WO2021252666A1 - Brm targeting compounds and associated methods of use - Google Patents
Brm targeting compounds and associated methods of use Download PDFInfo
- Publication number
- WO2021252666A1 WO2021252666A1 PCT/US2021/036664 US2021036664W WO2021252666A1 WO 2021252666 A1 WO2021252666 A1 WO 2021252666A1 US 2021036664 W US2021036664 W US 2021036664W WO 2021252666 A1 WO2021252666 A1 WO 2021252666A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- optionally substituted
- alkyl
- groups
- compound according
- membered
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CCCCC(CC)N(CC(*CC*)CC1)C1C1=C(*)**C(c2ccccc2**)=C1** Chemical compound CCCCC(CC)N(CC(*CC*)CC1)C1C1=C(*)**C(c2ccccc2**)=C1** 0.000 description 25
- SOSJHNUBPVGYCP-UHFFFAOYSA-N CC(C(CN(CC1)C(OC(C)(C)C)=O)N1c1cc(C)nnc1C)O Chemical compound CC(C(CN(CC1)C(OC(C)(C)C)=O)N1c1cc(C)nnc1C)O SOSJHNUBPVGYCP-UHFFFAOYSA-N 0.000 description 1
- UMZGJYKVEXEGRF-UHFFFAOYSA-N CC(C)(C)OC(CCN1CCC(CN(CC2)CC(CN3)N2c2c3nnc(-c3ccccc3O)c2)CC1)=O Chemical compound CC(C)(C)OC(CCN1CCC(CN(CC2)CC(CN3)N2c2c3nnc(-c3ccccc3O)c2)CC1)=O UMZGJYKVEXEGRF-UHFFFAOYSA-N 0.000 description 1
- ZGVSLIJCYFJGDQ-UHFFFAOYSA-N CC(C)c1ccn[o]1 Chemical compound CC(C)c1ccn[o]1 ZGVSLIJCYFJGDQ-UHFFFAOYSA-N 0.000 description 1
- YVOIIFNYZFCVHY-UHFFFAOYSA-N CC(C)c1n[o]cc1 Chemical compound CC(C)c1n[o]cc1 YVOIIFNYZFCVHY-UHFFFAOYSA-N 0.000 description 1
- IQIYWUHPCCWKCX-UHFFFAOYSA-N CC(CNCC1)(CN2)N1c1c2nnc(-c2ccccc2O)c1 Chemical compound CC(CNCC1)(CN2)N1c1c2nnc(-c2ccccc2O)c1 IQIYWUHPCCWKCX-UHFFFAOYSA-N 0.000 description 1
- NQTKFVMSDTZTBG-UHFFFAOYSA-N CC1CC(CC2)C2C1 Chemical compound CC1CC(CC2)C2C1 NQTKFVMSDTZTBG-UHFFFAOYSA-N 0.000 description 1
- CZNGYMUPYXAOLR-LBPRGKRZSA-N C[C@@H](c(cc1)ccc1-[n]1c(C)ncc1)NC(OC(C)(C)C)=O Chemical compound C[C@@H](c(cc1)ccc1-[n]1c(C)ncc1)NC(OC(C)(C)C)=O CZNGYMUPYXAOLR-LBPRGKRZSA-N 0.000 description 1
- SHQAHUJQKFOGMF-QMMMGPOBSA-N C[C@@H](c(ccc(Br)c1)c1F)NC(OC(C)(C)C)=O Chemical compound C[C@@H](c(ccc(Br)c1)c1F)NC(OC(C)(C)C)=O SHQAHUJQKFOGMF-QMMMGPOBSA-N 0.000 description 1
- ZHUYNMHASYYDLT-AMGKYWFPSA-N C[C@@H]1NCC(COCc2ccccc2)NC1 Chemical compound C[C@@H]1NCC(COCc2ccccc2)NC1 ZHUYNMHASYYDLT-AMGKYWFPSA-N 0.000 description 1
- UOKFQNNYPTXKLR-KZUDCZAMSA-N Oc1ccccc1-c1cc(N(CC2)[C@@H](CN3)CN2C2CNCC2)c3nn1 Chemical compound Oc1ccccc1-c1cc(N(CC2)[C@@H](CN3)CN2C2CNCC2)c3nn1 UOKFQNNYPTXKLR-KZUDCZAMSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
- C07D487/12—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains three hetero rings
- C07D487/14—Ortho-condensed systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D519/00—Heterocyclic compounds containing more than one system of two or more relevant hetero rings condensed among themselves or condensed with a common carbocyclic ring system not provided for in groups C07D453/00 or C07D455/00
Definitions
- the bifunctional compounds are useful as modulators of targeted ubiquitination, especially with respect to Switch/Sucrose Non-Fermentable (SWI/SNF)-Related, Matrix-Associated, Actin- Dependent Regulator of Chromatin, Subfamily A, Member 2 (SMARCA2) (i.e. BRAHMA or BRM), which are degraded and/or otherwise inhibited by bifunctional compounds according to the present disclosure.
- SMARCA2 Switch/Sucrose Non-Fermentable
- BRAHMA or BRM Actin- Dependent Regulator of Chromatin, Subfamily A, Member 2
- BACKGROUND The human SWItch/Sucrose Non-Fermentable (SWI/SNF) complexes are ATP- dependent chromatin remodelers. These large complexes play important roles in essential cellular processes, such as transcription, DNA repair and replication by regulating DNA accessibility.
- SMARCA2 and SMARCA4 are the subunits containing catalytic ATPase domains and they are essential for the function of SWI/SNF in perturbation of histone-DNA contacts, thereby providing access points to transcription factors and cognate DNA elements that facilitate gene activation and repression.
- SMARCA2 and SMARCA4 shares a high degree of homology (up to 75%). SMARCA4 is frequently mutated in primary tumors (i.e., deleted or inactivated), particularly in lung cancer (12%), melanoma, liver cancer and pancreatic cancer. SMARCA2 is one of the top essential genes in SMARCA4-mutant (deleted) cancer cell line.
- SMARCA4 deleted cancer cells exclusively rely on SMARCA2 ATPase activity for their chromatin remodeling activity for cellular functions such as cell proliferation, survival and growth.
- targeting SMARCA2 may be promising therapeutic approach in SMARCA4-related or deficient cancers (genetic synthetic lethality).
- Previous studies have demonstrated the strong synthetic lethality using gene expression manipulation such as RNAi; downregulating SMARCA2 gene expression in SMARCA4 mutated cancer cells results in suppression of cancer cell proliferation.
- SMARCA2/4 bromodomain inhibitors e.g. PFI-3 exhibit none to minor effects on cell proliferation inhibition [Vangamudi et al. Cancer Res 2015].
- SMARCA2 is also reported to play roles in multiple myeloma expressing t(4;14) chromosomal translocation [Chooi et al. Cancer Res abstract 2018]. SMARCA2 interacts with NSD2 and regulates gene expression such as PRL3 and CCND1. SMARCA2 gene expression downregulation with shRNA reduces cell cycle S phase and suppresses cell proliferation of t(4;14) MM cells. [09] Therapeutic compounds that inhibit SMARCA2 and/or SMARCA4 are needed.
- one or more of the present compounds described herein are co-administered in combination with at least one additional bioactive agent, especially including an anticancer agent.
- the co-administration of compounds results in synergistic activity and/or therapy, including anticancer activity.
- compound refers to any specific chemical compound disclosed herein and includes tautomers, regioisomers, geometric isomers, and where applicable, stereoisomers, including optical isomers (enantiomers) and other stereoisomers (diastereomers) thereof, as well as pharmaceutically acceptable salts and derivatives, including prodrug and/or deuterated forms thereof where applicable, in context.
- Deuterated small molecules contemplated are those in which one or more of the hydrogen atoms contained in the drug molecule have been replaced by deuterium.
- the term compound generally refers to a single compound, but also may include other compounds such as stereoisomers, regioisomers and/or optical isomers (including racemic mixtures) as well as specific enantiomers or enantiomerically enriched mixtures of disclosed compounds.
- the term also refers, in context to prodrug forms of compounds which have been modified to facilitate the administration and delivery of compounds to a site of activity. It is noted that in describing the present compounds, numerous substituents and variables associated with same, among others, are described.
- ubiquitin ligase refers to a family of proteins that facilitate the transfer of ubiquitin to a specific substrate protein, targeting the substrate protein for degradation.
- an E3 ubiquitin ligase protein that alone or in combination with an E2 ubiquitin-conjugating enzyme causes the attachment of ubiquitin to a lysine on a target protein, and subsequently targets the specific protein substrates for degradation by the proteasome.
- E3 ubiquitin ligase alone or in complex with an E2 ubiquitin conjugating enzyme is responsible for the transfer of ubiquitin to targeted proteins.
- the ubiquitin ligase is involved in polyubiquitination such that a second ubiquitin is attached to the first; a third is attached to the second, and so forth.
- Polyubiquitination marks proteins for degradation by the proteasome.
- Mono-ubiquitinated proteins are not targeted to the proteasome for degradation, but may instead be altered in their cellular location or function, for example, via binding other proteins that have domains capable of binding ubiquitin.
- different lysines on ubiquitin can be targeted by an E3 to make chains.
- lysine is Lys48 on the ubiquitin chain. This is the lysine used to make polyubiquitin, which is recognized by the proteasome.
- alkyl by itself or as part of another substituent, means, unless otherwise stated, a straight or branched chain hydrocarbon radical having up to twelve carbon atoms. In some embodiments, the number of carbon atoms is designated (i.e., C 1 -C 8 means one to eight carbons).
- alkyl groups include methyl, ethyl, n- propyl, iso-propyl, n-butyl, t-butyl, iso-butyl, sec-butyl, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like.
- Alkyl groups may be optionally substituted as provided herein.
- the alkyl group is a C 1- C 6 alkyl; in some embodiments, it is a C 1- C 4 alkyl.
- C 1 -C 6 When a range of carbon atoms is used herein, for example, C 1 -C 6 , all ranges, as well as individual numbers of carbon atoms are encompassed.
- C 1 -C 3 includes C 1 -C 3 , C 1 - C 2 , C 2 -C 3 , C 1 , C 2 , and C 3 .
- the term “optionally substituted”, as used in combination with a substituent defined herein, means that the substituent may, but is not required to be, substituted with one or more suitable functional groups or other substituents as provided herein.
- a substituent may be optionally substituted with one or more of: halo, cyano, C 1-6 alkyl, C 3-6 cycloalkyl, C 2-6 alkenyl, C 2-6 alkynyl, halo(C 1-6 )alkyl, C 1-6 alkoxy, halo(C 1-6 alkoxy), C 1-6 alkylthio, C 1-6 alkylamino, NH 2 , NH(C 1-6 alkyl), N(C 1-6 alkyl) 2 , NH(C 1-6 alkoxy), N(C 1-6 alkoxy) 2 , —C(O)NHC 1-6 alkyl, —C(O)N(C 1-6 alkyl) 2 , —C(O)NH 2 , —C(O)C 1-6 alkyl, — C(O) 2 C 1-6 alkyl, —NHCO(C 1-6 alkyl), —N(C 1-6 alkyl)CO(C 1-6 al
- each of the above optional substituents are themselves optionally substituted by one or two groups.
- cycloalkyl refers to a 3-12 membered cyclic alkyl group, and includes bridged and spirocycles (e.g., adamantine). Cycloalkyl groups may be fully saturated or partially unsaturated.
- cycloalkyl also includes multiple condensed ring systems (e.g., ring systems comprising 2, 3 or 4 rings) wherein a single cycloalkyl ring (as defined above) can be condensed with one or more groups selected from heterocycles, carbocycles, aryls, or heteroaryls to form the multiple condensed ring system.
- Such multiple condensed ring systems may be optionally substituted with one or more (e.g., 1, 2, 3 or 4) oxo groups on the carbocycle or heterocycle portions of the multiple condensed ring.
- the rings of the multiple condensed ring system can be connected to each other via fused, spiro and bridged bonds when allowed by valency requirements.
- the individual rings of the multiple condensed ring system may be connected in any order relative to one another. It is also to be understood that the point of attachment of a multiple condensed ring system (as defined above for a cycloalkyl) can be at any position of the cycloalkylic ring.
- cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cycloheptyl, cyclohexyl, cycloheptyl, cyclooctyl, indenyl, bicyclo[2.2.1]heptanyl, bicyclo[3.1.1]heptanyl, bicyclo[4.1.0]heptanyl, spiro[3.3]heptanyl, and spiro[3.4]octanyl.
- the cycloalkyl group is a 3-7 membered cycloalkyl.
- alkenyl refers to C 2- C 12 alkyl group that contains at least one carbon-carbon double bond. In some embodiments, the alkenyl group is optionally substituted. In some embodiments, the alkenyl group is a C 2 -C 6 alkenyl. [024] The term “akynyl” as used herein refers to C 2 -C 12 alkyl group that contains at least one carbon-carbon triple bond. In some embodiments, the alkenyl group is optionally substituted. In some embodiments, the alkynyl group is a C 2- C 6 alkynyl.
- alkoxy alkylamino and “alkylthio”, are used in their conventional sense, and refer to those alkyl groups attached to the remainder of the molecule via an oxygen atom (“oxy”), an amino group (“amino”) or thio group.
- alkylamino includes mono- di-alkylamino groups, the alkyl portions can be the same or different.
- halo or “halogen”, by itself or as part of another substituent, means a fluorine, chlorine, bromine, or iodine atom.
- heteroalkyl refers to an alkyl group in which one or more carbon atom has been replaced by a heteroatom selected from S, O, P and N.
- exemplary heteroalkyls include alkyl ethers, secondary and tertiary alkyl amines, alkyl amides, alkyl sulfides, and the like.
- the group may be a terminal group or a bridging group. As used herein reference to the normal chain when used in the context of a bridging group refers to the direct chain of atoms linking the two terminal positions of the bridging group.
- aryl refers to a single, all carbon aromatic ring or a multiple condensed all carbon ring system wherein at least one of the rings is aromatic.
- an aryl group has 6 to 12 carbon atoms.
- Aryl includes a phenyl radical.
- Aryl also includes multiple condensed ring systems (e.g., ring systems comprising 2, 3 or 4 rings) having about 9 to 12 carbon atoms in which at least one ring is aromatic and wherein the other rings may be aromatic or not aromatic.
- Such multiple condensed ring systems are optionally substituted with one or more (e.g., 1, 2 or 3) oxo groups on any carbocycle portion of the multiple condensed ring system.
- the rings of the multiple condensed ring system can be connected to each other via fused, spiro and bridged bonds when allowed by valency requirements. It is to be understood that the point of attachment of a multiple condensed ring system, as defined above, can be at any position of the aromatic ring.
- aryl groups include, but are not limited to, phenyl, indenyl, naphthyl, 1, 2, 3,4-tetrahydronaphthyl, and the like.
- heteroaryl refers to a single aromatic ring that has at least one atom other than carbon in the ring, wherein the atoms are selected from the group consisting of oxygen, nitrogen and sulfur; “heteroaryl” also includes multiple condensed ring systems that have at least one such aromatic ring, which multiple condensed ring systems are further described below.
- heteroaryl includes single aromatic rings of from about 1 to 6 carbon atoms and about 1-4 heteroatoms selected from the group consisting of oxygen, nitrogen and sulfur. The sulfur and nitrogen atoms may also be present in an oxidized form provided the ring is aromatic.
- heteroaryl ring systems include but are not limited to pyridyl, pyrimidinyl, oxazolyl or furyl.
- “Heteroaryl” also includes multiple condensed ring systems (e.g., ring systems comprising 2, 3 or 4 rings) wherein a heteroaryl group, as defined above, is condensed with one or more rings selected from heteroaryls (to form for example a naphthyridinyl such as 1,8-naphthyridinyl), heterocycles, (to form for example a 1, 2, 3, 4-tetrahydronaphthyridinyl such as 1,2,3,4- tetrahydro-1,8-naphthyridinyl), carbocycles (to form for example 5,6,7,8- tetrahydroquinolyl) and aryls (to form for example indazolyl) to form the multiple condensed ring system.
- heteroaryl to form for example a naphthy
- a heteroaryl (a single aromatic ring or multiple condensed ring system) has about 1-20 carbon atoms and about 1-6 heteroatoms within the heteroaryl ring.
- a heteroaryl (a single aromatic ring or multiple condensed ring system) can also have about 5 to 12 or about 5 to 10 members within the heteroaryl ring.
- Multiple condensed ring systems may be optionally substituted with one or more (e.g., 1, 2, 3 or 4) oxo groups on the carbocycle or heterocycle portions of the condensed ring.
- the rings of a multiple condensed ring system can be connected to each other via fused, spiro and bridged bonds when allowed by valency requirements.
