의 또 다른 목적은 상기 리피바디를 유효성분으로 함유하는 암 치료용 조성물을 제공하는데 있다.
본 발명의 또 다른 목적은 상기 리피바디를 유효성분으로 함유하는 암 진단용 조성물을 제공하는데 있다.
상기 목적을 달성하기 위하여, 본 발명은 서열번호 1의 아미노산 서열로 표시되고, 인간 상피세포 증식인자 수용체 2형의 도메인 4에 선택적으로 결합하는 리피바디(repebody)를 제공한다.
본 발명은 또한, 상기 리피바디를 코딩하는 폴리뉴클레오티드를 제공한다.
본 발명은 또한, 상기 폴리뉴클레오티드를 포함하는 재조합 벡터를 제공한다.
본 발명은 또한, 상기 폴리뉴클레오티드 또는 상기 재조합 벡터가 도입되어 있는 재조합 미생물을 제공한다.
본 발명은 또한, (i) 상기 재조합 미생물을 배양하여 리피바디를 생성시키는 단계; 및 (ii) 상기 생성된 리피바디를 회수하는 단계를 포함하는, 상기 리피바디의 제조방법을 제공한다.
본 발명은 또한, 상기 리피바디를 유효성분으로 함유하는 암 치료용 조성물을 제공한다.
본 발명은 또한, 상기 리피바디를 유효성분으로 함유하는 암 진단용 조성물을 제공한다.
본 발명은 또한, 상기 리피바디를 투여하는 단계를 포함하는 암의 치료방법을 제공한다.
본 발명은 또한, 암의 치료 또는 예방을 위한 상기 리피바디의 용도를 제공한다.
본 발명은 또한, 암의 치료용 약제 제조를 위한 상기 리피바디의 사용을 제공한다.
도 1은 본 발명에서 인간 상피세포 증식인자 수용체 2형의 도메인 4에 결합하도록 계산생물학적으로 설계된 리피바디 중 결합에너지차이 값(ΔΔG)이 가장 높은 순으로 선별된 후보군들을 나타내는 도면이다.
도 2는 선별된 리피바디 후보군들과 결합위치가 알려진 기존의 항체(trastuzumab)와의 표적에 대한 경쟁 여부를 확인한 효소 결합 면역 침강 분석법(Enzyme-Linked Immunosorbent Assay, ELISA)의 결과를 나타낸 것이다.
도 3은 기존 항체와의 표적에 대한 경쟁이 가장 큰 후보 리피바디 Rb-H0에 대하여 계산생물학적으로 예측된 인간 상피세포 증식인자 수용체 2형과의 결합 구조 모델을 나타내는 도면이다.
도 4는 선별된 리피바디 초기후보의 결합 증대를 위해 예측된 결합 구조를 기반으로 선별한 아미노산에 대하여 구축한 무작위적인 라이브러리의 전체 구조를 나타내는 개략도이다.
도 5는 파지 디스플레이 방법으로 결합력이 증대된 리피바디의 결합력 변화를 효소 결합 면역 침강 분석법(ELISA)으로 측정한 결과를 나타내는 도면이다.
도 6은 본 발명에서 개발된 인간 상피세포 증식인자 수용체 2형에 특이적으로 결합하는 리피바디의 결합력을 표면 플라스몬 공명(Surface plasmon resonance, SPR)으로 측정한 결과를 나타낸 것이다.
도 7은 선별된 리피바디 클론들이 기존 항체와 표적 단백질에 대한 경쟁을 유지하고 있는 것을 결합력 변화로 확인하기 위하여, 효소 결합 면역 침강 분석법(ELISA)으로 측정한 결과를 나타낸 것이다.
도 8은 본 발명에 따른 리피바디와 인간 상피세포 증식인자 수용체 2형과의 결합이 매우 안정적인 것을 확인한 크기 배제 크로마토그래피(Size Exclusion Chromatography)결과를 나타낸 것이다.
도 9는 본 발명에 따른 리피바디가 인간 상피세포 증식인자 수용체 단백질 족을 이루는 수용체들 중에서 2형에만 특이적으로 결합하는 것을 면역 침강 분석법(ELISA)으로 확인한 결과를 나타낸 것이다.
도 10은 본 발명에서 개발된 Rb-H2 리피바디를 형광물질(Fluorescein isothiocyanate, FITC)로 표지하여 암세포 표면에 발현된 인간 상피세포 증식인자 수용체 2형과 특이적으로 결합하며 세포 표면의 발현 정도에 따라 다른 형광세기를 나타냄을 확인한 결과를 나타낸 것이다.
도 11은 본 발명에 따른 Rb-H2 리피바디와 기존에 개발된 항체(trastuzumab)를 각각 암세포에 처리하여, 암세포 증식 억제 효능을 비교 분석한 결과를 나타낸 것이다.
발명의 상세한 설명 및 바람직한 구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술 분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 본 명세서에서 사용된 명명법은 본 기술 분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명에서는 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 폴리펩티드를 계산생물학적 방법과 라이브러리 기반 파지 디스플레이 방법을 접목해 신규 폴리펩티드를 개발하고, 상기 신규 폴리펩티드의 결합 특징과 암세포 증식 억제 능력을 확인하였다.
본 발명에서는, 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 리피바디를 개발하기 위하여, 계산생물학적 방법을 이용해 적합한 후보군들을 설계하였다. 또한 후보군들 중에서 실험을 통해 도메인 4에 결합하는 것이 알려진 항체와 표적에 대해 경쟁을 하는 후보 리피바디를 선정한 후, 이 리피바디의 결합력 증대를 위해 라이브러리에 포함된 폴리펩티드를 파지미드를 이용한 바이오패닝을 통해 인간 상피세포 증식인자 수용체 2형에 대한 결합력을 증대시키는 작업을 수행하였다. 그 결과, 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 높은 결합력을 가지는 폴리펩티드를 개발하였다.
본 발명의 실시 예 에서는 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합할 수 있는 신규한 폴리펩티드를 개발하기 위하여, 인터날린 B (Internalin B) 단백질의 N-말단, 컨센서스 디자인(consensus design)으로 최적화된 LRR (Leucine-rich repeat) 모듈이 융합된, 폴리펩티드의 구조적으로 오목(concave)한 지역을 계산생물학적 방법으로 목표로 하는 위치에 결합이 가능한 후보들을 설계하고 이들 후보 중 원하는 위치에 결합하는 폴리펩티드를 실험적 방법으로 선별한 후 결합력 증대를 위해 무작위 라이브러리를 구축하였다.
또한, 상기 라이브러리는 상기 폴리뉴클레오티드를 포함하는 파지미드의 형태가 될 수 있다.