- the individual rings of the multiple condensed ring system may be connected in any order relative to one another. It is also to be understood that the point of attachment of a multiple condensed ring system (as defined above for a heteroaryl) can be at any position of the heteroaryl ring. It is also to be understood that the point of attachment for a heteroaryl or heteroaryl multiple condensed ring system can be at any suitable atom of the heteroaryl ring including a carbon atom and a heteroatom (e.g., a nitrogen).
- heteroaryls include but are not limited to pyridyl, pyrrolyl, pyrazinyl, pyrimidinyl, pyridazinyl, pyrazolyl, thienyl, indolyl, imidazolyl, oxazolyl, isoxazolyl, thiazolyl, furyl, oxadiazolyl, thiadiazolyl, quinolyl, isoquinolyl, benzothiazolyl, benzoxazolyl, indazolyl, quinoxalyl, quinazolyl, 5,6,7,8- tetrahydroisoquinolinyl benzofuranyl, benzimidazolyl, thianaphthenyl, pyrrolo[2,3- b]pyridinyl, quinazolinyl-4(3H)-one, triazolyl, 4,5,6,7-tetrahydro-1H-indazole and 3b,
- heteroaryl refers to a single aromatic ring containing at least one heteroatom.
- the term includes 5-membered and 6-membered monocyclic aromatic rings that include one or more heteroatoms.
- Non-limiting examples of heteroaryl include but are not limited to pyridyl, furyl, thiazole, pyrimidine, oxazole, and thiadiazole.
- heterocyclyl or “heterocycle” as used herein refers to a single saturated or partially unsaturated ring that has at least one atom other than carbon in the ring, wherein the atom is selected from the group consisting of oxygen, nitrogen and sulfur; the term also includes multiple condensed ring systems that have at least one such saturated or partially unsaturated ring, which multiple condensed ring systems are further described below.
- the term includes single saturated or partially unsaturated rings (e.g., 3, 4, 5, 6 or 7- membered rings) from about 1 to 6 carbon atoms and from about 1 to 3 heteroatoms selected from the group consisting of oxygen, nitrogen and sulfur in the ring.
- the ring may be substituted with one or more (e.g., 1, 2 or 3) oxo groups and the sulfur and nitrogen atoms may also be present in their oxidized forms.
- exemplary heterocycles include but are not limited to azetidinyl, tetrahydrofuranyl and piperidinyl.
- heterocycle also includes multiple condensed ring systems (e.g., ring systems comprising 2, 3 or 4 rings) wherein a single heterocycle ring (as defined above) can be condensed with one or more groups selected from heterocycles (to form for example a 1,8-decahydronapthyridinyl), carbocycles (to form for example a decahydroquinolyl) and aryls to form the multiple condensed ring system.
- a heterocycle a single saturated or single partially unsaturated ring or multiple condensed ring system
- Such multiple condensed ring systems may be optionally substituted with one or more (e.g., 1, 2, 3 or 4) oxo groups on the carbocycle or heterocycle portions of the multiple condensed ring.
- the rings of the multiple condensed ring system can be connected to each other via fused, spiro and bridged bonds when allowed by valency requirements. It is to be understood that the individual rings of the multiple condensed ring system may be connected in any order relative to one another.
- a heterocycle (a single saturated or single partially unsaturated ring or multiple condensed ring system) has about 3-20 atoms including about 1-6 heteroatoms within the heterocycle ring system.
- the point of attachment of a multiple condensed ring system can be at any position of the heterocyclic ring. It is also to be understood that the point of attachment for a heterocycle or heterocycle multiple condensed ring system can be at any suitable atom of the heterocyclic ring including a carbon atom and a heteroatom (e.g., a nitrogen).
- the term heterocycle includes a C 2-20 heterocycle. In one embodiment the term heterocycle includes a C 2-7 heterocycle. In one embodiment the term heterocycle includes a C 2-5 heterocycle. In one embodiment the term heterocycle includes a C 2-4 heterocycle.
- heterocycles include, but are not limited to aziridinyl, azetidinyl, pyrrolidinyl, piperidinyl, homopiperidinyl, morpholinyl, thiomorpholinyl, piperazinyl, tetrahydrofuranyl, dihydrooxazolyl, tetrahydropyranyl, tetrahydrothiopyranyl, 1,2,3,4-tetrahydroquinolyl, benzoxazinyl, dihydrooxazolyl, chromanyl, 1,2-dihydropyridinyl, 2,3-dihydrobenzofuranyl, 1,3-benzodioxolyl, 1,4-benzodioxanyl, spiro[cyclopropane-1,1′-isoindolinyl]-3′-one, isoindolinyl-1-one, 2-oxa-6-azaspiro[3.3]heptanyl, imid
- heterocycle refers to a monocyclic, saturated or partially unsaturated, 3-8 membered ring having at least one heteroatom.
- the term includes a monocyclic, saturated or partially unsaturated, 4, 5, 6, or 7 membered ring having at least one heteroatom.
- Non-limiting examples of heterocycle include aziridine, azetidine, pyrrolidine, piperidine, piperidine, piperazine, oxirane, morpholine, and thiomorpholine.
- the term “9- or 10-membered heterobicycle” as used herein refers to a partially unsaturated or aromatic fused bicyclic ring system having at least one heteroatom.
- the term 9- or 10-membered heterobicycle includes a bicyclic ring system having a benzo ring fused to a 5-membered or 6-membered saturated, partially unsaturated, or aromatic ring that contains one or more heteroatoms.
- heteroatom is meant to include oxygen (O), nitrogen (N), sulfur (S) and silicon (Si). The nitrogen and sulfur can be in an oxidized form when feasible.
- chiral refers to molecules which have the property of non-superimposability of the mirror image partner, while the term “achiral” refers to molecules which are superimposable on their mirror image partner.
- the term “stereoisomers” refers to compounds which have identical chemical constitution, but differ with regard to the arrangement of the atoms or groups in space, e.g., enantiomers, diastereomers, tautomers.
- the term “patient” or “subject” is used throughout the specification to describe an animal, preferably a human or a domesticated animal, to whom treatment, including prophylactic treatment, with the compositions according to the present disclosure is provided.
- the term patient refers to that specific animal, including a domesticated animal such as a dog or cat or a farm animal such as a horse, cow, sheep, etc.
- the term patient refers to a human patient unless otherwise stated or implied from the context of the use of the term.
- the term “effective” is used to describe an amount of a compound, composition or component which, when used within the context of its intended use, effects an intended result. The term effective subsumes all other effective amount or effective concentration terms, which are otherwise described or used in the present application.
- “Pharmaceutically acceptable” means approved or approvable by a regulatory agency of the Federal or a state government or the corresponding agency in countries other than the United States, or that is listed in the U.S. Pharmacopoeia or other generally recognized pharmacopoeia for use in animals, e.g., in humans.
- “Pharmaceutically acceptable salt” refers to a salt of a compound of the disclosure that is pharmaceutically acceptable and that possesses the desired pharmacological activity of the parent compound.
- such salts are non-toxic may be inorganic or organic acid addition salts and base addition salts.
- such salts include: (1) acid addition salts, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid, and the like; or formed with organic acids such as acetic acid, propionic acid, hexanoic acid, cyclopentanepropionic acid, glycolic acid, pyruvic acid, lactic acid, malonic acid, succinic acid, malic acid, maleic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, 3-(4-hydroxybenzoyl)benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, 1,2-ethane-disulfonic acid, 2- hydroxyethanesulfonic acid, benzenesulfonic acid, 4-chlorobenzenesulfonic acid, 2- naphthalenesulfonic acid, 4-toluenesulf
- Salts further include, by way of example only, sodium, potassium, calcium, magnesium, ammonium, tetraalkylammonium, and the like; and when the compound contains a basic functionality, salts of non-toxic organic or inorganic acids, such as hydrochloride, hydrobromide, tartrate, mesylate, acetate, maleate, oxalate and the like.
- a “pharmaceutically acceptable excipient” refers to a substance that is non-toxic, biologically tolerable, and otherwise biologically suitable for administration to a subject, such as an inert substance, added to a pharmacological composition or otherwise used as a vehicle, carrier, or diluent to facilitate administration of an agent and that is compatible therewith.
- excipients include calcium carbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, and polyethylene glycols.
- a “solvate” refers to a physical association of a compound of Formula I with one or more solvent molecules.
- “Treating” or “treatment” of any disease or disorder refers, in one embodiment, to ameliorating the disease or disorder (e.g., arresting or reducing the development of the disease or at least one of the clinical symptoms thereof). In another embodiment “treating” or “treatment” refers to ameliorating at least one physical parameter, which may not be discernible by the subject.
- treating refers to modulating the disease or disorder, either physically, (e.g., stabilization of a discernible symptom), physiologically, (e.g., stabilization of a physical parameter), or both.
- treating or “treatment” refers to delaying the onset of the disease or disorder.
- the compounds of Formula I include a protein targeting moiety (PTM).
- PTM in the compounds of Formula I is a moiety of Formula IA
- B is a ring fused to ring “C” via Y and Z.
- B in Formula IA is an optionally substituted 5-7 membered cycloalkyl ring. an optionally substituted 5-7 membered heteroaryl ring, or an optionally substituted 5-7 membered heterocyclic ring.
- B in Formula IA is an optionally substituted 5-7 membered cycloalkyl ring.
- B in Formula IA is an optionally substituted 5-7 membered cycloalkyl ring wherein the optional substituents are hydroxy, halogen, alkoxy, alkyl, haloalkyl, amino, alkylamino, or cyano.
- B in Formula IA is an optionally substituted 5-7 membered heteroaryl ring.
- B in Formula IA is an optionally substituted 5-7 membered heteroaryl ring wherein the optional substituents are hydroxy, halogen, alkoxy, alkyl, haloalkyl, amino, alkylamino, or cyano.
- B in Formula IA is an optionally substituted 5-7 membered heterocyclic ring.
- B in Formula IA is an optionally substituted 5-7 membered heterocyclic ring wherein the optional substituents are hydroxy, halogen, alkoxy, alkyl, haloalkyl, amino, alkylamino, cyano.
- W in Formula IA is optionally substituted -CH 2 -. In other embodiments, W in Formula IA is -CH 2 -.
- W in Formula IA is optionally substituted -CH 2 - wherein the optional substituent is an alkyl group, such as, for example methyl (-CH 3 ), ethyl, propyl, and the like.
- W in Formula IA is -C(CH 3 )H-.
- W in Formula IA is -C(O)-.
- W in Formula IA is -S(O)-.
- W in Formula IA is optionally substituted -S(O) 2 -.
- R c1 and R d1 in Formula IA are independently H, D, Halo, C 1-3 alkyl, C 1-3 haloalkyl, or C 1-4 alkoxyl.
- R c1 is H.
- R c1 is D.
- R c1 is halo, e.g., -F, -Cl, -Br, or -I.
- R c1 is C 1-3 alkyl, e.g., -C 1 alkyl, -C 2 alkyl, -C 3 alkyl, -CH 3 , - CH 2 CH 3 , and the like.
- R c1 is C 1-3 haloalkyl, e.g., -C 1 haloalkyl, -C 2 haloalkyl, -C 3 haloalkyl, -CF 3 , -CH 2 CF 3 , and the like.
- R c1 is C 1-4 alkoxyl, e.g., -C 1 alkoxyl, -C 2 alkoxyl, -C 3 alkoxyl, -C 4 alkoxyl, -OCH 3 , -OCH 2 CH 3 , and the like.
- R d1 is H.
- R d1 is D.
- R d1 is halo, e.g., -F, -Cl, -Br, or -I.
- R d1 is C 1-3 alkyl, e.g., -C 1 alkyl, -C 2 alkyl, -C 3 alkyl, -CH 3 , - CH 2 CH 3 , and the like.
- R d1 is C 1-3 haloalkyl, e.g., -C 1 haloalkyl, -C 2 haloalkyl, -C 3 haloalkyl, -CF 3 , -CH 2 CF 3 , and the like.
- R d1 is C 1-4 alkoxyl, e.g., -C 1 alkoxyl, -C 2 alkoxyl, -C 3 alkoxyl, -C 4 alkoxyl, -OCH 3 , -OCH 2 CH 3 , and the like.
- R e3 in Formula IA is H, -C(O)R f , or -P(O)(OR g ) 2 ; wherein R f and R g are independently H, C 1-4 alkyl, C 1-4 substituted alkyl, C 3-8 cyclcoalkyl, C 3-8 substituted cyclcoalkyl, C 3-8 heterocyclcoalkyl, or C 3-8 substituted heterocyclcoalkyl;.
- R e3 is H.
- R e3 is -C(O)R f wherein R f is H, C 1-4 alkyl, C 1-4 substituted alkyl, C 3-8 cyclcoalkyl, C 3-8 substituted cyclcoalkyl, C 3-8 heterocyclcoalkyl, or C 3-8 substituted heterocyclcoalkyl.
- R e3 is -C(O)R f wherein R f is H.
- R e3 is -C(O)R f wherein R f is C 1-4 alkyl, e.g., -C 1 alkyl, -C 2 alkyl, -C 3 alkyl, -C 4 alkyl, -CH 3 , - CH 2 CH 3 , and the like.
- R e3 is -C(O)R f wherein R f is C 1-4 substituted alkyl, e.g., -C 1 substituted alkyl, -C 2 substituted alkyl, -C 3 substituted alkyl, and -C 4 substituted alkyl.
- R e3 is -C(O)R f wherein R f is C 3-8 cyclcoalkyl, e.g., C 3 cyclcoalkyl, C 4 cyclcoalkyl, C 5 cyclcoalkyl, C 6 cyclcoalkyl, C 7 cyclcoalkyl, and C 8 cyclcoalkyl.
- R e3 is -C(O)R f wherein R f is C 3-8 substituted cyclcoalkyl, e.g., C 3 substituted cyclcoalkyl, C 4 substituted cyclcoalkyl, C5 substituted cyclcoalkyl, C 6 substituted cyclcoalkyl, C 7 substituted cyclcoalkyl, and C 8 substituted cyclcoalkyl.
- R f is C 3-8 substituted cyclcoalkyl, e.g., C 3 substituted cyclcoalkyl, C 4 substituted cyclcoalkyl, C5 substituted cyclcoalkyl, C 6 substituted cyclcoalkyl, C 7 substituted cyclcoalkyl, and C 8 substituted cyclcoalkyl.
- R e3 is -C(O)R f wherein R f is C 3-8 heterocyclcoalkyl, e.g., C 3 heterocyclcoalkyl, C 4 heterocyclcoalkyl, C5 heterocyclcoalkyl, C 6 heterocyclcoalkyl, C 7 heterocyclcoalkyl, and C 8 heterocyclcoalkyl.
- R e3 is -C(O)R f wherein R f is C 3-8 substituted heterocyclcoalkyl, e.g., C 3 substituted heterocyclcoalkyl, C 4 substituted heterocyclcoalkyl, C5 substituted heterocyclcoalkyl, C 6 substituted heterocyclcoalkyl, C 7 substituted heterocyclcoalkyl, and C 8 substituted heterocyclcoalkyl.
- R f is C 3-8 substituted heterocyclcoalkyl, e.g., C 3 substituted heterocyclcoalkyl, C 4 substituted heterocyclcoalkyl, C5 substituted heterocyclcoalkyl, C 6 substituted heterocyclcoalkyl, C 7 substituted heterocyclcoalkyl, and C 8 substituted heterocyclcoalkyl.
- R e3 is -P(O)(OR g ) 2 ; wherein each R g is independently H, C 1-4 alkyl, C 1-4 substituted alkyl, C 3-8 cyclcoalkyl, C 3-8 substituted cyclcoalkyl, C 3-8 heterocyclcoalkyl, or C 3-8 substituted heterocyclcoalkyl.
- R e3 is -P(O)(OR g ) 2 ; wherein each R g is H.
- R e3 is -P(O)(OR g ) 2 ; wherein each R g is C 1-4 alkyl, e.g., -C 1 alkyl, -C 2 alkyl, -C 3 alkyl, -C 4 alkyl, -CH 3 , -CH 2 CH 3 , and the like.
- R e3 is -P(O)(OR g ) 2 ; wherein one R g is H and the other R g is C 1-4 alkyl, e.g., -C 1 alkyl, -C 2 alkyl, -C 3 alkyl, -C 4 alkyl, -CH 3 , -CH 2 CH 3 , and the like.
- R e3 is -P(O)(OR g ) 2 ; wherein at least one R g is C 1-4 substituted alkyl, e.g., -C 1 substituted alkyl, -C 2 substituted alkyl, -C 3 substituted alkyl, and -C 4 substituted alkyl.
- R e3 is -P(O)(OR g ) 2 ; wherein at least one R g is C 3-8 cyclcoalkyl, e.g., C 3 cyclcoalkyl, C 4 cyclcoalkyl, C5 cyclcoalkyl, C 6 cyclcoalkyl, C 7 cyclcoalkyl, and C 8 cyclcoalkyl.
- R e3 is -P(O)(OR g ) 2 ; wherein at least one R g is C 3-8 substituted cyclcoalkyl, e.g., C 3 substituted cyclcoalkyl, C 4 substituted cyclcoalkyl, C 5 substituted cyclcoalkyl, C 6 substituted cyclcoalkyl, C 7 substituted cyclcoalkyl, and C 8 substituted cyclcoalkyl.
- R e3 is -P(O)(OR g ) 2 ; wherein at least one R g is C 3-8 heterocyclcoalkyl, e.g., C 3 heterocyclcoalkyl, C 4 heterocyclcoalkyl, C 5 heterocyclcoalkyl, C 6 heterocyclcoalkyl, C 7 heterocyclcoalkyl, and C 8 heterocyclcoalkyl.
- R e3 is -P(O)(OR g ) 2 ; wherein at least one R g is C 3-8 substituted heterocyclcoalkyl, e.g., C 3 substituted heterocyclcoalkyl, C 4 substituted heterocyclcoalkyl, C 5 substituted heterocyclcoalkyl, C 6 substituted heterocyclcoalkyl, C 7 substituted heterocyclcoalkyl, and C 8 substituted heterocyclcoalkyl.
- Examples of these embodiments include:
- the PTM is a moiety of Formula IA wherein * is a point of attachment to ULM.
- R 1 in Formula IA is a covalent bond, or chemical moiety that links PTM and ULM.
- R 1 in Formula IA is a covalent bond.
- R 1 in Formula IA is a chemical moiety that links PTM and ULM.
- Chemical moieties that are used to link PTM and ULM moieties are known in the art. These moieties are sometimes referred to as “linkers” in the art.
- R 1 in Formula IA is a chemical moiety that is used to link a PTM and ULM that is known in the art. [0104] In some embodiments, R 1 in Formula IA is a chemical moiety that is used to link a PTM and ULM as described in U.S. Patent Application Publication No.2019/0300521, the entirety of which is incorporated by reference herein. [0105] In other embodiments, R 1 in Formula IA is a chemical moiety that is used to link a PTM and ULM as described in U.S. Patent Application Publication No.2019/0255066, the entirety of which is incorporated by reference herein.
- R 1 in Formula IA is a chemical moiety that is used to link a PTM and ULM as described in WO 2019/084030, the entirety of which is incorporated by reference herein.
- R 1 in Formula IA is a chemical moiety that is used to link a PTM and ULM as described in WO 2019/084026, the entirety of which is incorporated by reference herein.
- R 1 is -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CO)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c ; -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CO)-A- (CR 1a R 1b ) 1-5 - wherein A is O, S, or NR 1c ; -A-(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -A- wherein each A is independently O, S, or NR 1c ; -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -A- wherein each A is independently
- R 1 is -(CR 1a R 1b ) 1-5 , for example -(CH 2 ) 1-5 -, -CH 2 -, - CH 2 CH 2 CH 2 - and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , such as for example, -(CH 2 ) 1-5 -O-, -(CH 2 ) 1-5 -S-, -(CH 2 ) 1-5 -NH-, or -(CH 2 )0-2-(C(CH 3 ) 2 )-(CH 2 )0-2-O-.
- R 1 is -(CR 1a R 1b ) 1-5 -A-(CR 1a R 1b ) 1-5 - wherein A is O, S, or NR 1c , such as, for example, -(CH 2 ) 1-5 -O-(CH 2 ) 1-5 -, -(CH 2 ) 1-5 -S-(CH 2 ) 1-5 -, -(CH 2 ) 1-5 -NH- (CH 2 ) 1-5 -.
- R 1 is -(C ⁇ C)-(CR 1a R 1b ) 1-5, such as, for example, -(C ⁇ C)- (CH 2 ) 2 -, and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -(3-11 membered cycloalkyl optionally substituted with 0-6 R 1a and/or R 1b groups)-, such as, for example, -CH 2 -cyclobutyl-.
- R 1 is -(CR 1a R 1b ) 1-5 -(3-11 membered cycloalkyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 , such as, for example, -CH 2 - cyclobutyl-CH 2 - and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 , such as, for example, -CH 2 - azetidinyl-CH 2 -.
- R 1 is -(CR 1a R 1b ) 1-5 -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-, such as, for example, -CH 2 -azetidinyl-.
- R 1 is -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups) -(CR 1a R 1b ) 1-5 -, such as, for example, -azetidinyl-CH 2 -, - pyrolidnyl-CH 2 -, -piperidinyl-CH 2 -, and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -(3-11 membered cycloalkyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , such as, for example, -CH 2 -cyclopropyl-CH 2 -O-, and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , such as, for example, -CH 2 -piperidinyl-CH 2 CH 2 -O-, and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-A- wherein A is O, S, or NR 1c , such as, for example, -CH 2 -azetidinyl-O-, and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -A-(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)- wherein A is O, S, or NR 1c , such as, for example, -CH 2 -O-azetidinyl-, -CH 2 -NH-azetidinyl-, and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -A-(3-11 membered cycloalkyl optionally substituted with 0-6 R 1a and/or R 1b groups)- wherein A is O, S, or NR 1c , such as -CH 2 -O- cyclobutylene-, -CH 2 -NH-cyclobutylene-, and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -A-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , such as, for example, -CH 2 -O-CH 2 CH 2 -O-.
- the Y in the compound of Formula IA is CR h wherein R h is H, and the compound of Formula IA has Formula IA-1: wherein R c1 , R d1 , R e3 , W, Z, B, n, and R 1 are as described above for Formula IA.
- n in Formula IA-1 is 1.
- At least one W is optionally substituted -CH 2 -.
- at least one W is optionally substituted -CH 2 - wherein the optional substituents are alkyl, alkoxy, alkylamino.
- at least one W is -CH 2 -.
- W in Formula IA-1 is optionally substituted -CH 2 - wherein the optional substituent is an alkyl group, such as, for example methyl (-CH 3 ), ethyl, propyl, and the like.
- W in Formula IA-1 is -CH(CH 3 )-. [0139] In some embodiments of the compound of Formula IA-1, one W is -C(O)-. [0140] In some embodiments of the compound of Formula IA-1, one W is -S(O)-. [0141] In some embodiments of the compound of Formula IA-1, one W is -S(O) 2 -. [0142] In some embodiments, B in Formula IA-1 is an optionally substituted 5-7 membered cycloalkyl ring.
- B in Formula IA-1 is an optionally substituted 5-7 membered cycloalkyl ring wherein the optional substituents are hydroxy, halogen, alkoxy, alkyl, haloalkyl, amino, alkylamino, or cyano.
- B in Formula IA-1 is an optionally substituted 5-7 membered heterocyclic ring.
- B in Formula IA-1 is an optionally substituted 5-7 membered heterocyclic ring wherein the optional substituents are hydroxy, halogen, alkoxy, alkyl, haloalkyl, amino, alkylamino, cyano.
- the Y in the compound of Formula IA is N, and Z is CR h wherein R h is H, and the compound of Formula IA has Formula IA-2: wherein R c1 , R d1 , R e3 , W, B, n, and R 1 are as described above for Formula IA.
- n in Formula IA-2 is 1.
- at least one W is optionally substituted -CH 2 -.
- At least one W is optionally substituted -CH 2 - wherein the optional substituents are alkyl, alkoxy, or alkylamino.
- at least one W is -CH 2 -.
- W in Formula IA-2 is optionally substituted -CH 2 - wherein the optional substituent is an alkyl group, such as, for example methyl (-CH 3 ), ethyl, propyl, and the like.
- W in Formula IA-2 is -CH(CH 3 )-.
- one W is -C(O)-.
- one W is -S(O)-.
- one W is -S(O) 2 -.
- B in Formula IA-2 is an optionally substituted 5-7 membered heterocyclic ring.
- B in Formula IA-2 is an optionally substituted 5-7 membered heterocyclic ring wherein the optional substituents are hydroxy, halogen, alkoxy, alkyl, haloalkyl, amino, alkylamino, cyano.
- B in Formula IA-2 is an optionally substituted 5-7 membered heterocyclic ring.
- B in Formula IA-2 is an optionally substituted 5-7 membered heterocyclic ring wherein the optional substituents are hydroxy, halogen, alkoxy, alkyl, haloalkyl, amino, alkylamino, or cyano.
- Q is optionally substituted -CH 2 -.
- Q is optionally substituted -CH 2 - wherein the optional substituents are alkyl, alkoxy, or alkylamino.
- Q is optionally substituted -(CH 2 ) 2 -.
- Q is optionally substituted -(CH 2 ) 2 - wherein the optional substituents are alkyl, alkoxy, or alkylamino.
- Q is -C(O)-.
- Q is optionally substituted -CH 2 C(O)-.
- Q is -S(O)-.
- Q is -S(O) 2 -.
- Q is optionally substituted -CH 2 S(O) 2 -.
- Q is optionally substituted -CH 2 S(O)-.
- n 3.
- R k F.
- R k C 1-3 alkyl, for example, C 1 alkyl, C 2 alkyl, C 3 alkyl, -CH 3 , - CH 2 CH 3 , and the like.
- R k C 1-3 haloalkyl, for example, C 1 haloalkyl, C 2 haloalkyl, C 3 haloalkyl, -CF 3 , - CH 2 CF 3 , and the like.
- R k C 1-4 alkoxyl, for example, C 1 alkoxyl, C 2 alkoxyl, C 3 alkoxyl, -OCH 3 , -OCH 2 CH 3 , and the like.
- R k substituted C 1-3 alkyl, for example, substituted C 1 alkyl, substituted C 2 alkyl, substituted C 3 alkyl, and the like.
- R k substituted C 1-3 haloalkyl, for example, substituted C 1 haloalkyl, substituted C 2 haloalkyl, substituted C 3 haloalkyl, and the like.
- R k substituted C 1-4 alkoxyl, for example, substituted C 1 alkoxyl, substituted C 2 alkoxyl, substituted C 3 alkoxyl, and the like.
- R k C 1-3 haloalkyl, for example, C 1 haloalkyl, C 2 haloalkyl, C 3 haloalkyl, -CF 3 , - CH 2 CF 3 , and the like.
- R k H. or C 1-4 alkoxyl, for example, C 1 alkoxyl, C 2 alkoxyl, C 3 alkoxyl, -OCH 3 , -OCH 2 CH 3 , and the like.
- R k C 1-3 haloalkyl, for example, C 1 haloalkyl, C 2 haloalkyl, C 3 haloalkyl, -CF 3 , - CH 2 CF 3 , and the like.
- R k H. or C 1-4 alkoxyl, for example, C 1 alkoxyl, C 2 alkoxyl, C 3 alkoxyl, -OCH 3 , -OCH 2 CH 3 , and the like.
- the ULM moiety in the compounds of the disclosure is a small molecule E3 Ubiquitin Ligase binding moiety that binds a Von Hippel-Lindau E3 Ubiquitin Ligase (VHL).
- VHL Von Hippel-Lindau E3 Ubiquitin Ligase
- Such ULM moieties that bind to VHL are known to those of skill in the art. Methods of determining whether a small molecule binds a Von Hippel-Lindau E3 Ubiguitin Ligase are known in the art.
- the ULM is a previously described ULM.
- the ULM is a ULM moiety described in U.S.
- the ULM is a ULM moiety described in U.S. Patent Application Publication No.2019/0255066, the entirety of which is incorporated by reference herein.
- the ULM is a ULM moiety described in WO 2019/084030, the entirety of which is incorporated by reference herein.
- the ULM is a ULM moiety described in WO 2019/084026, the entirety of which is incorporated by reference herein.
- the ULM is a moiety having the Formula ULM-I wherein ------- indicates the position of attachment of the ULM to R 1;
- V is H or F;
- R 3 is optionally substituted phenyl, optionally substituted napthyl, or an optionally substituted 5-10 membered heteroaryl;
- one of R 4 or R 5 is H, D, haloalkyl, optionally substituted alkyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, -COR d , CONR e1 R e2 ; the other of R 4 or R 5 is H or D; or R 4 and R 5 , together with the carbon atom to which they are both attached, form an optionally substituted 3-5 membered cycloalkyl, or heterocyclyl;
- W 3 is an optionally substituted aryl, optionally substituted heteroaryl, or
- R 6 and R 7 are independently H, D, optionally substituted alkyl, optionally
- R 3 is optionally substituted phenyl having the formula: wherein R 9 is H, D, halo, -CN, -OH, -NO 2 , -NR e1 R e2 , -OR e1 , -CONR e1 R e2 , -NR e1 COR e2 , - SO 2 NR e1 R e2 , -NR e1 SO2R e2 , optionally substituted alkyl, optionally substituted alkoxyl, optionally substituted haloalkyl, optionally substituted haloalkoxy; optionally substituted aryl; optionally substituted heteroaryl; optionally substituted cycloalkyl; or optionally substituted heterocyclyl; R 10 is H, D, halo,
- R 3 is optionally substituted phenyl
- R 10 is -F or - OCH 3 .
- R 9 is -CN.
- R 9 is an optionally substituted heteroaryl.
- R 9 is , each optionally substituted.
- R 3 is optionally substituted phenyl
- R 9 is .
- R 9 is .
- R 3 is .
- R 10 is hydroxy, halogen, -NH(C 1 -C 4 alkyl), or C 1 -C 6 alkoxy, and z is 0, 1, 2, 3, or 4.
- one of R 4 or R 5 is H, and the other of R 4 or R 5 is H or optionally substituted alkyl.
- one of R 4 or R 5 is H, and the other of R 4 or R 5 is optionally substituted C 1 -C 6 alkyl.
- one of R 4 or R 5 is H, and the other of R 4 or R 5 is C 1 -C 6 alkyl.
- one of R 4 or R 5 is H, and the other of R 4 or R 5 is - CH 3 .
- one of R 4 or R 5 is H, and the other of R 4 or R 5 is - CH 2 OH.
- both R 4 and R 5 are H.
- W 3 is .
- R 6 is H.
- R 7 is H, or optionally substituted alkyl. [0233] In some embodiments of ULM-I, R 7 is H. [0234] In some embodiments of ULM-I, R 7 is optionally substituted alkyl. [0235] In some embodiments of ULM-I, R 7 is optionally substituted C 1 -C 6 alkyl. [0236] In some embodiments of ULM-I, R 7 is C 1 -C 6 alkyl.
- R 7 is C 1 -C 6 alk-OH, C 1 -C 6 alk-NH 2 , -C 1 -C 6 alk- CONH-*, or -C 1- C 6 alk-NHCO-* wherein * is a point of attachment to R 1 .
- R 7 is -t-butyl or -isopropyl.
- R 7 is -t-butyl.
- R 7 is -isopropyl.
- R 8 is NR a R b .
- R a is H or optionally substituted alkyl.
- R a is H.
- R b is H, optionally substituted alkyl, -C(O)-* wherein * is a point of attachment to R 1 , optionally substituted (cycloalkyl)carbonyl, or optionally substituted alkylcarbonyl.
- R b is optionally substituted alkylcarbonyl.
- R b is -C(O)-* wherein * is a point of attachment to R 1 .
- R 8 is CONR a R b .
- R 8 is wherein * is a point of attachment to R 1 .
- * is a point of attachment to R 1 .
- R 8 is wherein * is a point of attachment to R 1 .
- R 8 is wherein * is a point of 1 attachment to R .
- R 8 is [0252] In some embodiments, R 8 is -NH-* wherein * is a point of attachment to R 1 . [0253] In some embodiments of ULM-I, R 8 is optionally substituted heteroaryl. [0254] In some embodiments of ULM-I, R 8 is wherein each R c is independently halo, optionally substituted alkoxy, cyano, optionally substituted alkyl, haloalkyl, or haloalkoxy, and p is 0, 1, or 2.
- R 8 is wherein each R c is independently halo, optionally substituted alkoxy, cyano, optionally substituted alkyl, haloalkyl, or haloalkoxy, and p is 0, 1, or 2. [0256] In some embodiments, R 8 is whe 1 rein * is a point of attachment to R .
- R 8 is [0258] In some embodiments, R 8 is [0259] In some embodiments, R 8 is [0260] In some embodiments, R 8 is [0261] In some embodiments, R 8 is [0262] In some embodiments, R 8 is [0263] In some embodiments, R 8 is [0264] In some embodiments, R 8 is [0265] In some embodiments, . [0266] In some embodiments, ULM-I is a compound of formula: * is a point of attachment of the ULM to R 1 .