본 발명의 용어 "파지미드"란, 대장균을 숙주로 하는 바이러스인 파지로부터 유래된 원형의 폴리뉴클레오티드 분자를 의미하는데, 번식과 증식에 필요한 단백질 및 표면 단백질들의 서열이 포함되어 있다. 재조합 파지미드는 당해 기술 분야에서 잘 알려진 유전자 재조합 기술을 이용하여 제조할 수 있으며, 부위-특이적 DNA 절단 및 연결은 당해 기술 분야에서 일반적으로 알려진 효소 등을 사용하여 수행될 수 있다. 상기 파지미드는 프로모터, 오퍼레이터, 개시코돈, 종결코돈, 인핸서 같은 발현 조절 요소 외에도 분비를 위한 신호서열 또는 리더서열을 포함할 수 있고, 주로 원하는 단백질을 파지의 표면 단백질과 융합하여 파지 표면에 표지하기 위한 방법에 사용될 수 있다. 파지미드의 프로모터는 주로 유도성이며, 숙주 세포를 선택하기 위한 선택성 마커를 포함할 수도 있다.
본 발명에서 상기 파지미드는 상기 라이브러리를 구성하는 폴리펩티드를 코딩하는 폴리뉴클레오티드를 발현 및 분비하기 위한 신호서열 또는 리더 서열인 MalEss, DsbAss 또는 PelBss를 포함하고, 파지의 표면에 재조합 단백질의 발현을 확인하기 위한 히스티딘-태그와 파지 표면으로의 발현을 위한 M13 파지의 표면 단백질의 일종인 gp3 도메인을 인코딩하는 폴리뉴클레오티드를 포함하는 본 발명자의 선행특허 (대한민국 등록특허 제1,356,075호)에 기술된 서열번호 1의 폴리뉴클레오티드가 될 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명자들은 상기 파지미드를 포함하는 선행특허 (대한민국 등록특허 제1,356,075호)의 서열번호 1에 해당하는 리피바디를 이용한 계산생물학적 방법을 사용하여 인간 상피세포 증식인자 수용체 2형의 도메인 4에 결합할 수 있는 리피바디 후보군들을 설계하고 이 중 결합에너지차이 값을 기준으로 상위 10개의 신규한 폴리펩티드 후보(서열번호 2, 3, 4, 5, 6, 7, 8, 9, 10, 11)를 선별하였다.
이후, 기존에 도메인 4에 결합한다고 알려진 항체(trastuzumab)와의 표적에 대한 경쟁 여부를 확인하여 결합위치가 trastuzumab과 겹치는 후보 폴리펩티드(서열번호 6)를 선정하였다. 이 후보의 결합력을 증대시키기 위하여, 예측된 결합구조를 기반으로 선정된 7개의 아미노산에 대한 위치지정 돌연변이(site directed mutagenesis, 서열번호 12)를 수행한 결과 결합력이 증대된 신규 폴리펩티드(서열번호 13)를 선별하였다. 추가적으로 선정된 7개의 아미노산에 위치지정 돌연변이(site directed mutagenesis, 서열번호 14)를 수행하여 결합력이 더욱 증대된 신규한 폴리펩티드(서열번호 1)를 선별하였고, 그 결합력이 매우 높은 것을 확인할 수 있었다 (도 5).
따라서, 본 발명은 일 관점에서, 서열번호 1의 아미노산 서열로 표시되고, 인간 상피세포 증식인자 수용체 2형의 도메인 4의 특정 부위에 선택적으로 결합하는 리피바디(repebody)에 관한 것이다.
본 발명의 용어 "리피바디(Repebody)"란, LRR 구조를 갖는 인터날린의 N-말단과 컨센서스 디자인(consensus design)으로 최적화된 LRR (Leucine-rich repeat) 모듈로 구성된 폴리펩티드이다. 리피바디 단백질은 구조상 오목한 지역(concave)과 볼록한 지역(convex)으로 나누어질 수 있다 (도 4). 여기서 오목한 지역은 서열의 다양성이 높으며 단백질 상호작용에 중요한 부위로 알려져 있다. 이와 반대로 볼록한 지역은 보존성이 높은 서열을 바탕으로 단백질의 전체구조를 안정하게 유지하는 역할을 수행한다. 리피바디 단백질은 반복 모듈을 갖는 LRR 패밀리에 속하는 모든 단백질을 상기 방법으로 수용성 발현 및 단백질의 생물리화학적 성질을 향상시킨 융합 LRR 패밀리 단백질을 모두 포함할 수 있다.
본 발명에서 용어 "LRR(Leucine Rich Repeat) 단백질"이란, 루이신이 일정한 위치에 반복되는 모듈의 조합으로 이루어진 단백질을 의미하는 것으로, (i) 하나 이상의 LRR 반복 모듈을 갖고 있고, (ii) 상기 LRR 반복 모듈은 20 내지 30개의 아미노산으로 이루어져 있고, (iii) LRR 반복 모듈은 보존 패턴으로 "LxxLxxLxLxxN"을 갖고 있으며, 여기서 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 및 트립토판과 같은 소수성 아미노산을, N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌을, x는 임의의 아미노산을 의미하며, (iv) LRR 패밀리 단백질은 말발굽과 같은 삼차원 구조를 갖고 있는 단백질을 의미한다.
본 발명의 LRR 패밀리 단백질은 이미 그 서열이 알려져 있거나, 생체 내에서 새로 유도된 mRNA나 cDNA를 이용하여 찾아낸 것과 더불어 컨센서스 디자인(consensus design) 등의 설계를 통하여 자연계에 알려지지 않은 서열을 가지면서 반복모듈의 골격 구조가 있는 변이체를 모두 포함할 수 있다.
본 발명에서 용어 "인터날린 B 단백질"이란, 리스테리아(Listeria) 균주에서 발현되는 LRR 패밀리 단백질의 일종으로, 다른 소수성 코어가 전 분자에 걸쳐서 일정하게 분포되어 있는 다른 LRR 패밀리 단백질들과는 상이한 N-말단 구조를 가지고 있어 미생물에서도 안정적으로 발현되는 것으로 알려져 있다. 이러한 인터날린 단백질의 N-말단은 반복 모듈의 접힘(folding)에 가장 중요한 N-말단 부위가 미생물 유래일 뿐만 아니라 그 형태가 알파 나선을 포함하는 안정적인 모양을 가졌기에 미생물에서 LRR 패밀리 단백질들의 안정적인 발현을 위하여 효과적으로 사용될 수 있다.
본 발명에서 용어, "인터날린 단백질의 N-말단"은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 의미하며 알파 나선형 캡핑 모티프(capping motif) 및 인터날린 단백질의 반복 모듈을 의미한다. 인터날린 단백질의 N-말단은 단백질의 수용성 발현 및 접힘에 있어서 필요한 인터날린 단백질의 N-말단을 제한없이 포함하며, 그 예로 알파 나선형 캡핑 모티프인 "ETITVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNE" 및 반복 모듈을 포함할 수 있다. 또한 반복 모듈 패턴은 "LxxLxxLxLxxN"을 포함할 수 있다. 반복 모듈 패턴 중 L은 알라닌, 글리신, 페닐알라닌, 티로신, 루이신, 이소루이신, 발린 또는 트립토판; N은 아스파라진, 글루타민, 세린, 시스테인 또는 트레오닌, x는 임의의 친수성 아미노산을 의미한다. 인터날린 단백질의 N-말단은 융합될 수 있는 LRR 패밀리 단백질의 종류에 따라 높은 구조 유사도를 갖는 N-말단이 선택될 수 있으며 결합 에너지 등의 계산을 통해 가장 안정적인 아미노산을 선택하여 해당 모듈의 아미노산의 변이가 가능하다.