- ULM-IA In some embodiments of ULM-IA, ULM-IB, ULM-IC, or ULM-ID, R 9 is optionally substituted and and R 10 is H, D, hydroxy, halogen, aminoC 1-4 alkyl, or C 1-4 alkyloxy.
- the ULM is a moiety having the Formula ULM-II
- R 14 is C 1 -C 6 alkyl, such as, for example, -CH 3 , -CH 2 CH 3 , -CH(CH 3 ) 2 , and the like; and all of the other variables have the same scope as set forth above with respect to ULM-I.
- R 14 in ULM-II is -CH 3 .
- R 14 in ULM-II is -CH(CH 3 ) 2 .
- R k C 1-3 alkyl, for example, C 1 alkyl, C 2 alkyl, C 3 alkyl, -CH 3 , - CH 2 CH 3 , and the like.
- R k C 1-3 haloalkyl, for example, C 1 haloalkyl, C 2 haloalkyl, C 3 haloalkyl, -CF 3 , - CH 2 CF 3 , and the like.
- R k H.
- R c1 and R d1 are each H.
- R e3 is H.
- R c1 , R d1 , and R e3 are each H.
- the compounds of Formula I are compounds of Formula IA-9a or IA-10a: wherein X is N or CH, and the other variables are as set forth above with respect to Formula IA-9 and IA-10. [0286] In some aspects, the compounds of Formula I are those having the formula IA-11 or IA-12:
- W is -CH 2 - or -CH(CH 3 )-
- X is N or CH
- R 1 is a covalent bond
- 3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups
- -(CR 1a R 1b ) 1-5 ;
- -(CR 1a CR 1b )-;
- W is -CH 2 -.
- X is -N.
- X is -CH.
- R 4 is -CH 3 .
- R 7 is ably -C(CH 3 )3 or -CH(CH 3 ) 2 .
- s 0.
- R 1 is: -(CR 1a R 1b ) 1-5 ; -(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c ; -(CR 1a R 1b ) 1-5 -A-(CR 1a R 1b ) 1-5 - wherein A is O, S, or NR 1c ; -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CO)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c ; -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CO)-A-(CR 1a R 1b ) 1-5 - wherein A is O, S, or NR 1c ; -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or
- each R 1a , each R 1b , and each R 1c is independently H or C 1 -C 6 alkyl.
- R 1 is - (CR 1a R 1b ) 1-5 , such as, for example, -CH 2 -, -CH 2 CH 2 -, -CH 2 CH 2 CH 2 -, -CH 2 CH 2 CH 2 CH 2 -, - CH 2 CH 2 CH 2 CH 2 -, and the like.
- R 1 is - (CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , such as, for example, -CH 2 -O-, -CH 2 CH 2 -O-, - CH 2 CH 2 CH 2 -O-, and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -A- (CR 1a R 1b ) 1-5 - wherein A is O, S, or NR 1c , such as, for example, -CH 2 CH 2 CH 2 -N(CH 3 )- CH 2 CH 2 -, -CH 2 CH 2 -N(CH 3 )-CH 2 CH 2 -, -CH 2 CH 2 -O-CH 2 -, and the like.
- R 1 is -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CO)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , such as, for example, -piperidinyl-(CO)-CH(CH 3 )-O-, - pyrrolidinyl-(CO)-CH(CH 3 )-O-, -piperidinyl-(CO)-CH 2 -O-, -methylpiperidinyl-(CO)-CH 2 - O-, and the like.
- R 1 is -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CO)-A-(CR 1a R 1b ) 1-5 - wherein A is O, S, or NR 1c , such as, for example, -piperidinyl-(CO)-O-CH 2 -, and the like.
- R 1 is -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , such as, for example, -azabicyclo[3.1.1]heptanyl-CH 2 CH 2 -O-, - azaspiro[3.3]heptanyl-CH 2 CH 2 -O-, -piperidinyl-CH 2 CH 2 -O-, -fluoropiperidinyl-CH 2 CH 2 -O- , -azepanyl-CH 2 CH 2 -O-, -pyrrolidinyl-CH 2 CH 2 -O-, -piperidinyl-CH 2 CH(CH 3 )-O-, - octahydrocyclopenta[c]pyrrolyl-CH 2 CH 2 -O-,
- R 1 is -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -, such as, for example, -piperidinyl-CH 2 -, -piperidinyl-CH 2 CH 2 -, -piperidinyl-CH 2 CH 2 CH 2 -, azetidinyl- CH 2 CH 2 CH 2 -, -aziridinyl-CH 2 -, -pyrrolidinyl-CH 2 CH 2 -, and the like.
- R 1 is -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , such as, for example, -piperidinyl-pyrrolidinyl-CH 2 CH 2 -O-, -piperidinyl- piperidinyl-CH 2 CH 2 -O-, -pyrrolidinyl-piperidinyl-CH 2 CH 2 -O-, and the like.
- R 1 is -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 - A- wherein A is O, S, or NR 1c , such as, for example, -piperidinyl-CH 2 -piperidinyl-CH 2 CH 2 - O-, -piperidinyl-CH 2 CH 2 -piperidinyl-CH 2 CH 2 -O-, and the like.
- R 1 is -(3-11 membered cycloalkyl optionally substituted with 0-6 R 1a and/or R 1b groups)-A-(CR 1a R 1b ) 1-5 - wherein each A is independently O, S, or NR 1c , such as, for example, -cyclohexyl-N(CH 3 )-CH 2 CH 2 - O-, and the like.
- R 1 is -(CO)-(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , such as, for example, -(CO)-piperidinyl-CH 2 CH 2 -O-, and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -, such as, for example, -CH 2 -piperidinyl-CH 2 -, -CH 2 -piperidinyl-CH 2 CH 2 -, -CH 2 -piperidinyl- CH 2 CH 2 CH 2 -, and the like.
- R 1 is -(CR 1a R 1b ) 1-5 -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 - A-, wherein each A is independently O, S, or NR 1c , such as, for example, -CH 2 -pyrrolidinyl- CH 2 CH 2 -O-, -CH 2 -pyridinyl-CH 2 CH(CH 3 )-O-, -CH 2 -pyridinyl-CH 2 CH 2 -O-, -CH(CH 3 )- pyridinyl-CH 2 CH 2 -O-, -CH 2 -azepanyl-CH 2 CH(CH 3 )-O-, -CH 2 -azabicyclo[3.2.1]octanyl- CH 2 CH 2 -O-, -CH 2 -(d
- R 1 is -(CR 1a R 1b ) 1-5 -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-A- wherein A is O, S, or NR 1c , such as, for example, -CH 2 CH 2 CH 2 -pyrrolidinyl-O-, and the like.
- R 1 is -(heteroaryl optionally substituted with 0-4 R 1a and/or R 1b groups)-A-(CR 1a R 1b ) 1-5 - wherein A is O, S, or NR 1c , such as, for example, -pyridinyl-O-CH 2 -, and the like.
- R 1 is -A-(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -A- wherein each A is independently O, S, or NR 1c , such as, for example, -N(CH 3 )-piperidinyl-CH 2 CH 2 - O-, and the like.
- the compounds of Formula I are those having the formula IA-13a, IA-13b, IA-14a or IA-14b:
- R 1 is -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CO)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , or -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c , R 1a , R 1b , R 1c , and R 1e are each independently, -H, D, -halo, -C 1 -C 8 alkyl, -C 1 - C 6 haloalkyl, -O-C 1 -C 8 alkyl, -S-C
- R 1 is -(3-11 membered heterocyclyl)-(CO)-(CR 1a R 1b ) 1-3 -O- wherein each R 1a is H and each R 1b is independently H or -C 1 -C 8 alkyl, preferably -CH 3 .
- R 1 is -(3-11 membered heterocyclyl)-(CR 1a R 1b ) 1-3 -O-, wherein each R 1a is H and each R 1b is independently H or -C 1 -C 8 alkyl, preferably -CH 3 .
- R 1 is -azabicyclo[3.1.1]heptanyl-CH 2 CH 2 -O-, - azaspiro[3.3]heptanyl-CH 2 CH 2 -O-, - piperidinyl-CH 2 CH 2 -O-, -fluoropiperidinyl-CH 2 CH 2 -O-, -azepanyl-CH 2 CH 2 -O-, - pyrrolidinyl-CH 2 CH 2 -O-, -piperidinyl-CH 2 CH(CH 3 )-O-, -octahydrocyclopenta[c]pyrrolyl- CH 2 CH 2 -O-, -pyrrolidinyl-CH 2 CH(CH 3 )-O-, -methylpiperidinyl-CH 2 CH 2 -O-, -piperidinyl- CH 2
- R 1a1 is H or -C 1 -C 8 alkyl, preferably -CH 2 CH 3 , or -CH 3 ;
- R 1c is -H, or -C 1 -C 8 alkyl, preferably -CH 3 ;
- A is O and R 1a1 is -C 1 -C 8 alkyl, preferably -CH 2 CH 3 , or -CH 3 .
- R 1a1 is -C 1 -C 8 alkyl, preferably -CH 2 CH 3 , or -CH 3 .
- a 1 is a covalent bond.
- a 1 is -(CR 1a R 1b )1-3.
- the compounds of the disclosure include: (2S,4R)-4-hydroxy-1-((S)-2-(2-((R)-2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)acetamido)-3,3-dimethylbutanoyl)-N-((S)- 1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2-carboxamide; (2S,4R)-4-hydroxy-1-((S)-2-(2-((S)-2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)acetamido)
- the compounds of the invention may have multiple stereogenic centers. As a result, there exist multiple stereoisomers (enantiomers and diastereomers) of the compounds (and subgenera described herein).
- the present disclosure contemplates and encompasses each stereoisomer of any compound encompassed by the disclosure as well as mixtures of said stereoisomers.
- Pharmaceutically acceptable salts and solvates of the compounds of the disclosure are also within the scope of the disclosure.
- Isotopic variants of the compounds of the disclosure are also contemplated by the present disclosure.
- references to formula I or subgenera thereof e.g., formula IA, IA-1, IA-2, IA-3, IA-4, IA-5, IA-6, IA-7, IA-8, IA-9, IA-9a, IA-10, IA-10a, IA-11, IA-12, IA-13a, IA-13b, IA-14a, IA-14b, IA-15a, IA-15b, IA-16a, IA-16b
- formula I or subgenera thereof e.g., formula IA, IA-1, IA-2, IA-3, IA-4, IA-5, IA-6, IA-7, IA-8, IA-9, IA-9a, IA-10, IA-10a, IA-11, IA-12, IA-13a, IA-13b, IA-14a, IA-14b, IA-15a, IA-15b, IA-16a, IA-16b
- certain features of the invention which are, for clarity, described herein in the context of separate embodiment
- compositions and methods of administration are typically formulated to provide a therapeutically effective amount of a compound of the present disclosure as the active ingredient, or a pharmaceutically acceptable salt, ester, prodrug, solvate, hydrate or derivative thereof.
- the pharmaceutical compositions contain pharmaceutically acceptable salt and/or coordination complex thereof, and one or more pharmaceutically acceptable excipients, carriers, including inert solid diluents and fillers, diluents, including sterile aqueous solution and various organic solvents, permeation enhancers, solubilizers and adjuvants.
- the subject pharmaceutical compositions can be administered alone or in combination with one or more other agents, which are also typically administered in the form of pharmaceutical compositions.
- the one or more compounds of the invention and other agent(s) may be mixed into a preparation or both components may be formulated into separate preparations to use them in combination separately or at the same time.
- the concentration of one or more compounds provided in the pharmaceutical compositions of the present invention is less than 100%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, 0.1%, 0.09%, 0.08%, 0.07%, 0.06%, 0.05%, 0.04%, 0.03%, 0.02%, 0.01%, 0.009%, 0.008%, 0.007%, 0.006%, 0.005%, 0.004%, 0.003%, 0.002%, 0.001%, 0.0009%, 0.0008%, 0.0007%, 0.0006%, 0.0005%, 0.0004%, 0.0003%, 0.0002%, or 0.0001% (or a number in the range defined by and including any two numbers above) w/w/w/w
- the concentration of one or more compounds of the invention is greater than 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 19.75%, 19.50%, 19.25%, 19%, 18.75%, 18.50%, 18.25% 18%, 17.75%, 17.50%, 17.25% 17%, 16.75%, 16.50%, 16.25%, 16%, 15.75%, 15.50%, 15.25% 15%, 14.75%, 14.50%, 14.25% 14%, 13.75%, 13.50%, 13.25%, 13%, 12.75%, 12.50%, 12.25%, 12%, 11.75%, 11.50%, 11.25% 11%, 10.75%, 10.50%, 10.25% 10%, 9.75%, 9.50%, 9.25%, 9%, 8.75%, 8.50%, 8.25% 8%, 7.75%, 7.50%, 7.25%, 7%, 6.75%, 6.50%, 6.25%, 6%, 5.75%, 5.50%, 5.25%, 5%, 5%,
- the concentration of one or more compounds of the invention is in the range from approximately 0.0001% to approximately 50%, approximately 0.001% to approximately 40%, approximately 0.01% to approximately 30%, approximately 0.02% to approximately 29%, approximately 0.03% to approximately 28%, approximately 0.04% to approximately 27%, approximately 0.05% to approximately 26%, approximately 0.06% to approximately 25%, approximately 0.07% to approximately 24%, approximately 0.08% to approximately 23%, approximately 0.09% to approximately 22%, approximately 0.1% to approximately 21%, approximately 0.2% to approximately 20%, approximately 0.3% to approximately 19%, approximately 0.4% to approximately 18%, approximately 0.5% to approximately 17%, approximately 0.6% to approximately 16%, approximately 0.7% to approximately 15%, approximately 0.8% to approximately 14%, approximately 0.9% to approximately 12%, approximately 1% to approximately 10% w/w, w/v or v/v.
- the concentration of one or more compounds of the invention is in the range from approximately 0.001% to approximately 10%, approximately 0.01% to approximately 5%, approximately 0.02% to approximately 4.5%, approximately 0.03% to approximately 4%, approximately 0.04% to approximately 3.5%, approximately 0.05% to approximately 3%, approximately 0.06% to approximately 2.5%, approximately 0.07% to approximately 2%, approximately 0.08% to approximately 1.5%, approximately 0.09% to approximately 1%, approximately 0.1% to approximately 0.9% w/w, w/v or v/v.
- the amount of one or more compounds of the invention is equal to or less than 10 g, 9.5 g, 9.0 g, 8.5 g, 8.0 g, 7.5 g, 7.0 g, 6.5 g, 6.0 g, 5.5 g, 5.0 g, 4.5 g, 4.0 g, 3.5 g, 3.0 g, 2.5 g, 2.0 g, 1.5 g, 1.0 g, 0.95 g, 0.9 g, 0.85 g, 0.8 g, 0.75 g, 0.7 g, 0.65 g, 0.6 g, 0.55 g, 0.5 g, 0.45 g, 0.4 g, 0.35 g, 0.3 g, 0.25 g, 0.2 g, 0.15 g, 0.1 g, 0.09 g, 0.08 g, 0.07 g, 0.06 g, 0.05 g, 0.04 g, 0.03 g, 0.02 g, 0.01 g, 0.009
- the amount of one or more compounds of the invention is more than 0.0001 g, 0.0002 g, 0.0003 g, 0.0004 g, 0.0005 g, 0.0006 g, 0.0007 g, 0.0008 g, 0.0009 g, 0.001 g, 0.0015 g, 0.002 g, 0.0025 g, 0.003 g, 0.0035 g, 0.004 g, 0.0045 g, 0.005 g, 0.0055 g, 0.006 g, 0.0065 g, 0.007 g, 0.0075 g, 0.008 g, 0.0085 g, 0.009 g, 0.0095 g, 0.01 g, 0.015 g, 0.02 g, 0.025 g, 0.03 g, 0.035 g, 0.04 g, 0.045 g, 0.05 g, 0.055 g, 0.06 g, 0.065 g, 0.07 g,
- the amount of one or more compounds of the invention is in the range of 0.0001-10 g, 0.0005-9 g, 0.001-8 g, 0.005-7 g, 0.01-6 g, 0.05-5 g, 0.1-4 g, 0.5-4 g, or 1-3 g.
- the compounds according to the invention are effective over a wide dosage range. For example, in the treatment of adult humans, dosages from 0.01 to 1000 mg, from 0.5 to 100 mg, from 1 to 50 mg per day, and from 5 to 40 mg per day are examples of dosages that may be used. An exemplary dosage is 10 to 30 mg per day.
- a pharmaceutical composition of the invention typically contains an active ingredient (e.g., a compound of the disclosure) of the present invention or a pharmaceutically acceptable salt and/or coordination complex thereof, and one or more pharmaceutically acceptable excipients, carriers, including but not limited to inert solid diluents and fillers, diluents, sterile aqueous solution and various organic solvents, permeation enhancers, solubilizers and adjuvants.
- active ingredient e.g., a compound of the disclosure
- a pharmaceutically acceptable salt and/or coordination complex thereof e.g., a pharmaceutically acceptable excipients, carriers, including but not limited to inert solid diluents and fillers, diluents, sterile aqueous solution and various organic solvents, permeation enhancers, solubilizers and adjuvants.
- compositions for oral administration [0342] In some embodiments, the invention provides a pharmaceutical composition for oral administration containing a compound of the invention, and a pharmaceutical excipient suitable for oral administration. [0343] In some embodiments, the invention provides a solid pharmaceutical composition for oral administration containing: (i) an effective amount of a compound of the invention; optionally (ii) an effective amount of a second agent; and (iii) a pharmaceutical excipient suitable for oral administration. In some embodiments, the composition further contains: (iv) an effective amount of a third agent. [0344] In some embodiments, the pharmaceutical composition may be a liquid pharmaceutical composition suitable for oral consumption.
- compositions of the invention suitable for oral administration can be presented as discrete dosage forms, such as capsules, cachets, or tablets, or liquids or aerosol sprays each containing a predetermined amount of an active ingredient as a powder or in granules, a solution, or a suspension in an aqueous or non-aqueous liquid, an oil-in- water emulsion, or a water-in-oil liquid emulsion.
- dosage forms can be prepared by any of the methods of pharmacy, but all methods include the step of bringing the active ingredient into association with the carrier, which constitutes one or more necessary ingredients.
- compositions are prepared by uniformly and intimately admixing the active ingredient with liquid carriers or finely divided solid carriers or both, and then, if necessary, shaping the product into the desired presentation.
- a tablet can be prepared by compression or molding, optionally with one or more accessory ingredients.
- Compressed tablets can be prepared by compressing in a suitable machine the active ingredient in a free- flowing form such as powder or granules, optionally mixed with an excipient such as, but not limited to, a binder, a lubricant, an inert diluent, and/or a surface active or dispersing agent.
- Molded tablets can be made by molding in a suitable machine a mixture of the powdered compound moistened with an inert liquid diluent.
- This invention further encompasses anhydrous pharmaceutical compositions and dosage forms comprising an active ingredient, since water can facilitate the degradation of some compounds.
- water may be added (e.g., 5%) in the pharmaceutical arts as a means of simulating long-term storage in order to determine characteristics such as shelf- life or the stability of formulations over time.
- Anhydrous pharmaceutical compositions and dosage forms of the invention can be prepared using anhydrous or low moisture containing ingredients and low moisture or low humidity conditions.
- compositions and dosage forms of the invention which contain lactose can be made anhydrous if substantial contact with moisture and/or humidity during manufacturing, packaging, and/or storage is expected.
- An anhydrous pharmaceutical composition may be prepared and stored such that its anhydrous nature is maintained. Accordingly, anhydrous compositions may be packaged using materials known to prevent exposure to water such that they can be included in suitable formulary kits. Examples of suitable packaging include, but are not limited to, hermetically sealed foils, plastic or the like, unit dose containers, blister packs, and strip packs.
- An active ingredient can be combined in an intimate admixture with a pharmaceutical carrier according to conventional pharmaceutical compounding techniques.
- the carrier can take a wide variety of forms depending on the form of preparation desired for administration.
- any of the usual pharmaceutical media can be employed as carriers, such as, for example, water, glycols, oils, alcohols, flavoring agents, preservatives, coloring agents, and the like in the case of oral liquid preparations (such as suspensions, solutions, and elixirs) or aerosols; or carriers such as starches, sugars, micro-crystalline cellulose, diluents, granulating agents, lubricants, binders, and disintegrating agents can be used in the case of oral solid preparations, in some embodiments without employing the use of lactose.
- suitable carriers include powders, capsules, and tablets, with the solid oral preparations.
- Binders suitable for use in pharmaceutical compositions and dosage forms include, but are not limited to, corn starch, potato starch, or other starches, gelatin, natural and synthetic gums such as acacia, sodium alginate, alginic acid, other alginates, powdered tragacanth, guar gum, cellulose and its derivatives (e.g., ethyl cellulose, cellulose acetate, carboxymethyl cellulose calcium, sodium carboxymethyl cellulose), polyvinyl pyrrolidone, methyl cellulose, pre-gelatinized starch, hydroxypropyl methyl cellulose, microcrystalline cellulose, and mixtures thereof.
- natural and synthetic gums such as acacia, sodium alginate, alginic acid, other alginates, powdered tragacanth, guar gum, cellulose and its derivatives (e.g., ethyl cellulose, cellulose acetate, carboxymethyl cellulose calcium, sodium carboxymethyl cellulose), polyvinyl pyrrol
- suitable fillers for use in the pharmaceutical compositions and dosage forms disclosed herein include, but are not limited to, talc, calcium carbonate (e.g., granules or powder), microcrystalline cellulose, powdered cellulose, dextrates, kaolin, mannitol, silicic acid, sorbitol, starch, pre-gelatinized starch, and mixtures thereof.
- Disintegrants may be used in the compositions of the invention to provide tablets that disintegrate when exposed to an aqueous environment. Too much of a disintegrant may produce tablets which may disintegrate in the bottle. Too little may be insufficient for disintegration to occur and may thus alter the rate and extent of release of the active ingredient(s) from the dosage form.
- a sufficient amount of disintegrant that is neither too little nor too much to detrimentally alter the release of the active ingredient(s) may be used to form the dosage forms of the compounds disclosed herein.
- the amount of disintegrant used may vary based upon the type of formulation and mode of administration, and may be readily discernible to those of ordinary skill in the art. About 0.5 to about 15 weight percent of disintegrant, or about 1 to about 5 weight percent of disintegrant, may be used in the pharmaceutical composition.
- Disintegrants that can be used to form pharmaceutical compositions and dosage forms of the invention include, but are not limited to, agar-agar, alginic acid, calcium carbonate, microcrystalline cellulose, croscarmellose sodium, crospovidone, polacrilin potassium, sodium starch glycolate, potato or tapioca starch, other starches, pre-gelatinized starch, other starches, clays, other algins, other celluloses, gums or mixtures thereof.
- Lubricants which can be used to form pharmaceutical compositions and dosage forms of the invention include, but are not limited to, calcium stearate, magnesium stearate, mineral oil, light mineral oil, glycerin, sorbitol, mannitol, polyethylene glycol, other glycols, stearic acid, sodium lauryl sulfate, talc, hydrogenated vegetable oil (e.g., peanut oil, cottonseed oil, sunflower oil, sesame oil, olive oil, corn oil, and soybean oil), zinc stearate, ethyl oleate, ethyl laureate, agar, or mixtures thereof.
- Additional lubricants include, for example, a syloid silica gel, a coagulated aerosol of synthetic silica, or mixtures thereof.
- a lubricant can optionally be added, in an amount of less than about 1 weight percent of the pharmaceutical composition.
- the active ingredient therein may be combined with various sweetening or flavoring agents, coloring matter or dyes and, if so desired, emulsifying and/or suspending agents, together with such diluents as water, ethanol, propylene glycol, glycerin and various combinations thereof.
- the tablets can be uncoated or coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period.
- a time delay material such as glyceryl monostearate or glyceryl distearate can be employed.
- Formulations for oral use can also be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate or kaolin, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example, peanut oil, liquid paraffin or olive oil.
- Surfactant which can be used to form pharmaceutical compositions and dosage forms of the invention include, but are not limited to, hydrophilic surfactants, lipophilic surfactants, and mixtures thereof. That is, a mixture of hydrophilic surfactants may be employed, a mixture of lipophilic surfactants may be employed, or a mixture of at least one hydrophilic surfactant and at least one lipophilic surfactant may be employed.
- a suitable hydrophilic surfactant may generally have an HLB value of at least 10, while suitable lipophilic surfactants may generally have an HLB value of or less than about 10.
- HLB hydrophilic-lipophilic balance
- Surfactants with lower HLB values are more lipophilic or hydrophobic, and have greater solubility in oils, while surfactants with higher HLB values are more hydrophilic, and have greater solubility in aqueous solutions.
- Hydrophilic surfactants are generally considered to be those compounds having an HLB value greater than about 10, as well as anionic, cationic, or zwitterionic compounds for which the HLB scale is not generally applicable.
- lipophilic (e.g., hydrophobic) surfactants are compounds having an HLB value equal to or less than about 10.
- Hydrophilic surfactants may be either ionic or non-ionic. Suitable ionic surfactants include, but are not limited to, alkylammonium salts; fusidic acid salts; fatty acid derivatives of amino acids, oligopeptides, and polypeptides; glyceride derivatives of amino acids, oligopeptides, and polypeptides; lecithins and hydrogenated lecithins; lysolecithins and hydrogenated lysolecithins; phospholipids and derivatives thereof; lysophospholipids and derivatives thereof; carnitine fatty acid ester salts; salts of alkylsulfates; fatty acid salts; sodium docusate; acyl lactylates; mono- and di-acetylated tartaric acid esters of mono- and di-
- ionic surfactants include, by way of example: lecithins, lysolecithin, phospholipids, lysophospholipids and derivatives thereof; carnitine fatty acid ester salts; salts of alkylsulfates; fatty acid salts; sodium docusate; acylactylates; mono- and di-acetylated tartaric acid esters of mono- and di-glycerides; succinylated mono- and di-glycerides; citric acid esters of mono- and di-glycerides; and mixtures thereof.
- Ionic surfactants may be the ionized forms of lecithin, lysolecithin, phosphatidylcholine, phosphatidylethanolamine, phosphatidylglycerol, phosphatidic acid, phosphatidylserine, lysophosphatidylcholine, lysophosphatidylethanolamine, lysophosphatidylglycerol, lysophosphatidic acid, lysophosphatidylserine, PEG- phosphatidylethanolamine, PVP -phosphatidylethanolamine, lactylic esters of fatty acids, stearoyl-2-lactylate, stearoyl lactylate, succinylated monoglycerides, mono/diacetylated tartaric acid esters of mono/diglycerides, citric acid esters of mono/diglycerides, cholylsarcosine, caproate, capry
- Hydrophilic non-ionic surfactants may include, but are not limited to, alkylglucosides; alkylmaltosides; alkylthioglucosides; lauryl macrogolglycerides; polyoxyalkylene alkyl ethers such as polyethylene glycol alkyl ethers; polyoxyalkylene alkylphenols such as polyethylene glycol alkyl phenols; polyoxyalkylene alkyl phenol fatty acid esters such as polyethylene glycol fatty acids monoesters and polyethylene glycol fatty acids diesters; polyethylene glycol glycerol fatty acid esters; polyglycerol fatty acid esters; polyoxyalkylene sorbitan fatty acid esters such as polyethylene glycol sorbitan fatty acid esters; hydrophilic transesterification products of a polyol with at least one member of the group consisting of glycerides, vegetable oils, hydrogenated vegetable oils, fatty acids, and sterols; polyoxyethylene stea,
- the polyol may be glycerol, ethylene glycol, polyethylene glycol, sorbitol, propylene glycol, pentaerythritol, or a saccharide.
- Other hydrophilic-non-ionic surfactants include, without limitation, PEG- 10 laurate, PEG- 12 laurate, PEG-20 laurate, PEG-32 laurate, PEG-32 dilaurate, PEG- 12 oleate, PEG- 15 oleate, PEG-20 oleate, PEG-20 dioleate, PEG-32 oleate, PEG-200 oleate, PEG-400 oleate, PEG- 15 stearate, PEG-32 distearate, PEG-40 stearate, PEG- 100 stearate, PEG-20 dilaurate, PEG-25 glyceryl trioleate, PEG-32 dioleate, PEG-20 glyceryl laurate, PEG-30
- Suitable lipophilic surfactants include, by way of example only: fatty alcohols; glycerol fatty acid esters; acetylated glycerol fatty acid esters; lower alcohol fatty acids esters; propylene glycol fatty acid esters; sorbitan fatty acid esters; polyethylene glycol sorbitan fatty acid esters; sterols and sterol derivatives; polyoxyethylated sterols and sterol derivatives; polyethylene glycol alkyl ethers; sugar esters; sugar ethers; lactic acid derivatives of mono- and di-glycerides; hydrophobic transesterification products of a polyol with at least one member of the group consisting of glycerides, vegetable oils, hydrogenated vegetable oils, fatty acids and sterols; oil-soluble vitamins/vitamin derivatives; and mixtures thereof.
- preferred lipophilic surfactants include glycerol fatty acid esters, propylene glycol fatty acid esters, and mixtures thereof, or are hydrophobic transesterification products of a polyol with at least one member of the group consisting of vegetable oils, hydrogenated vegetable oils, and triglycerides.
- the composition may include a solubilizer to ensure good solubilization and/or dissolution of the compound of the present invention and to minimize precipitation of the compound of the present invention. This can be especially important for compositions for non-oral use, e.g., compositions for injection.
- a solubilizer may also be added to increase the solubility of the hydrophilic drug and/or other components, such as surfactants, or to maintain the composition as a stable or homogeneous solution or dispersion.
- suitable solubilizers include, but are not limited to, the following: alcohols and polyols, such as ethanol, isopropanol, butanol, benzyl alcohol, ethylene glycol, propylene glycol, butanediols and isomers thereof, glycerol, pentaerythritol, sorbitol, mannitol, transcutol, dimethyl isosorbide, polyethylene glycol, polypropylene glycol, polyvinylalcohol, hydroxypropyl methylcellulose and other cellulose derivatives, cyclodextrins and cyclodextrin derivatives; ethers of polyethylene glycols having an average molecular weight of about 200 to about 6000, such as te
- solubilizers may also be used. Examples include, but not limited to, triacetin, triethylcitrate, ethyl oleate, ethyl caprylate, dimethylacetamide, N- methylpyrrolidone, N-hydroxyethylpyrrolidone, polyvinylpyrrolidone, hydroxypropyl methylcellulose, hydroxypropyl cyclodextrins, ethanol, polyethylene glycol 200-100, glycofurol, transcutol, propylene glycol, and dimethyl isosorbide.
- solubilizers include sorbitol, glycerol, triacetin, ethyl alcohol, PEG-400, glycofurol and propylene glycol.
- the amount of solubilizer that can be included is not particularly limited.
- the amount of a given solubilizer may be limited to a bioacceptable amount, which may be readily determined by one of skill in the art.
- the solubilizer can be in a weight ratio of 10%, 25%o, 50%), 100%o, or up to about 200%> by weight, based on the combined weight of the drug, and other excipients. If desired, very small amounts of solubilizer may also be used, such as 5%>, 2%>, 1%) or even less. Typically, the solubilizer may be present in an amount of about 1%> to about 100%, more typically about 5%> to about 25%> by weight.
- the composition can further include one or more pharmaceutically acceptable additives and excipients.
- additives and excipients include, without limitation, detackifiers, anti-foaming agents, buffering agents, polymers, antioxidants, preservatives, chelating agents, viscomodulators, tonicifiers, flavorants, colorants, odorants, opacifiers, suspending agents, binders, fillers, plasticizers, lubricants, and mixtures thereof.
- detackifiers anti-foaming agents
- buffering agents buffering agents
- polymers antioxidants
- preservatives chelating agents
- viscomodulators tonicifiers
- flavorants colorants
- odorants opacifiers
- suspending agents binders
- fillers fillers
- plasticizers plasticizers
- lubricants lubricants
- Examples of pharmaceutically acceptable bases include amino acids, amino acid esters, ammonium hydroxide, potassium hydroxide, sodium hydroxide, sodium hydrogen carbonate, aluminum hydroxide, calcium carbonate, magnesium hydroxide, magnesium aluminum silicate, synthetic aluminum silicate, synthetic hydrocalcite, magnesium aluminum hydroxide, diisopropylethylamine, ethanolamine, ethylenediamine, triethanolamine, triethylamine, triisopropanolamine, trimethylamine, tris(hydroxymethyl)aminomethane (TRIS) and the like.
- bases that are salts of a pharmaceutically acceptable acid, such as acetic acid, acrylic acid, adipic acid, alginic acid, alkanesulfonic acid, amino acids, ascorbic acid, benzoic acid, boric acid, butyric acid, carbonic acid, citric acid, fatty acids, formic acid, fumaric acid, gluconic acid, hydroquinosulfonic acid, isoascorbic acid, lactic acid, maleic acid, oxalic acid, para- bromophenylsulfonic acid, propionic acid, p-toluenesulfonic acid, salicylic acid, stearic acid, succinic acid, tannic acid, tartaric acid, thioglycolic acid, toluenesulfonic acid, uric acid, and the like.