본 발명의 용어, "인간 상피세포 증식인자 수용체 2형"은 암세포 표면에 과발현되는 단백질로, 리간드(ligand)가 없는 대신 자신(homo) 혹은 인간 상피세포 증식인자 수용체 단백질 족에 속한 다른 수용체들과 이종 이합체(hetero-dimer)를 형성하여 암세포의 분화와 증식을 촉진시킨다. 따라서, 이들 인간 상피세포 증식인자 수용체 2형이 과발현되는 암세포의 성장을 억제하기 위해서는 이합체 형성에 관여하는 도메인을 표적으로 하여 이합체 형성을 방해하여야 한다. 인간 상피세포 증식인자 수용체 2형의 세포막 밖 부분은 총 4개의 단백질 도메인으로 이루어져 있으며, 이중 도메인 2와 4가 이합체 형성에 관여하는 것으로 알려져 있다.
본 발명은 다른 관점에서, 상기 리피바디를 코딩하는 폴리뉴클레오티드; 상기 폴리뉴클레오티드를 포함하는 재조합 벡터 및 재조합 미생물에 관한 것이다.
본 발명에 있어서, 상기 폴리뉴클레오티드는 특별히 이에 제한되지 않으나, 상기 서열번호 1의 아미노산 서열을 코딩하는 폴리뉴클레오티드가 될 수 있고, 상기 폴리뉴클레오티드와 70% 이상, 보다 바람직하게는 80% 이상, 보다 바람직하게는 90% 이상의 상동성을 가지는 염기 서열을 가지는 폴리뉴클레오티드일 수 있으나, 특별히 이에 제한되지는 않는다.
본 발명의 용어 "벡터"는 적합한 숙주 내에서 목적 단백질을 발현시킬 수 있도록 적합한 조절 서열에 작동 가능하게 연결된 상기 목적 단백질을 암호화하는 폴리뉴클레오티드의 염기서열을 함유하는 DNA 제조물을 의미한다. 상기 조절 서열은 전사를 개시할 수 있는 프로모터, 그러한 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열, 및 전사 및 해독의 종결을 조절하는 서열을 포함한다. 벡터는 적당한 숙주 내로 형질 전환된 후, 숙주 게놈과 무관하게 복제되거나 기능할 수 있으며, 게놈 그 자체에 통합될 수 있다.
본 발명에서 사용되는 벡터는 숙주 중에서 복제 가능한 것이면 특별히 한정되지 않으며 당 업계에 알려진 임의의 벡터를 이용할 수 있다. 통상 사용되는 벡터의 예로는 천연 상태이거나 재조합된 상태의 플라스미드, 파지미드, 코스미드, 바이러스 및 박테리오파지를 들 수 있다. 예를 들어, 파지 벡터 또는 코스미드 벡터로서 pWE15, M13, λMBL3, λMBL4, λIXII, λASHII, λAPII, λt10, λt11, Charon4A, 및 Charon21A 등을 사용할 수 있으며, 플라스미드 벡터로서 pBR계, pUC계, pBluescriptII계, pGEM계, pTZ계, pCL계 및 pET계 등을 사용할 수 있다. 본 발명에서 사용 가능한 벡터는 특별히 제한되는 것이 아니며 공지된 발현 벡터를 사용할 수 있다. 바람직하게는 pACYC177, pACYC184, pCL, pECCG117, pUC19, pBR322, pMW118, pCC1BAC, pET-21a, pET-32a, pcDNA3.1 벡터 등을 사용할 수 있다. 가장 바람직하게는 pET-21a, pET-32a, pcDNA3.1 벡터를 사용할 수 있다.
본 발명의 용어 "재조합 미생물"이란, 하나 이상의 목적 단백질을 암호화하는 유전자를 갖는 벡터가 숙주세포에 도입되어 목적 단백질을 발현시키도록 형질이 감염된 세포를 의미하며, 진핵세포, 원핵세포 등의 모든 세포가 될 수 있는데, 특별히 이에 제한되지 않으나, 대장균, 스트렙토미세스, 살모넬라 티피뮤리움 등의 박테리아 세포; 효모 세포; 피치아 파스토리스 등의 균류 세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO, COS, NSO, 293, 보우 멜라노마 세포 등의 동물 세포; 또는 식물 세포가 될 수 있다. 본 발명에서 사용 가능한 숙주세포는 특별히 제한되는 것이 아니나, 바람직하게는 대장균을 숙주 세포로 사용할 수 있다. 가장 바람직하게는 대장균 BL21(DE3), OrigamiB(DE3)를 숙주 세포로 사용할 수 있다.
본 발명에서 용어 "형질전환"이란, 표적 단백질을 암호화하는 폴리뉴클레오티드를 포함하는 벡터를 숙주 세포 내에 도입하여 숙주 세포 내에서 상기 폴리뉴클레오티드가 암호화하는 단백질이 발현할 수 있도록 하는 것을 의미한다. 형질 전환된 폴리뉴클레오티드는 숙주 세포 내에 발현될 수 있기만 한다면, 숙주세포의 염색체 내에 삽입되어 위치하거나 염색체 외에 위치하든지 상관없이 이들 모두를 포함한다. 또한, 상기 폴리뉴클레오티드는 표적 단백질을 암호화하는 DNA 및 RNA를 포함한다. 상기 폴리뉴클레오티드는 숙주 세포 내로 도입되어 발현될 수 있는 것이면, 어떠한 형태로 도입되는 것이든 상관없다. 예를 들면, 상기 폴리뉴클레오티드는, 자체적으로 발현되는데 필요한 모든 요소를 포함하는 유전자 구조체인 발현 카세트 (Expression cassette)의 형태로 숙주세포에 도입될 수 있다. 상기 발현 카세트는 통상 상기 폴리뉴클레오티드에 작동 가능하게 연결되어 있는 프로모터(promoter), 전사 종결 신호, 리보좀 결합부위 및 번역 종결신호를 포함한다. 상기 발현 카세트는 자체 복제가 가능한 발현 벡터 형태일 수 있다. 또한, 상기 폴리뉴클레오티드는 그 자체의 형태로 숙주세포에 도입되어, 숙주세포에서 발현에 필요한 서열과 작동 가능하게 연결되어 있는 것일 수도 있다.
본 발명은 또 다른 관점에서, (i) 상기 재조합 미생물을 배양하여 리피바디를 생성시키는 단계; 및 (ii) 상기 생성된 리피바디를 회수하는 단계를 포함하는 리피바디의 생산 방법에 관한 것이다.
상기 방법에 있어서, 상기 재조합 미생물을 배양하는 단계는 특별히 이에 제한되지 않으나, 공지된 회분식 배양방법, 연속식 배양방법, 유가식 배양방법 등에 의해 수행됨이 바람직하고, 배양조건은 특별히 이에 제한되지 않으나, 염기성 화합물(예: 수산화나트륨, 수산화칼륨 또는 암모니아) 또는 산성 화합물(예: 인산 또는 황산)을 사용하여 적정 pH(pH 5 내지 9, 바람직하게는 pH 6 내지 8, 가장 바람직하게는 pH 6.8)를 조절할 수 있고, 산소 또는 산소-함유 가스 혼합물을 배양물에 도입시켜 호기성 조건을 유지할 수 있으며, 배양온도는 20 내지 45℃, 바람직하게는 25 내지 40℃를 유지할 수 있고, 약 10 내지 160 시간동안 배양하는 것이 바람직하다. 상기 배양에 의하여 생산된 상기 폴리펩티드는 배지로 분비되거나 세포 내에 잔류할 수 있다.
아울러, 사용되는 배양용 배지는 탄소 공급원으로는 당 및 탄수화물(예: 글루코오스, 슈크로오스, 락토오스, 프럭토오스, 말토오스, 몰라세, 전분 및 셀룰로오스), 유지 및 지방(예: 대두유, 해바라기씨유, 땅콩유 및 코코넛유), 지방산(예: 팔미트산, 스테아르산 및 리놀레산), 알콜(예: 글리세롤 및 에탄올) 및 유기산(예: 아세트산) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 질소 공급원으로는 질소-함유 유기 화합물(예: 펩톤, 효모 추출액, 육즙, 맥아 추출액, 옥수수 침지액, 대두 박분 및 우레아), 또는 무기 화합물(예: 황산암모늄, 염화암모늄, 인산암모늄, 탄산암모늄 및 질산암모늄) 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있으며; 인 공급원으로서 인산 이수소칼륨, 인산수소이칼륨, 이에 상응하는 나트륨 함유 염 등을 개별적으로 사용하거나 또는 혼합하여 사용할 수 있고; 기타 금속염(예: 황산마그네슘 또는 황산철), 아미노산 및 비타민과 같은 필수성장-촉진 물질을 포함할 수 있다.
본 발명의 상기 배양 단계에서 생산된 폴리펩티드를 회수하는 방법은 배양방법, 예를 들어 회분식, 연속식 또는 유가식 배양 방법 등에 따라 당해 분야에 공지된 적합한 방법을 이용하여 배양액으로부터 목적하는 리피바디를 회수할 수 있다.
한편, 본 발명의 리피바디를 이용할 경우, 기존의 항체를 대체하여 인간 상피세포 증식인자 수용체 2형이 과발현되는 암세포의 치료에 사용할 수 있다.
따라서, 본 발명은 또 다른 관점에서, 상기 리피바디를 유효성분으로 함유하는 암 치료용 조성물에 관한 것이다.
또한, 본 발명의 리피바디를 이용할 경우, 인간 상피세포 증식인자 수용체 2형이 과발현되는 암세포를 진단할 수 있다.
본 발명의 일 양태에서는 본 발명에 따른 Rb-H2 리피바디와 양성대조군인 trastuzumab를 암세포(Sk-Br3, Sk-Ov3 및 MCF-7)에 처리하고, 암세포의 성장 억제능을 확인하였고, 그 결과, Rb-H2 리피바디가 trastuzumab과 유사한 암세포 성장 억제 능력을 가지고 있음을 확인하였으며(도 11), 이를 통해 Rb-H2 리피바디가 trastuzumab과 유사하게 이합체 형성을 방해하여 암세포 증식을 억제하는 것을 확인하였다.
본 발명은 또 다른 관점에서, 상기 리피바디를 투여하는 단계를 포함하는 암의 치료방법에 관한 것이다.
본 발명은 또 다른 관점에서, 암의 치료 또는 예방을 위한 상기 리피바디의 용도에 관한 것이다.
본 발명은 또 다른 관점에서, 암의 치료용 약제 제조를 위한 상기 리피바디의 사용에 관한 것이다.
본 발명은 또 다른 관점에서, 상기 리피바디를 유효성분으로 함유하는 암 진단용 조성물에 관한 것이다.
본 발명에서 상기 인간 상피세포 증식인자 수용체 2형이 과발현되는 암은 유방암, 대장암, 난소암, 위암 등이 있이 있으나, 이에 한정되는 것은 아니다.
상기 방법에 있어서, 상기 리피바디를 형광물질 혹은 방사성 동위원소로 표지 한 후 체내에 주입하여 형광 혹은 방사성 동위원소를 측정함으로써 암세포를 진단할 수 있다.
본 발명에서 상기 인간 상피세포 증식인자 수용체 2형이 과발현되는 암은 유방암, 대장암, 난소암, 위암 등이 있이 있으나, 이에 한정되는 것은 아니다.
본 발명의 일 양태에서는 형광물질인 FITC로 표지한 Rb-H2 리피바디를 암세포(Sk-Br3, Sk-Ov3 및 MCF-7)에 처리한 후, 공초점주사현미경(confocal microscopy)을 이용해 형광을 띠는 세포의 사진을 확인한 결과, HER2가 강하게 발현되는 Sk-Br3 세포에는 매우 강한 형광이 관측되었고, 중간 정도의 HER2가 발현되는 Sk-Ov3 세포에서는 그 보다는 낮은 중간정도의 형광이 확인되었으며, HER2 발현이 낮은 MCF-7 세포에서는 매우 낮은 형광이 관찰되었다. 이를 통해 본 발명에 따른 Rb-H2 리피바디가 암세포 표면에 발현된 인간 상피세포 증식인자 수용체 2형에 특이적으로 결합하는 것을 확인하였으며(도 10), 이를 통해 본 발명에 따른 리피바디가 암의 진단에 사용될 수 있음을 확인하였다.
[실시예]
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.
실시예 1: 계산생물학적 방법을 이용한 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 리피바디 후보 선별
인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 리피바디를 개발하기 위하여, 서열번호 2의 리피바디 구조를 이용하여 계산생물학적 방법(ClusPro webserver )으로 얻어진 후보들 중 결합에너지차이 값을 기반으로 상위 10개의 후보를 선별하였다(도 1). 10개의 후보들을 각각 발현한 후, 도메인 4에 결합한다고 알려진 항체인 trastuzumab (Roach, 서울, 한국)과 표적에 대한 경쟁 여부를 HRP 가 결합된 c-Myc 항체(Santa Cruz Biotechnology, TX, 미국)를 이용하여 확인하였고 최종 후보(Rb-H0)를 선별하였다(도 2).
실시예 2: 리피바디의 결합력 증가를 위한 모듈 기반 라이브러리 제작
결합력이 증대된 리피바디를 확보하기 위해 선행특허 (대한민국 등록특허 제1,356,075호)에서 구축한 모듈 기반 친화력 증대 기술을 사용하였다. 우선, 실시예 1에서 선별한 인간 상피세포 증식인자 수용체 2형의 도메인 4에 결합하는 Rb-H0 리피바디의 결합구조를 계산생물학적 방법으로 예측하였다. 예측된 구조를 기반으로, 표적과 가장 인접한 모듈들(LRRV3,4)에 위치한 7개의 아미노산을 선택하여 돌연변이를 주었다. 상기 선택한 아미노산을 NNK 동의코돈(degenerate codon)으로 치환하도록, 라이브러리 구축을 위한 돌연변이 유발 프라이머 (mutagenic primer)를 합성하였다.
이어, 상기 프라이머들을 이용하여 두 모듈에 대한 겹침 중합효소 연쇄 반응(overlap PCR)을 수행하며 라이브러리 DNA를 수득하고, 본 발명자의 선행특허 (대한민국 등록특허 제1,356,075호)에 기술된 서열번호 3의 파지미드 pBEL118N에 삽입하여 최종적인 라이브러리 파지미드를 확보하였다.
상기 확보된 라이브러리를 전기천공법(electroporation)으로 대장균 TG-1에 도입하여 형질 전환체를 수득함으로써, 1.2x109 수준의 다양성을 갖는 라이브러리를 구축하였다. 총 다섯 번의 패닝 과정을 거쳐 결합력이 증대된 리피바디(Rb-H1, 서열번호 13)를 확보하였다.