- a pharmaceutically acceptable acid such as acetic acid, acrylic acid, adipic acid, alginic acid, alkanesulfonic acid, amino acids
- Salts of polyprotic acids such as sodium phosphate, disodium hydrogen phosphate, and sodium dihydrogen phosphate can also be used.
- the cation can be any convenient and pharmaceutically acceptable cation, such as ammonium, alkali metals, alkaline earth metals, and the like.
- Example may include, but not limited to, sodium, potassium, lithium, magnesium, calcium and ammonium.
- Suitable acids are pharmaceutically acceptable organic or inorganic acids. Examples of suitable inorganic acids include hydrochloric acid, hydrobromic acid, hydriodic acid, sulfuric acid, nitric acid, boric acid, phosphoric acid, and the like.
- suitable organic acids include acetic acid, acrylic acid, adipic acid, alginic acid, alkanesulfonic acids, amino acids, ascorbic acid, benzoic acid, boric acid, butyric acid, carbonic acid, citric acid, fatty acids, formic acid, fumaric acid, gluconic acid, hydroquinosulfonic acid, isoascorbic acid, lactic acid, maleic acid, methanesulfonic acid, oxalic acid, para-bromophenylsulfonic acid, propionic acid, p-toluenesulfonic acid, salicylic acid, stearic acid, succinic acid, tannic acid, tartaric acid, thioglycolic acid, toluenesulfonic acid, uric acid and the like.
- compositions for injection [0369]
- the invention provides a pharmaceutical composition for injection containing a compound of the present invention and a pharmaceutical excipient suitable for injection. Components and amounts of agents in the compositions are as described herein.
- the forms in which the novel compositions of the present invention may be incorporated for administration by injection include aqueous or oil suspensions, or emulsions, with sesame oil, corn oil, cottonseed oil, or peanut oil, as well as elixirs, mannitol, dextrose, or a sterile aqueous solution, and similar pharmaceutical vehicles.
- Aqueous solutions in saline are also conventionally used for injection.
- Ethanol, glycerol, propylene glycol, liquid polyethylene glycol, and the like (and suitable mixtures thereof), cyclodextrin derivatives, and vegetable oils may also be employed.
- the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, for the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
- Sterile injectable solutions are prepared by incorporating the compound of the present invention in the required amount in the appropriate solvent with various other ingredients as enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- certain desirable methods of preparation are vacuum-drying and freeze- drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Pharmaceutical compositions for topical (e.g. transdermal) delivery are prepared by incorporating the compound of the present invention in the required amount in the appropriate solvent with various other ingredients as enumerated above, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- certain desirable methods of preparation are vacuum-drying and freeze
- the invention provides a pharmaceutical composition for transdermal delivery containing a compound of the present invention and a pharmaceutical excipient suitable for transdermal delivery.
- Compositions of the present invention can be formulated into preparations in solid, semisolid, or liquid forms suitable for local or topical administration, such as gels, water soluble jellies, creams, lotions, suspensions, foams, powders, slurries, ointments, solutions, oils, pastes, suppositories, sprays, emulsions, saline solutions, dimethylsulfoxide (DMSO)- based solutions.
- DMSO dimethylsulfoxide
- carriers with higher densities are capable of providing an area with a prolonged exposure to the active ingredients.
- compositions may provide more immediate exposure of the active ingredient to the chosen area.
- the pharmaceutical compositions also may comprise suitable solid or gel phase carriers or excipients, which are compounds that allow increased penetration of, or assist in the delivery of, therapeutic molecules across the stratum corneum permeability barrier of the skin. There are many of these penetration- enhancing molecules known to those trained in the art of topical formulation.
- humectants e.g., urea
- glycols e.g., propylene glycol
- alcohols e.g., ethanol
- fatty acids e.g., oleic acid
- surfactants e.g., isopropyl myristate and sodium lauryl sulfate
- pyrrolidones e.g., isopropyl myristate and sodium lauryl sulfate
- pyrrolidones e.glycerol monolaurate, sulfoxides, terpenes (e.g., menthol)
- amines amides, alkanes, alkanols, water, calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols.
- transdermal delivery devices Such transdermal patches may be used to provide continuous or discontinuous infusion of a compound of the present invention in controlled amounts, either with or without another agent.
- transdermal patches for the delivery of pharmaceutical agents is well known in the art. See, e.g., U.S. Pat. Nos.5,023,252, 4,992,445 and 5,001,139. Such patches may be constructed for continuous, pulsatile, or on demand delivery of pharmaceutical agents. Pharmaceutical compositions for inhalation.
- compositions for inhalation or insufflation include solutions and suspensions in pharmaceutically acceptable, aqueous or organic solvents, or mixtures thereof, and powders.
- the liquid or solid compositions may contain suitable pharmaceutically acceptable excipients as described supra.
- the compositions are administered by the oral or nasal respiratory route for local or systemic effect.
- Compositions in preferably pharmaceutically acceptable solvents may be nebulized by use of inert gases. Nebulized solutions may be inhaled directly from the nebulizing device or the nebulizing device may be attached to a face mask tent, or intermittent positive pressure breathing machine. Solution, suspension, or powder compositions may be administered, preferably orally or nasally, from devices that deliver the formulation in an appropriate manner. Other pharmaceutical compositions.
- compositions may also be prepared from compositions described herein and one or more pharmaceutically acceptable excipients suitable for sublingual, buccal, rectal, intraosseous, intraocular, intranasal, epidural, or intraspinal administration. Preparations for such pharmaceutical compositions are well-known in the art.
- Administration of the compounds or pharmaceutical composition of the present invention can be effected by any method that enables delivery of the compounds to the site of action. These methods include oral routes, intraduodenal routes, parenteral injection (including intravenous, intraarterial, subcutaneous, intramuscular, intravascular, intraperitoneal or infusion), topical (e.g. transdermal application), rectal administration, via local delivery by catheter or stent or through inhalation. Compounds can also be administered intraadiposally or intrathecally. [0382] In some embodiments, the compounds or pharmaceutical composition of the present invention are administered by intravenous injection.
- an effective dosage is in the range of about 0.001 to about 100 mg per kg body weight per day, preferably about 1 to about 35 mg/kg/day, in single or divided doses. For a 70 kg human, this would amount to about 0.05 to 7 g/day, preferably about 0.05 to about 2.5 g/day. In some instances, dosage levels below the lower limit of the aforesaid range may be more than adequate, while in other cases still larger doses may be employed without causing any harmful side effect, e.g.
- a compound of the invention is administered in a single dose. Typically, such administration will be by injection, e.g., intravenous injection, in order to introduce the agent quickly. However, other routes may be used as appropriate. A single dose of a compound of the invention may also be used for treatment of an acute condition.
- a compound of the invention is administered in multiple doses. Dosing may be about once, twice, three times, four times, five times, six times, or more than six times per day. Dosing may be about once a month, once every two weeks, once a week, or once every other day.
- a compound of the invention and another agent are administered together about once per day to about 6 times per day.
- the administration of a compound of the invention and an agent continues for less than about 7 days.
- the administration continues for more than about 6, 10, 14, 28 days, two months, six months, or one year. In some cases, continuous dosing is achieved and maintained as long as necessary.
- Administration of the compounds of the invention may continue as long as necessary.
- a compound of the invention is administered for more than 1, 2, 3, 4, 5, 6, 7, 14, or 28 days.
- a compound of the invention is administered for less than 28, 14, 7, 6, 5, 4, 3, 2, or 1 day.
- a compound of the invention is administered chronically on an ongoing basis, e.g., for the treatment of chronic effects.
- An effective amount of a compound of the invention may be administered in either single or multiple doses by any of the accepted modes of administration of agents having similar utilities, including rectal, buccal, intranasal and transdermal routes, by intra-arterial injection, intravenously, intraperitoneally, parenterally, intramuscularly, subcutaneously, orally, topically, or as an inhalant.
- the compositions of the invention may also be delivered via an impregnated or coated device such as a stent, for example, or an artery-inserted cylindrical polymer.
- Such a method of administration may, for example, aid in the prevention or amelioration of restenosis following procedures such as balloon angioplasty.
- compounds of the invention may slow or inhibit the migration and proliferation of smooth muscle cells in the arterial wall which contribute to restenosis.
- a compound of the invention may be administered, for example, by local delivery from the struts of a stent, from a stent graft, from grafts, or from the cover or sheath of a stent.
- a compound of the invention is admixed with a matrix.
- a matrix may be a polymeric matrix, and may serve to bond the compound to the stent.
- Polymeric matrices suitable for such use include, for example, lactone-based polyesters or copolyesters such as polylactide, polycaprolactonglycolide, polyorthoesters, polyanhydrides, polyaminoacids, polysaccharides, polyphosphazenes, poly (ether-ester) copolymers (e.g. PEO-PLLA); polydimethylsiloxane, poly(ethylene-vinylacetate), acrylate-based polymers or copolymers (e.g. polyhydroxyethyl methylmethacrylate, polyvinyl pyrrolidinone), fluorinated polymers such as polytetrafluoroethylene and cellulose esters.
- lactone-based polyesters or copolyesters such as polylactide, polycaprolactonglycolide, polyorthoesters, polyanhydrides, polyaminoacids, polysaccharides, polyphosphazenes, poly (ether-ester) copo
- Suitable matrices may be nondegrading or may degrade with time, releasing the compound or compounds.
- Compounds of the invention may be applied to the surface of the stent by various methods such as dip/spin coating, spray coating, dip-coating, and/or brush-coating.
- the compounds may be applied in a solvent and the solvent may be allowed to evaporate, thus forming a layer of compound onto the stent.
- the compound may be located in the body of the stent or graft, for example in microchannels or micropores. When implanted, the compound diffuses out of the body of the stent to contact the arterial wall.
- Such stents may be prepared by dipping a stent manufactured to contain such micropores or microchannels into a solution of the compound of the invention in a suitable solvent, followed by evaporation of the solvent. Excess drug on the surface of the stent may be removed via an additional brief solvent wash.
- compounds of the invention may be covalently linked to a stent or graft.
- a covalent linker may be used which degrades in vivo, leading to the release of the compound of the invention. Any bio-labile linkage may be used for such a purpose, such as ester, amide or anhydride linkages.
- Compounds of the invention may additionally be administered intravascularly from a balloon used during angioplasty.
- Extravascular administration of the compounds via the pericard or via advential application of formulations of the invention may also be performed to decrease restenosis.
- a variety of stent devices which may be used as described are disclosed, for example, in the following references, all of which are hereby incorporated by reference: U.S. Pat. No.5451233; U.S. Pat. No.5040548; U.S. Pat. No.5061273; U.S. Pat. No. 5496346; U.S. Pat. No.5292331; U.S. Pat. No.5674278; U.S. Pat. No.3657744; U.S. Pat. No.4739762; U.S. Pat. No.5195984; U.S.
- the compounds of the invention may be administered in dosages. It is known in the art that due to intersubject variability in compound pharmacokinetics, individualization of dosing regimen is necessary for optimal therapy. Dosing for a compound of the invention may be found by routine experimentation in light of the instant disclosure.
- a compound of the invention is administered in a composition that comprises one or more agents, and the agent has a shorter half- life than the compound of the invention unit dose forms of the agent and the compound of the invention may be adjusted accordingly.
- the subject pharmaceutical composition may, for example, be in a form suitable for oral administration as a tablet, capsule, pill, powder, sustained release formulations, solution, suspension, for parenteral injection as a sterile solution, suspension or emulsion, for topical administration as an ointment or cream or for rectal administration as a suppository.
- the pharmaceutical composition may be in unit dosage forms suitable for single administration of precise dosages.
- the pharmaceutical composition will include a conventional pharmaceutical carrier or excipient and a compound according to the invention as an active ingredient. In addition, it may include other medicinal or pharmaceutical agents, carriers, adjuvants, etc.
- Exemplary parenteral administration forms include solutions or suspensions of active compound in sterile aqueous solutions, for example, aqueous propylene glycol or dextrose solutions. Such dosage forms can be suitably buffered, if desired.
- Methods of Use [0392] The method typically comprises administering to a subject a therapeutically effective amount of a compound of the invention.
- the therapeutically effective amount of the subject combination of compounds may vary depending upon the intended application (in vitro or in vivo), or the subject and disease condition being treated, e.g., the weight and age of the subject, the severity of the disease condition, the manner of administration and the like, which can readily be determined by one of ordinary skill in the art.
- the term also applies to a dose that will induce a particular response in target cells, e.g., reduction of proliferation or downregulation of activity of a target protein.
- the specific dose will vary depending on the particular compounds chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, timing of administration, the tissue to which it is administered, and the physical delivery system in which it is carried.
- the present invention provides a pharmaceutical composition comprising a compound of bispecific formula, or pharmaceutically acceptable salt thereof.
- the present invention provides a pharmaceutical composition comprising a compound of bispecific formula for use in degrading a target protein in a cell.
- a method of degrading a target protein comprising administering to a cell therapeutically effective amount of a bispecific compound, or pharmaceutically acceptable salt, wherein the compound is effective for degrading the target protein.
- the present invention provides a pharmaceutical composition comprising a compound of bispecific formula, for use in treating or preventing of a disease or disorder in which SMARCA2 and/or SMARCA4 plays a role.
- the present invention provides a pharmaceutical composition comprising a compound of bispecific formula, for use in treating or preventing of a disease or disorder in which SWI/SNF mutations plays a role.
- target proteins are SMARCA2, SMARCA4 and/or PB1.
- target protein complex is SWI/SNF in a cell.
- diseases or disorders dependent on SMARCA2 or SMARCA4 include cancers.
- diseases or disorders dependent on SWI/SNF complex include cancers.
- Exemplary cancers which may be treated by the present compounds either alone or in combination with at least one additional anti-cancer agent include squamous-cell carcinoma, basal cell carcinoma, adenocarcinoma, hepatocellular carcinomas, and renal cell carcinomas, cancer of the bladder, bowel, breast, cervix, colon, esophagus, head, kidney, liver, lung, neck, ovary, pancreas, prostate, and stomach; leukemias; benign and malignant lymphomas, particularly Burkitt's lymphoma and Non-Hodgkin's lymphoma; benign and malignant melanomas; myeloproliferative diseases; sarcomas, including Ewing's sarcoma, hemangiosarcoma, Kaposi's sarcoma, liposarcoma, myosarcomas, peripheral neuroepithelioma, synovial sarcoma, gliomas, astrocytomas, oli
- T-lineage Acute lymphoblastic Leukemia T-ALL
- T-LL T- lineage lymphoblastic Lymphoma
- Peripheral T-cell lymphoma Adult T-cell Leukemia, Pre-B ALL, Pre-B Lymphomas, Large B-cell Lymphoma, Burkitts Lymphoma, B-cell ALL, Philadelphia chromosome positive ALL and Philadelphia chromosome positive CML.
- the cancer is a SMARCA2 and/or SMARAC 4 - dependent cancer.
- the cancer harbors a SMARCA4 mutation.
- the present invention provides a pharmaceutical composition comprising a compound of bispecific formula for use in the diseases or disorders dependent upon SMARCA2 and/or SMARCA4 is cancer.
- Compounds of the disclosure, as well as pharmaceutical compositions comprising them can be administered to treat any of the described diseases, alone or in combination with a medical therapy.
- Medical therapies include, for example, surgery and radiotherapy (e.g., gamma-radiation, neutron beam radiotherapy, electron beam radiotherapy, proton therapy, brachytherapy, systemic radioactive isotopes).
- compounds of the disclosure, as well as pharmaceutical compositions comprising them can be administered to treat any of the described diseases, alone or in combination with one or more other agents.
- the compounds of the disclosure, as well as pharmaceutical compositions comprising them can be administered in combination with agonists of nuclear receptors agents.
- the compounds of the disclosure, as well as pharmaceutical compositions comprising them can be administered in combination with antagonists of nuclear receptors agents.
- the compounds of the disclosure, as well as pharmaceutical compositions comprising them can be administered in combination with an anti- proliferative agent.
- Combination Therapies [0411] For treating cancer and other proliferative diseases, the compounds of the invention can be used in combination with chemotherapeutic agents, agonists or antagonists of nuclear receptors, or other anti-proliferative agents.
- the compounds of the invention can also be used in combination with a medical therapy such as surgery or radiotherapy, e.g., gamma-radiation, neutron beam radiotherapy, electron beam radiotherapy, proton therapy, brachytherapy, and systemic radioactive isotopes.
- a medical therapy such as surgery or radiotherapy, e.g., gamma-radiation, neutron beam radiotherapy, electron beam radiotherapy, proton therapy, brachytherapy, and systemic radioactive isotopes.
- chemotherapeutic agents include any of: abarelix, aldesleukin, alemtuzumab, alitretinoin, allopurinol, all-trans retinoic acid, altretamine, anastrozole, arsenic trioxide, asparaginase, azacitidine, bendamustine, bevacizumab, bexarotene, bleomycin, bortezombi, bortezomib, busulfan intravenous, busulfan oral, calusterone, capecitabine, carboplatin, carmustine, cetuximab, chlorambucil, cisplatin, cladribine, clofarabine, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, dalteparin sodium, dasatinib, daunorubicin, decitabine, denileukin, denileukin difti
- the compounds of the invention can be used in combination with a therapeutic agent that targets an epigenetic regulator.
- epigenetic regulators include bromodomain inhibitors, the histone lysine methyltransferase inhibitors, histone arginine methyl transferase inhibitors, histone demethylase inhibitors, histone deacetylase inhibitors, histone acetylase inhibitors, and DNA methyltransferase inhibitors.
- Histone deacetylase inhibitors include, e.g., vorinostat.
- Histone arginine methyl transferase inhibitors include inhibitors of protein arginine methyltransferases (PRMTs) such as PRMT5, PRMT1 and PRMT4.
- PRMTs protein arginine methyltransferases
- DNA methyltransferase inhibitors include inhibitors of DNMT1 and DNMT3.
- the compounds of the invention can be used in combination with targeted therapies, including JAK kinase inhibitors (e.g. Ruxolitinib), PI3 kinase inhibitors including PI3K-delta selective and broad spectrum PI3K inhibitors, MEK inhibitors, Cyclin Dependent kinase inhibitors, including CDK4/6 inhibitors and CDK9 inhibitors, BRAF inhibitors, mTOR inhibitors, proteasome inhibitors (e.g. Bortezomib, Carfilzomib), HDAC inhibitors (e.g.
- the inhibitor of an immune checkpoint molecule is an inhibitor of PD-1, e.g., an anti-PD-1 monoclonal antibody.
- the anti- PD-1 monoclonal antibody is nivolumab, pembrolizumab (also known as MK-3475), or PDR001. In some embodiments, the anti-PD-1 monoclonal antibody is nivolumab or pembrolizumab. In some embodiments, the anti-PD1 antibody is pembrolizumab. In some embodiments, the inhibitor of an immune checkpoint molecule is an inhibitor of PD-L1, e.g., an anti-PD-L1 monoclonal antibody. In some embodiments, the anti-PD-L1 monoclonal antibody is atezolizumab, durvalumab, or BMS-935559.
- the inhibitor of an immune checkpoint molecule is an inhibitor of CTLA-4, e.g., an anti- CTLA-4 antibody.
- the anti-CTLA-4 antibody is ipilimumab.
- the agent is an alkylating agent, a proteasome inhibitor, a corticosteroid, or an immunomodulatory agent. Examples of an alkylating agent include cyclophosphamide (CY), melphalan (MEL), and bendamustine.
- the proteasome inhibitor is carfilzomib.
- the corticosteroid is dexamethasone (DEX).
- the immunomodulatory agent is lenalidomide (LEN) or pomalidomide (POM).
- Compounds of the present invention include, but are not limited to, those shown in Table 1. Table 1.
- Scheme A Compounds of Formula (IA) can be synthesized using, for example, the sequences shown in Scheme A.
- the following intramolecular SNAr reaction or amide formation can afford cyclized product A-4.
- a protecting group to facilitate organometallic addition of Ar via, e.g., Suzuki conditions (e.g., in the presence of a palladium catalyst, such as but not limited to tetrakis(triphenylphosphine)palladium(0) or [1,1′- bis(diphenylphosphino)ferrocene]dichloropalladium (II), complex with dichloromethane and a base (e.g., a carbonate base)) using the appropriate boronic acid or ester or other Pd catalyzed reactions gives A-6.
- a palladium catalyst such as but not limited to tetrakis(triphenylphosphine)palladium(0) or [1,1′- bis(diphenylphosphino)ferrocene]dichloropalladium (II)
- a base e.g., a carbonate base
- Scheme II [0418] Compounds of formula II-5 can be synthesized using, for example, the sequences shown in Scheme II. Coupling of compounds II-1 with R1 using appropriate synthetic methods (such as but not limited to amide formation, S N 2 reaction, reductive amination, etc.; e.g., RG1 is a leaving group, such as a bromide and is displaced the amine of II-1) can afford compounds II-2.
- Compounds I-8 can be introduced using appropriate synthetic methods (such as, but not limited to, SN 2 reaction, SNAr reaction, reductive amination, Buchwald reaction, amide formation, Mitsunobu reaction, olefin metathesis, etc.) to give compounds II-4.
- the synthesis of II-4 can be achieved by the coupling of I-8 with R1, followed by the introduction of II-1 using appropriate synthetic methods mentioned above. Removal of the protecting groups can afford compounds of formula II-5.
- Scheme III [0419] The compounds of formula III-5 can be synthesized using, for example, the sequences shown in Scheme III. Coupling of compounds III-1 with R 1 using appropriate synthetic methods (such as but not limited to SN 2 reaction, SNAr reaction, Mitsunobu reaction, etc.) can afford compounds III-2.
- Compounds I-8 can be introduced using appropriate synthetic methods (such as, but not limited to, SN 2 reaction, SNAr reaction, reductive amination, Buchwald reaction, amide formation, Mitsunobu reaction, olefin metathesis, etc.) to give compounds III-4.
- the synthesis of III-4 can be achieved by the coupling of I- 8 with R 1 , followed by the introduction of intermediates III-1 using appropriate synthetic methods mentioned above. Removal of the protecting groups can result in compounds of formula III-5.
- Scheme IV [0420] The compounds of formula IV-4 can be synthesized using, for example, the sequences shown in Scheme IV.
- Scheme V An exemplary synthesis for preparing compound of V-4 is depicted in Scheme V.
- Nucleophilic substitution of haloalkylacids with compounds V-1 under basic conditions e.g., in the presence of a carbonate base, DIPEA, Et3N, etc.
- ethers V-2 e.g., in the presence of a carbonate base, DIPEA, Et3N, etc.
- Coupling of amines IV-3 with carboxylic acids V-2 under standard amide coupling conditions e.g., treatment with an appropriate base such as DIPEA or trimethylamine and in the presence of coupling agents such as HATU, HOBt, or PyBOP
- coupling agents such as HATU, HOBt, or PyBOP
- Scheme VI An exemplary synthesis for preparing compound of VI-3 is depicted in Scheme VI.
- Nucleophilic substitution of alkyldihalide with alcohol V-1 under basic conditions e.g., in the presence of a carbonate base, DIPEA, Et 3 N, etc.
- ethers VI-1 e.g., in the presence of a carbonate base, DIPEA, Et 3 N, etc.
- Nucleophilic substitution of VI-1 where LG2 is a leaving group, such as halo with an amine IV-3 under basic conditions (e.g., in the presence of a carbonate base, DIPEA, Et3N, etc.) can give compounds VI-2. Removal of the protecting group appropriate conditions can afford compounds of formula VI-3.
- Scheme VII [0423] Compounds of formula VII-9 can be synthesized using, for example, the sequences shown in Scheme VII. Coupling of amine VII-1 with carboxylic acid VII-2 under standard amide coupling conditions (treatment with an appropriate base such as, but not limited to, DIPEA or trimethylamine and in the presence of coupling agents such as HATU, HOBt, or PyBOP) gives amides VII-3. Nucleophilic substitution of VII-3 with an alkyl-dihalide under basic conditions (e.g., in the presence of a carbonate base, DIPEA, Et 3 N, etc.) can give compounds VII-4.
- an appropriate base such as, but not limited to, DIPEA or trimethylamine and in the presence of coupling agents such as HATU, HOBt, or PyBOP
- Nucleophilic substitution of VII-3 with an alkyl-dihalide under basic conditions e.g., in the presence of a carbonate base, DIPEA, Et 3 N, etc.
- a second nucleophilic substitution of VII-4 where LG2 is halo with IV-3 under basic conditions can give compounds VII-5.
- Hydrolysis of t-butyl-ester using appropriate conditions can give compounds VII-6.
- Coupling of compounds VII-6 with compounds VII-7 under standard amide coupling conditions such as a base, (e.g., DIPEA or trimethylamine) and in the presence of coupling (e.g., HATU, HOBt, or PyBOP) can afford amides VII-8.
- Deprotection of VII-8 can afford compounds of formula VII-9.
- Scheme VIII [0424] The compounds of formula VIII-5 can be synthesized using, for example, the sequences shown in Scheme VIII.
- the reductive amination between compounds IV-3 and VIII-1 can provide compounds VIII-2.
- Removal of the protecting groups, followed by a nucleophilic substitution of VIII-4 where LG is halo with VIII-3 under basic conditions e.g., in the presence of a carbonate base, DIPEA, Et3N, etc.
- Step b Synthesis of 2-((5-(1-((2S,4R)-4-((tert-butyldimethylsilyl)oxy)-2-(((S)-1-(4-(4- methyl-1 ⁇ 3 ,3 ⁇ 2 -thiazol-5-yl)phenyl)ethyl)carbamoyl)pyrrolidin-1-yl)-3-methyl-1- oxobutan-2-yl)isoxazol-3-yl)oxy)acetic acid (Int-2).
- Step 2 Synthesis of tert-butyl (R)-3-(azidomethyl)-4-(3,6-dichloropyridazin-4-yl)piperazine- 1-carboxylate [0442] To a solution of tert-butyl (R)-4-(3,6-dichloropyridazin-4-yl)-3-(hydroxymethyl) piperazine-1-carboxylate (5.45 g, 15 mmol) and triphenylphosphine (4.7 g, 18 mmol) in THF (150 mL) was added diisopropyl azodicarboxylate (3.5 mL, 18 mmol) and DPPA (3.9 mL, 18 mmol) at 0 °C.
- Step 3 Synthesis of tert-butyl (S)-2-chloro-5,6,6a,7,9,10-hexahydro-8H-pyrazino[1',2':4,5] pyrazino[2,3-c]pyridazine-8-carboxylate [0443] To a stirred solution of crude tert-butyl (R)-3-(azidomethyl)-4-(3,6- dichloropyridazin-4-yl) piperazine-1-carboxylate (30% purity, 20.3 g, 15.7 mmol) in THF (200 mL), triphenylphosphine (4.9 g, 18.8 mmol) was added.
- Step 4 Synthesis of di-tert-butyl (R)-2-chloro-6a,7,9,10-tetrahydro-5H-pyrazino[1',2':4,5] pyrazino[2,3-c]pyridazine-5,8(6H)-dicarboxylate [0444] To a stirred solution of tert-butyl (S)-2-chloro-5,6,6a,7,9,10-hexahydro-8H- pyrazino [1',2':4,5]pyrazino[2,3-c]pyridazine-8-carboxylate (3.1 g, 9.5 mmol) in DCM (120 mL), di-tert butyl dicarbonate (6.2 g, 28.6 mmol) and 4-(dimethylamino)pyridine (1.2 g, 9.5 mmol) were added at RT.
- Step 5 Synthesis of di-tert-butyl (R)-2-(2-hydroxyphenyl)-6a,7,9,10-tetrahydro-5H-pyrazino [1',2':4,5]pyrazino[2,3-c]pyridazine-5,8(6H)-dicarboxylate [0445] To a solution of di-tert-butyl (R)-2-chloro-6a,7,9,10-tetrahydro-5H- pyrazino[1',2':4,5] pyrazino[2,3-c]pyridazine-5,8(6H)-dicarboxylate and 2-hydroxyphenyl boronic acid (1.9 g, 14.1 mmol) in 1,4-dioxane (110 mL) was added potassium carbonate (3.89 g, 28.2 mmol) and [1,1'-bis(diphenylphosphino)ferrocene]dichloropalladium
- Step 2 (3R,5S)-1-((R)-2-(3-(2-bromoethoxy)isoxazol-5-yl)-3-methylbutanoyl)-5-(((S)-1-(4- (4-methylthiazol-5-yl)phenyl)ethyl)carbamoyl)pyrrolidin-3-yl acetate [0449] To a solution of (2S,4R)-1-((R)-2-(3-(2-bromoethoxy)isoxazol-5-yl)-3- methylbutanoyl)-4-hydroxy-N-((S)-1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2- carboxamide (45 mg, 0.07 mmol) in DCM (5 mL) were added DMAP (48.0 mg, 0.37 mmol) and acetic anhydride (37.9 mg, 0.37 mmol), the mixture solution was stirred at
- the reaction mixture was diluted with EtOAc (20 mL) and the organic layer washed with water (2 x10 mL) then saturated brine (1 x10 mL). The organic layer was separated, dried over MgSO4, and filtered. The filtration was concentrated to dryness under reduced pressure.
- Step 2 tert-butyl 3-((S)-2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)pyrrolidine-1-carboxylate (diastereomer 1) [0452] 46.8 g of tert-butyl 3-((S)-2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)pyrrolidine-1-carboxylate (mixture of 2 diastereomers) was purified on chiral supercritical fluid chromatography using the following conditions: column:
- Step 3 2-((6aS)-8-(pyrrolidin-3-yl)-6,6a,7,8,9,10-hexahydro-5H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-2-yl)phenol (diastereomer 1) [0453] To a stirred solution of tert-butyl 3-((S)-2-(2-hydroxyphenyl)-5,6,6a,7,9,10- hexahydro-8H-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)pyrrolidine-1-carboxylate (diastereomer 1, 2.0 g, 4.4 mmol) in DCM (10 mL) was added TFA (1.0 mL) at rt.
- 23 g of (2S,4R)-4-((tert-butyldimethylsilyl)oxy)-1-(2-(3-hydroxyisoxazol-5-yl)-3- methylbutanoyl)-N-((S)-1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2-carboxamide was purified on chiral supercritical fluid chromatography using the following conditions: column: DAICEL CHIRALPAK® Whelk (250*25 mm 10 ⁇ m); mobile phase: 50% IPA/CO 2 ;
- Step 2 1,4-di-tert-butyl 2-methyl 2-methylpiperazine-1,2,4-tricarboxylate
- THF 100 mL
- LiHMDS 2.8 g, 16.6 mmol
- iodomethane 6.4 g, 45.3 mmol
- the resulted mixture was stirred at rt. for 16 h.
- Step 4 tert-butyl 2-chloro-6a-methyl-6-oxo-5,6,6a,7,9,10-hexahydro-8H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazine-8-carboxylate [0465] To a solution of 1,4-bis(tert-butoxycarbonyl)-2-methylpiperazine-2-carboxylic acid (4.2 g, 12.2 mmol) in DCM (25 mL) was added DMF (1 mL) and oxalyl chloride (4.6 g, 36.6 mmol). The mixture was stirred at rt for 30min.
- Step 2 (E)-2-(benzyloxy)acetaldehyde oxime
- 2-(benzyloxy)acetaldehyde 1.0 g, 6.7 mmol
- hydroxylamine hydrochloride 508 mg, 7.33mmol
- NaOH 666 mg, 16.6 mmol
- the reaction was stirred at 0 °C for 2 h.
- the resulting mixture was acidified with HCl (5 N) to pH 2.
- the mixture was extracted with EA (30 mL x 2).
- Step 5 2-(3-((benzyloxy)methyl)isoxazol-5-yl)acetic acid [0473] To a solution of 2-(3-((benzyloxy)methyl)isoxazol-5-yl)ethan-1-ol (100 mg, 0.43mmol) in water (0.20 mL) and acetone (2 mL) was added chromium(III) oxide (65.2 mg, 0.43mmol) and sulfuric acid (0.04 mL, 0.43mmol) . The reaction was stirred at 25 °C for 2 h. The reaction mixture was diluted with water (20 mL) and extracted with EA (2 x 30 mL).
- Step 6 ethyl 2-(3-((benzyloxy)methyl)isoxazol-5-yl)acetate
- 2-(3-((benzyloxy)methyl)isoxazol-5-yl)acetic acid 80.0 mg, 0.32mmol
- sulfuric acid 0.1 mL, 0.32mmol
- the reaction was stirred at 70 °C for 2 h.
- the reaction mixture was diluted with water (20 mL) and extracted with EA (2 x 30 mL).
- Step 10 (2S,4R)-4-((tert-butyldimethylsilyl)oxy)-1-(2-(3-(hydroxymethyl)isoxazol-5-yl)-3- methylbutanoyl)-N-((S)-1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2-carboxamide
- 2-(3-(hydroxymethyl)isoxazol-5-yl)-3-methylbutanoic acid (300.0 mg, 1.51 mmol) in DMF (2 mL) was added (2S,4R)-4-((tert-butyldimethylsilyl)oxy)-N-((S)- 1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2-carboxamide (1.01 g, 2.26 mmol), HATU (859 mg, 2.26 mmol), DIEA (0.75 mL
- the mixture was stirred at rt for 16 h.