추가로 결합력을 증가시키기 위해 Rb-H1의 결합구조를 계산생물학적 방법으로 예측하였고, 이를 기반으로 모듈들(LRR1, LRRV1, LRRV2)에 위치한 7개의 아미노산을 선택하여 위와 같은 방식으로 돌연변이를 주었다. 총 다섯 번의 패닝 과정을 거쳐 결합력이 증대된 리피바디(Rb-H2, 서열번호 14)를 확보하였다.
실시예 3: 리피바디 라이브러리의 패닝 과정을 통한 인간 상피세포 증식인자 수용체 2형에 대한 결합력 증대
실시예 2에서 구축한 라이브러리를 사용하여 인간 상피세포 증식인자 수용체 2형에 결합할 수 있는 폴리펩티드를 선별하여 정제하였다. 인간 상피세포 증식인자 수용체 2형에 대한 결합력을 증가시키기 위하여, biotinylation된 인간 상피세포 증식인자 수용체 2형의 세포막 외부 도메인을 streptavidin으로 표지 된 Dynabead 10 μL에 4 μg/mL의 농도로 가하고, 4 ℃에서 2시간 동안 코팅하였다. 상기 코팅된 Dynabead를 PBS로 3회 세척하고, 1% BSA와 0.05 % Tween 20을 포함하는 PBS 용액(TPBSA)으로 4 ℃에서 2시간동안 블로킹(Blocking)하였다. 그와 동시에, 상기 정제된 파지를 1012 cfu/ml의 농도로 그리고 정제된 Rb-H0 혹은 Rb-H1 리피바디를 1 μM의 농도로 1% BSA와 0.05 % Tween 20을 포함하는 PBS 용액(TPBSA)에 희석한 후 Dynabead 40 μL에 가하여 4 ℃에서 2시간 도안 negative selection을 진행시켰다. 이후 자석을 이용해 파지와 Dynabead를 분리시킨 후 파지용액을 상기 코팅된 Dynabead와 섞은 후 상온에서 2시간 동안 반응시켰다. 반응이 종료된 후, 0.05% Tween 20을 포함하는 PBS 용액(TPBS)으로 1분간 총 5번 세척하고 PBS 용액으로 1분간 한번 세척을 하였다. 마지막으로, 1 mL 0.2 M Glycine-HCl(pH 2.2)를 가하고, 상온에서 10분간 반응시킴으로써, 인간 상피세포 증식인자 수용체 2형과의 결합력 증가된 리피바디 후보를 표면에 발현시킨 파지를 용출시켰다. 상기 용출액에 100 ㎕의 1.0 M Tris-HCl (pH 9.0)를 가하여 중화시키고, 숙주세포인 대장균 TG-1의 배양액 15 mL(OD600 = 0.5)에 가한 다음, 2xYT 플레이트에 도말하는 바이오패닝(Bio-panning) 과정을 동일하게 5회 반복하여 수행하였다.
그 결과, 각 패닝 과정을 통해 인간 상피세포 증식인자 수용체 2형과의 결합력이 증가한 파지가 농축된 것을 확인하였다. 상기 결과는 인간 상피세포 증식인자 수용체 2형과 결합하는 라이브러리 파지가 특이적으로 증가하는 것을 통해 확인하였다.
실시예 4: 선별된 파지가 인간 상피세포 증식인자 수용체 2형에 대한 결합 여부 확인 및 서열 분석
실시예 3의 방법을 통하여 선별한 파지를 인간 상피세포 증식인자 수용체 2형과 Bovine serum albumin(BSA)가 코팅된 96-웰 플레이트를 이용하여 Enzyme-linked immunosorbent assay(ELISA)를 수행하였다. 각 파지 100 μL를 1% BSA와 0.05% Tween 20을 포함하는 PBS 용액(TPBSA) 100 μL 섞은 후 상온에서 1시간 동안 반응시켰다. 또한 각 웰을 1% BSA와 0.05% Tween 20을 포함하는 PBS 용액 (TPBSA)로 블로킹(blocking)을 진행하였다. 그 후 파지 100 μL를 각 웰에 넣은 후 상온에서 1시간 동안 반응시킨 후 TPBS로 5번 세척하였다. M13파지에 대한 항체에 HRP가 연결된 것을 이용하여 흡광도(OD450)를 측정하였다. BSA 대비 인간 상피세포 증식인자 수용체 2형을 코팅한 웰의 흡광도(OD450)가 가장 높은 리피바디 후보들을 선별하고, 이들 각각의 아미노산 서열을 확인한 결과, 시스테인이 삽입된 파지를 제외한 후 한 종류의 리피바디 파지(Rb-H1)를 선별하였다(서열번호 13).
실시예 2의 방법으로 Rb-H1을 기반으로 라이브러리를 제작한 후 실시예 3의 방법과 상기 방법을 추가적으로 수행하여 인간 상피세포 증식인자 수용체 2형에 대한 결합력이 더 증대된 리피바디 파지(Rb-H2)를 선별하였다(서열번호 14).
실시예 5: 선별된 리피바디들의 인간 상피세포 증식인자 수용체 2형과의 결합력 확인
선별된 Rb-H0, Rb-H1, Rb-H2 리피바디를 이용하여 인간 상피세포 증식인자 수용체 2형에 결합력을 확인하는 실험을 수행하였다. 인간 상피세포 증식인자 수용체 2형의 세포막 외부 도메인을 96-웰 플레이트의 각 웰에 10 μg/mL으로 100μL씩 처리해 준다. 4℃에서 12시간 동안 코팅해준 후에 단백질이 붙지 않은 나머지 구역을 1% BSA와 0.05% Tween 20을 포함하는 PBS 용액 (TPBSA)를 처리하여 블로킹(blocking)과정을 상온에서 1시간 동안 수행하였다. 그 후 Rb-H0, Rb-H1, Rb-H2 리피바디를 1 μM를 시작으로 1/3씩 희석한 농도를 100 μL씩 각 웰에 처리해 상온에서 한 시간 동안 반응시킨 다음에 TPBS로 5번 세척하였다. 리피바디를 잡을 수 있는 항체에 바이오틴(biotin)이 연결되어있는 것을 각 웰에 1 μg/mL으로 100 μL씩 처리해 상온에서 한 시간 동안 반응시킨 다음에 TPBS로 5번 세척하였다. 그 후 horseradish peroxidase (HRP)가 결합된 streptavidin 를 처리한 후 다시 한 시간 동안 상온에서 반응시킨다. TPBS로 5번 세척한 후에 PBS로 3번 다시 세척한 후 HRP의 기질인 3,3',5,5'-Tetramethylbenzidine(TMB)를 첨가하여 발색 반응을 진행한 후 1N H2SO4를 처리하여 발색 반응을 멈췄다. 그리고 발광 측정 장치를 통해 발광 정도(OD450)를 측정하였다. 그 결과, Rb-H2의 결합력이 가장 높은 것을 확인하였다(도 5). Trastuzumab의 결합력은 인간 Fc에 대한 항체에 HRP가 연결된 것을 이용하여 확인하였다. 표면 플라스몬 공명(SPR)(Biacore 3000 system, GE Healthcare)를 통해 해리상수를 측정한 결과 56 nM 수준의 가장 높은 결합력을 가지는 Rb-H2 리피바디를 확보하였다 (서열변호 14, 도 6).
실시예 6: 선별된 리피바디들의 기존 항체와의 표적에 대한 경쟁 능력 확인
선별된 Rb-H0, Rb-H1, Rb-H2 리피바디가 trastuzumab과 표적에 대한 경쟁을 유지하고 있는지를 확인하는 실험을 수행하였다. 인간 상피세포 증식인자 수용체 2형의 세포막 외부 도메인(Sino Biological, 중국)을 96-웰 플레이트의 각 웰에 10 μg/mL으로 100μL씩 처리해 주었다. 4℃에서 12시간 동안 코팅해준 후에 단백질이 붙지 않은 나머지 구역을 1% BSA와 0.05% Tween 20을 포함하는 PBS 용액 (TPBSA)를 처리하여 블로킹 (blocking)과정을 상온에서 1시간 동안 수행하였다. 그 후 Rb-H0, Rb-H1, Rb-H2 리피바디를 단독으로 10 μg/mL 혹은 trastuzumab 100 μg/mL과 같이 섞어서 100 μL씩 각 웰에 처리해 상온에서 한 시간 동안 반응시킨 다음에 TPBS로 5번 세척하였다. 리피바디를 잡을 수 있는 항체에 바이오틴(biotin)이 연결되어있는 것을 각 웰에 1 μg/mL으로 100 μL씩 처리해 상온에서 한 시간 동안 반응시킨 다음에 TPBS로 5번 세척하였다. 그 후 streptavidin-horseradish peroxidase(HRP)를 처리한 후 다시 한 시간 동안 상온에서 반응시킨다. TPBS로 5번 세척한 후에 PBS로 3번 다시 세척한 후 HRP의 기질인 3,3',5,5'-Tetramethylbenzidine(TMB)를 첨가하여 발색 반응을 진행한 후 1N H2SO4를 처리하여 발색 반응을 멈췄다. 그리고 발광 측정 장치를 통해 흡광도(OD450)를 측정하였다. 그 결과, Rb-H0, Rb-H1, Rb-H2 모두 trastuzumab으로 인한 흡광도 감소가 나타난 것을 통해 도메인 4를 모두 타겟하고 있는 것을 확인하였다(도 7).
실시예 7: 선별된 리피바디의 인간 상피세포 증식인자 수용체 2형에 대한 안정된 결합 능력 확인
선별된 Rb-H2 리피바디와 인간 상피세포 증식인자 수용체 2형의 결합체가 안정적으로 결합력을 유지하고 있는지 확인하는 실험을 수행하였다. 리피바디와 인간 상피세포 증식인자 수용체 2형의 세포막 외부 도메인을 1:5의 비율로 섞어 4℃에서 2시간 동안 반응시킨 후 크기 배제 크로마토그래피(size exclusion chromatography)(GE Healthcare, Sweden)를 수행한 결과 인간 상피세포 증식인자 수용체 2형의 세포막 외부 도메인이 리피바디 함께 같은 peak에서 나오는 것을 확인하였다 (도 8).
실시예 8: 선별된 리피바디의 인간 상피세포 증식인자 수용체 단백질 족에 대한 구별 능력 확인
인간 상피세포 증식인자 수용체 단백질 족에는 총 4개의 수용체가 있고 이들은 비슷한 구조를 공유하고 있기 때문에 선별된 리피바디가 2형에 특이적으로 결합할 수 있는지 확인하였다. 인간 상피세포 증식인자 수용체 1, 2, 3, 4형(Sino Biological, 북경, 중국)의 세포막 외부 도메인을 96-웰 플레이트의 각 웰에 10 μg/mL으로 100μL씩 처리해 준다. 4℃에서 12시간 동안 코팅해준 후에 단백질이 붙지 않은 나머지 구역을 1% BSA와 0.05% Tween 20을 포함하는 PBS 용액 (TPBSA)를 처리하여 블로킹 (blocking)과정을 상온에서 1시간 동안 수행하였다. 그 후 Rb-H2 리피바디를 10 μg/mL로 100 μL씩 각 웰에 처리해 상온에서 한 시간 동안 반응시킨 다음에 TPBS로 5번 세척하였다. 리피바디를 잡을 수 있는 항체에 바이오틴(biotin)이 연결되어있는 것을 각 웰에 1 μg/mL으로 100 μL씩 처리해 상온에서 한 시간 동안 반응시킨 다음에 TPBS로 5번 세척하였다. 그 후 horseradish peroxidase(HRP)가 결합된 streptavidin을 처리한 후 다시 한 시간 동안 상온에서 반응시킨다. TPBS로 5번 세척한 후에 PBS로 3번 다시 세척한 HRP 기질인 3,3',5,5'-Tetramethylbenzidine(TMB)를 첨가하여 발색 반응을 진행한 후 1N H2SO4를 처리하여 발색 반응을 멈췄다. 그리고 발광 측정 장치를 통해 발광 정도(OD450)를 측정하였다. 그 결과, Rb-H2는 2형에만 결합하는 것을 확인하였다(도 9).
실시예 9: 선별된 리피바디의 암세포 표면에 발현된 인간 상피세포 증식인자 수용체 2형에 대한 결합 능력 확인
선별된 Rb-H2 리피바디가 암세포 표면에 발현된 인간 상피세포 증식인자 수용체 2형에 대한 결합 능력을 확인하고자 형광물질인 FITC로 표지 하였다. 그 후 각 암세포를 8-웰 슬라이드글라스에 키운 후 FITC가 표지 된 Rb-H2를 1 μg/mL로 처리하고 37 ℃, 5% CO2 챔버에서 30분간 반응시킨 후 DPBS로 5번 세척을 진행하였다. 암세포는 인간 상피세포 증식인자 수용체 2형이 가장 많이 발현된 Sk-Br3(ATCC, VA, 미국; 인간 유방암 세포), 중간 수준인 Sk-Ov3(ATCC, VA, 미국; 인간 난소암 세포), 가장 낮은 수준인 MCF-7(ATCC, VA, 미국; 인간 유방암 세포)의 3가지 종류를 사용하였다. 공초점주사현미경(confocal microscopy)을 이용해 형광을 띠는 세포의 사진을 찍었다.
그 결과, Sk-Br3 세포에는 매우 강한 형광이 관측되었고 Sk-Ov3 세포에서는 그 보다는 낮은 중간정도의 형광이, MCF-7 세포에서는 매우 낮은 형광이 관찰되었다. 이를 통해 선별된 Rb-H2 리피바디가 암세포 표면에 발현된 인간 상피세포 증식인자 수용체 2형에 특이적으로 결합하는 것을 확인하였다 (도 10).
실시예 10: 선별된 리피바디의 암세포 성장 억제 능력 확인
실시예 9에 사용된 암세포(Sk-Br3, Sk-Ov3 및 MCF-7)에 대한 선별된 Rb-H2 리피바디의 증식 억제 능력을 확인하였다. 비교군으로 trastuzumab을 사용하였다. 96-웰 플레이트(well plate)에 각 암세포를 키운 후 Rb-H2 리피바디 혹은 trastuzumab을 1 μM 농도를 시작으로 1/10씩 희석하여 각 웰에 제공하였다. 그 결과, Rb-H2 리피바디가 trastuzumab과 유사한 암세포 성장 억제 능력을 가지고 있음을 확인하였다 (도 11). 또한 이를 통해 Rb-H2 리피바디가 trastuzumab과 같이 이합체 형성 방해를 통해 암세포 증식을 억제하는 것을 확인하였다.
본 발명에 따른 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드는 기존의 암 치료용 항체를 대체하여 암 치료 용도뿐만이 아니라 형광 혹은 방사성 물질을 표지하여 특정 암의 진단용으로도 사용이 가능하다.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시태양일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
전자파일 첨부하였음.

Claims (7)

  1. 서열번호 1의 아미노산 서열로 표시되고, 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 리피바디(repebody).
  2. 제1항의 리피바디를 코딩하는 폴리뉴클레오티드.
  3. 제2항의 폴리뉴클레오티드를 포함하는 재조합 벡터.
  4. 제2항의 폴리뉴클레오티드 또는 제3항의 재조합 벡터가 도입되어 있는 재조합 미생물.
  5. 다음 단계를 포함하는 서열번호 1의 아미노산 서열로 표시되고, 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 리피바디의 제조방법:
    (i) 제4항의 재조합 미생물을 배양하여 리피바디를 생성시키는 단계; 및
    (ii) 상기 생성된 리피바디를 회수하는 단계.
  6. 제1항의 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 리피바디를 유효성분으로 포함하는 암 치료용 조성물.
  7. 제1항의 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 리피바디를 유효성분으로 포함하는 암 진단용 조성물.
PCT/KR2021/008641 2020-07-08 2021-07-07 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도 Ceased WO2022010254A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2020-0083909 2020-07-08
KR1020200083909A KR102486958B1 (ko) 2020-07-08 2020-07-08 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도

Publications (1)

Publication Number Publication Date
WO2022010254A1 true WO2022010254A1 (ko) 2022-01-13

Family

ID=79553379

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/008641 Ceased WO2022010254A1 (ko) 2020-07-08 2021-07-07 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도

Country Status (2)

Country Link
KR (1) KR102486958B1 (ko)
WO (1) WO2022010254A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8975382B2 (en) * 2007-11-27 2015-03-10 Ablynx N.V. Amino acid sequences directed against HER2 and polypeptides comprising the same for the treatment of cancers and/or tumors
KR20150055397A (ko) * 2013-11-13 2015-05-21 한국과학기술원 반복모듈을 포함하는 리피바디 단백질의 개량방법
KR20170059729A (ko) * 2015-11-23 2017-05-31 한국과학기술원 리피바디-단백질 독소 복합체, 그 제조방법 및 용도

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101587622B1 (ko) * 2014-05-23 2016-01-22 한국과학기술원 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8975382B2 (en) * 2007-11-27 2015-03-10 Ablynx N.V. Amino acid sequences directed against HER2 and polypeptides comprising the same for the treatment of cancers and/or tumors
KR20150055397A (ko) * 2013-11-13 2015-05-21 한국과학기술원 반복모듈을 포함하는 리피바디 단백질의 개량방법
KR20170059729A (ko) * 2015-11-23 2017-05-31 한국과학기술원 리피바디-단백질 독소 복합체, 그 제조방법 및 용도

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
ETIENNE-MANNEVILLE SANDRINE, HALL ALAN: "Cdc42 regulates GSK-3β and adenomatous polyposis coli to control cell polarity", NATURE, vol. 421, no. 6924, 1 February 2003 (2003-02-01), London, pages 753 - 756, XP055886547, ISSN: 0028-0836, DOI: 10.1038/nature01423 *
HAO YUE, YU XINCHAO, BAI YONGHONG, MCBRIDE HELEN J., HUANG XIN: "Cryo-EM Structure of HER2-trastuzumab-pertuzumab complex", PLOS ONE, vol. 14, no. 5, 1 May 2019 (2019-05-01), pages 1 - 10, XP055886548, DOI: 10.1371/journal.pone.0216095 *
KIM TAE YOON, CHA JEONG SEOK, KIM HOYOUNG, CHOI YOONJOO, CHO HYUN-SOO, KIM HAK-SUNG: "Computationally-guided design and affinity improvement of a protein binder targeting a specific site on HER2", COMPUTATIONAL AND STRUCTURAL BIOTECHNOLOGY JOURNAL, vol. 19, 27 February 2021 (2021-02-27), Sweden , pages 1325 - 1334, XP055886549, ISSN: 2001-0370, DOI: 10.1016/j.csbj.2021.02.013 *

Also Published As

Publication number Publication date
KR20220006219A (ko) 2022-01-17
KR102486958B1 (ko) 2023-01-11

Similar Documents

Publication Publication Date Title
AU2017342062B2 (en) Archaeal pyrrolysyl tRNA synthetases for orthogonal use
WO2015178689A1 (ko) 상피세포 성장인자 수용체의 세포외 도메인과 결합하는 신규 폴리펩타이드
KR101282811B1 (ko) 가스트린 방출 펩티드 전구체에 대한 항체 및 그 용도
EP0418590B1 (en) Antibodies, production thereof and use
WO2023231888A1 (zh) 抗人生长激素单域抗体及其应用
WO2017188668A2 (ko) Taq dna 중합효소에 특이적으로 결합하는 폴리펩타이드 및 그 용도
WO2016018133A9 (ko) 보체 단백질 C5a와 결합할 수 있는 신규한 폴리펩타이드 및 그 용도
KR102486958B1 (ko) 인간 상피세포 증식인자 수용체 2형의 도메인 4에 특이적으로 결합하는 신규 폴리펩티드 및 이의 용도
WO2022098220A1 (ko) 인플라마솜 어댑터 단백질(asc)의 중합체화 도메인에 결합하는 신규한 폴리펩타이드 및 이의 용도
WO2012033382A2 (ko) 신규한 rna 결합 단백질 및 이를 이용한 무표지 마이크로 rna 검출방법
WO2017135545A1 (ko) 쥐 또는 토끼의 면역글로불린 g에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
EP4737478A1 (en) Modified g protein coupled receptor and use thereof
US5437995A (en) Monoclonal antibody against an acidic FGF protein and hybridoma for its production
WO2019164358A1 (ko) 브루톤티로신키나아제의 SH2 도메인(Src homology 2 domain)에 선택적으로 결합하는 신규한 폴리펩티드 및 이의 용도
CN115850496B (zh) Fuca1特异性抗体及其应用
CN111647049B (zh) 多肽和多肽偶联物及其制备方法和应用
CN111763255A (zh) 一种经基因修饰的vegfa蛋白及其单克隆抗体与应用
WO2015184626A1 (en) Preparation and selection of cells for producing bispecific antibodies
CN114940979B (zh) 一种利用遗传密码扩展提高阳离子-π相互作用的方法及应用
US20250282824A1 (en) Inhibitors of the Wnt Signaling Pathway and Uses Thereof
WO2025005704A1 (ko) Ct83 항원에 대한 인간 단클론 항체 및 이의 용도
Turgimbayeva et al. Preparation of rabbit polyclonal antibodies against GFP and mCherry proteins
CN111499740A (zh) 一种抗苦荞金属硫蛋白FtMT单克隆抗体及其制备方法和应用
Ruza Structural analysis of Wnt signalling pathways
KR101624703B1 (ko) 적색 형광단백질에 결합하는 신규한 폴리펩타이드

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21837628

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21837628

Country of ref document: EP

Kind code of ref document: A1