- the reaction mixture was diluted with EA (50 mL) and washed with water (2 x 20 mL) and saturated brine (1 x10 mL).
- the organic layer was separated, dried over MgSO4, and concentrated to dryness.
- Step 2 methyl (2S,4R)-4-((tert-butyldimethylsilyl)oxy)-1-((R)-2-(3-(2-(4-(((S)-2-(2- hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8- yl)methyl)piperidin-1-yl)ethoxy)isoxazol-5-yl)-3-methylbutanoyl)pyrrolidine-2-carboxylate [0484] To a solution of (S)-2-(8-(piperidin-4-ylmethyl)-6,6a,7,8,9,10-hexahydro-5H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-2-yl)phenol (60 mg, 0.16 mmol) and methyl (2S,
- the mixture was stirred at rt for 16 h.
- the mixture was diluted with EA (50 mL) and washed with water (2 x 20 mL ) and brine (1 x 10 mL).
- the organic layer was dried over MgSO 4 ,and concentrated to dryness.
- the reaction was stirred at rt for 16 h.
- the mixture was diluted with EA (30 mL) and washed with water (2 x 10 mL ) and brine (1 x 10 mL).
- the organic layer was dried over MgSO 4 , and concentrated to dryness.
- Step 2 tert-butyl 4-(3,6-dichloropyridazin-4-yl)-3-(1-hydroxyethyl)piperazine-1-carboxylate
- tert-butyl 4-(3,6-dichloropyridazin-4-yl)-3-formylpiperazine-1- carboxylate (3.6 g, 9.97 mmol) in THF (70 mL) was added CH 3 MgBr (1M in Et2O, 19.9 mL, 19.9 mmol) at 0 °C. The mixture was stirred at 0 °C for 2 h.
- Step3 to step 7 2-(6-methyl-6,6a,7,8,9,10-hexahydro-5H-pyrazino[1',2':4,5]pyrazino[2,3- c]pyridazin-2-yl)phenol
- the title compound was prepared using procedures analogous to those described for Int-9, from step 2 to step 6, with appropriate starting materials.
- LCMS m/z calcd for C 16 H 20 N 5 O [M+H] + : 298.2; Found: 298.2.
- Step 3 (S)-1-(2-fluoro-4-(4-methylthiazol-5-yl)phenyl)ethan-1-amine [0494] TFA (1.0 mL) was added to the solution of tert-butyl (S)-(1-(2-fluoro-4-(4- methylthiazol-5-yl)phenyl)ethyl)carbamate (15 mg, 0.04mmol) in DCM (5 mL). The resulting mixture was stirred at 25 °C for 3 h.
- Step 2 tert-butyl (S)-(1-(4-(2-methyl-1H-imidazol-1-yl)phenyl)ethyl)carbamate
- CuI 74 mg, 0.39 mmol
- 2-methyl-1H-imidazole 640 mg, 7.8 mmol
- cesium carbonate 2.5 g, 7.8mmol
- proline 899 mg, 7.8mmol
- the reaction mixture was heated to 130 °C and stirred for 2 h.
- the reaction mixture was diluted with water (50 mL) and extracted with EA (3 x 20 mL). The organic layers were combined, dried over sodium sulfate, filtered and concentrated to dryness.
- the residue was purified by prep-TLC with EA/PE (2/1) to afford tert-butyl (S)-(1-(4-(2-methyl-1H-imidazol-1- yl)phenyl)ethyl)carbamate (120 mg, 0.38 mmol, 9.7% yield) as yellow oil.
- Step 3 N-((S)-1-(2-methoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)ethyl)-2- methylpropane-2-sulfinamide [0500] To a solution of N-((S)-1- (4-bromo-2-methoxyphenyl)ethyl)-2-methylpropane-2- sulfinamide (175 mg, 0.52 mmol) and bis(pinacolato)diboron (200 mg, 0.79 mmol) in 1,4- dioxane (5 mL) was added Pd(dppf)Cl 2 (38 mg, 0.05 mmol) and potassium acetate (154 mg, 1.57 mmol).
- Step 4 N-((S)-1-(2-methoxy-4-(4-methylthiazol-5-yl)phenyl)ethyl)-2-methylpropane-2- sulfinamide
- N-((S)-1-(2-methoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2- yl)phenyl)ethyl)-2-methylpropane-2-sulfinamide 100 mg, 0.26 mmol
- 5-bromo-4- methyl-1,3-thiazole 70 mg, 0.39 mmol
- 1,4-dioxane 5 mL
- Step 5 (S)-1-(2-methoxy-4-(4-methylthiazol-5-yl)phenyl)ethan-1-amine [0502] A solution of N-((S)-1-(2-methoxy-4-(4-methylthiazol-5-yl)phenyl)ethyl)-2- methylpropane-2-sulfinamide (100 mg, 0.28 mmol) in HCl in dioxane (1 M, 1.42 mL, 1.42 mmol) was stirred at rt for 2 h.
- Step 2 tert-butyl (R)-(2-((tert-butoxycarbonyl)oxy)-1-(4-(4-methylthiazol-5- yl)phenyl)ethyl)carbamate
- the title compound was prepared using procedure analogous to those described for Int-39, step 2 with appropriate starting materials.
- Step 3 (R)-2-amino-2-(4-(4-methylthiazol-5-yl)phenyl)ethan-1-ol
- tert-butyl (R)-(2-((tert-butoxycarbonyl)oxy)-1-(4-(4- methylthiazol-5-yl)phenyl)ethyl)carbamate 1.0 g, 2.3 mmol
- TFA 10 mL
- Step 4 (R)-2-((tert-butyldimethylsilyl)oxy)-1-(4-(4-methylthiazol-5-yl)phenyl)ethan-1-amine [0506] To a solution of (R)-2-amino-2-(4-(4-methylthiazol-5-yl)phenyl)ethan-1-ol (850 mg, 3.63 mmol) in DCM (10 mL) was added imidazole (741 mg, 10.9 mmol) and tert-butyl dimethylchlorosilane (820 mg, 5.44 mmol). The mixture was stirred at rt for 16 h. The reaction mixture was diluted with water and extracted with DCM.
- Step 2 3-(2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)propanal [0512] To a stirred solution of 2-(8-(2-(1,3-dioxolan-2-yl)ethyl)-6,6a,7,8,9,10-hexahydro- 5H-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-2-yl)phenol (60 mg, 0.16 mmol) in MeCN (2 mL) was added aqueous HCl (1 N, 1 mL) at rt.
- Step 2 4-((S)-2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)pyrrolidin-3-ol [0517] To a stirred solution of tert-butyl 3-hydroxy-4-((S)-2-(2-hydroxyphenyl)- 5,6,6a,7,9,10-hexahydro-8H-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)pyrrolidine-1- carboxylate (60 mg, 0.13 mmol) in DCM (1.5 mL) was added TFA (1 mL) at rt.
- Step 2 (S)-(2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)(piperidin-4-yl)methanone [0520] To a stirred solution of tert-butyl (S)-4-(2-(2-hydroxyphenyl)-6,6a,7,8,9,10- hexahydro-5H-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazine-8-carbonyl)piperidine-1- carboxylate (170 mg, 0.34 mmol) in DCM (2 mL) was added trifluoroacetic acid (0.5 mL) at rt.
- Step 2 1-(tert-butyl) 2-methyl 4-((tert-butyldimethylsilyl)oxy)piperidine-1,2-dicarboxylate
- 1-(tert-butyl) 2-methyl 4-hydroxypiperidine-1,2- dicarboxylate 4.4 g, 17.0 mmol
- DMF 60 mL
- imidazole 5.8 g, 84.8 mmol
- TBSCl 7.7 g, 50.9 mmol
- Step 3 tert-butyl 4-((tert-butyldimethylsilyl)oxy)-2-(hydroxymethyl)piperidine-1-carboxylate
- 1-(tert-butyl) 2-methyl 4-((tert- butyldimethylsilyl)oxy)piperidine-1,2-dicarboxylate 5.6 g, 14.9 mmol
- LiAlH4 0.85 g, 22.3 mmol
- H 2 O 0.90 mL
- aqueous NaOH (15%, 0.90 mL
- H 2 O 2.70 mL
- Step 4 (4-((tert-butyldimethylsilyl)oxy)piperidin-2-yl)methanol
- Step 5-8 tert-butyl 8-((tert-butyldimethylsilyl)oxy)-2-chloro-6,6a,7,8,9,10-hexahydro-5H- pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5-carboxylate [0525]
- the title compound was prepared using procedure analogous to those described for Int-9, step 1 to step 4 with appropriate starting materials.
- Step 9 tert-butyl 2-chloro-8-hydroxy-6,6a,7,8,9,10-hexahydro-5H- pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5-carboxylate
- tert-butyl 8-((tert-butyldimethylsilyl)oxy)-2-chloro- 6,6a,7,8,9,10-hexahydro-5H-pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5-carboxylate (170 mg, 0.37 mmol) in THF (5 mL) was added TBAF (0.75 mL, 0.75 mmol) at 0 °C.
- Step 10 tert-butyl 2-chloro-8-oxo-6,6a,7,8,9,10-hexahydro-5H- pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5-carboxylate
- tert-butyl 2-chloro-8-hydroxy-6,6a,7,8,9,10-hexahydro-5H- pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5-carboxylate 110 mg, 0.32 mmol
- DCM 5 mL
- Dess-Martin periodinane 274 mg, 0.65 mmol
- Step 11 tert-butyl 8-((1-(tert-butoxycarbonyl)piperidin-4-yl)amino)-2-chloro-6,6a,7,8,9,10- hexahydro-5H-pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5-carboxylate [0528] To a stirred solution of tert-butyl 2-chloro-8-oxo-6,6a,7,8,9,10-hexahydro-5H- pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5-carboxylate (80 mg, 0.24 mmol) in methanol (5.00 mL) was added 4-amino-1-boc-piperidine (47.3 mg, 0.24 mmol), one drop AcOH, and NaBH 3 CN (29.7 mg, 0.47 mmol) at 25 °C.
- Step 12 tert-butyl 8-((1-(tert-butoxycarbonyl)piperidin-4-yl)(methyl)amino)-2-chloro- 6,6a,7,8,9,10-hexahydro-5H-pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5-carboxylate [0529] To a stirred solution of tert-butyl 8-((1-(tert-butoxycarbonyl)piperidin-4-yl)amino)- 2-chloro-6,6a,7,8,9,10-hexahydro-5H-pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5- carboxylate (60 mg, 0.11 mmol) in methanol (3 mL) was added 37 wt% formaldehyde solution in H 2 O/MeOH (0.02 mL, 0.57
- Step 13 tert-butyl 8-((1-(tert-butoxycarbonyl)piperidin-4-yl)(methyl)amino)-2-(2- hydroxyphenyl)-6,6a,7,8,9,10-hexahydro-5H-pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5- carboxylate [0530] To a solution of tert-butyl 8-((1-(tert-butoxycarbonyl)piperidin-4- yl)(methyl)amino)-2-chloro-6,6a,7,8,9,10-hexahydro-5H-pyrido[1',2':4,5]pyrazino[2,3- c]pyridazine-5-carboxylate (100 mg, 0.19 mmol) and 2-hydroxyphenylboronic acid (103 mg, 0.74 mmol) in 1,4-dioxane (8.00
- Step 14 2-(8-(methyl(piperidin-4-yl)amino)-6,6a,7,8,9,10-hexahydro-5H- pyrido[1',2':4,5]pyrazino[2,3-c]pyridazin-2-yl)phenol [0531] To a stirred solution of tert-butyl 8-((1-(tert-butoxycarbonyl)piperidin-4- yl)(methyl)amino)-2-(2-hydroxyphenyl)-6,6a,7,8,9,10-hexahydro-5H- pyrido[1',2':4,5]pyrazino[2,3-c]pyridazine-5-carboxylate (50 mg, 0.08 mmol) in DCM (3.00 mL) was added TFA (1.5 mL) at 25 °C.
- the reaction mixture was added EDCI (15.6 g, 81.3 mmol) and stirred at 0 °C for 15 minutes. Then, the reaction mixture was added to a mixture of L-serine methyl ester hydrochloride (11.3 g, 81.3 mmol) in DIPEA (14.2 mL, 81.3 mmol) and DMF (30 mL) dropwise at 0 °C over 5 minutes. The reaction was warmed up to room temperature and stirred for 3 hours. The reaction was added water (500 mL), and extracted with DCM (300 mL x 3). The organic phases were dried over Na 2 SO 4 , filtered and concentrated.
- Step 2 methyl O-benzyl-L-seryl-L-alaninate
- DCM methyl O-benzyl-N-(tert-butoxycarbonyl)-L-seryl-L-alaninate
- TFA 51.4 mL, 672.3 mmol
- the reaction was stirred at room temperature for 3 hours.
- the reaction mixture was basified to between pH 7 and pH 8 via saturated aqueous NaHCO 3 solution, extracted with DCM (100 mL x 3), and washed with brine (100 mL x 1).
- the combined organic phases were dried over Na 2 SO 4 , filtered and concentrated.
- Step 5 ((2R,5S)-5-methylpiperazin-2-yl)methanol
- (2R,5S)-2-((benzyloxy)methyl)-5-methylpiperazine (0.29 g, 1.3 mmol) in DCM (13 mL)
- 1 M BCl 3 in DCM solution 5.2 mL, 5.2 mmol
- the reaction was slowly warmed up to room temperature and stirred for overnight.
- the reaction was cooled under ice-water bath, and slowly added MeOH (10 mL).
- the reaction mixture was concentrated to dryness. The residue was directly used for the next step without purification (0.23 g crude).
- Step 7 tert-butyl (2S,5R)-5-(hydroxymethyl)-2-methylpiperazine-1-carboxylate
- a solution of di-tert-butyl (2R,5S)-2-(hydroxymethyl)-5-methylpiperazine-1,4- dicarboxylate (14.0 g, 42.4 mmol) in EtOH (78.5 mL) was added a solution of NaOH (8.5 g, 211.9 mmol) in water (78.5 mL). The reaction mixture was stirred at 80 °C for overnight.
- Step 8-12 di-tert-butyl (6aR,9S)-2-(2-hydroxyphenyl)-9-methyl-6a,7,9,10-tetrahydro-5H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazine-5,8(6H)-dicarboxylate
- the title compound was prepared using procedure analogous to those described for Int-9, step 1 to step 5, using appropriate starting materials.
- LCMS calc. for C 26 H 35 N 5 O 5 [M+H] + : m/z 498.3; Found: 498.5.
- Step 13 2-((6aR,9S)-9-methyl-6,6a,7,8,9,10-hexahydro-5H-pyrazino[1',2':4,5]pyrazino[2,3- c]pyridazin-2-yl)phenol (Int-69) 2M HCl in i-PrOAc (21 mL) was added to di-tert-butyl (6aR,9S)-2-(2-hydroxyphenyl)-9- methyl-6a,7,9,10-tetrahydro-5H-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazine-5,8(6H)- dicarboxylate (1.07g, 2.15mmol).
- Example 4a (2S,4R)-4-hydroxy-1-((R)-2-(3-(2-((S)-2-(2-hydroxyphenyl)-5,6,6a,7,9,10- hexahydro-8H-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)ethoxy)isoxazol-5-yl)- 3-methylbutanoyl)-N-((S)-1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2- carboxamide [0537] The title compound was prepared using procedure analogous to those described for example 4 with appropriate starting materials.
- Example 4b (2S,4R)-4-hydroxy-1-((R)-2-(3-(2-((R)-2-(2-hydroxyphenyl)-5,6,6a,7,9,10- hexahydro-8H-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)ethoxy)isoxazol-5-yl)- 3-methylbutanoyl)-N-((S)-1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2- carboxamide [0538] The title compound was prepared using procedure analogous to those described for example 4 with appropriate starting materials.
- Step a Synthesis of (2S,4R)-4-((tert-butyldimethylsilyl)oxy)-1-((2R)-2-(3-(2-(4-((2-(2- hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H-pyrazino[1',2':4,5]pyrazino[2,3- c]pyridazin-8-yl)methyl)piperidin-1-yl)ethoxy)isoxazol-5-yl)-3-methylbutanoyl)-N-((S)- 1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2-carboxamide (18).
- Step 3 (2S,4R)-4-hydroxy-1-((2S)-2-(3-(4-((2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro- 8H-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)methyl)piperidin-1-yl)propanamido)- 3,3-dimethylbutanoyl)-N-((S)-1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2- carboxamide [0543] To a mixture of (2S,4R)-1-[(2S)-2-amino-3,3-dimethylbutanoyl] -4-hydroxy-N- [(1S)-1- [4-(4- methyl-1,3-thiazol-5-yl)phenyl]ethyl]pyrrolidine-2-carboxamide (23.6 mg
- the resulting mixture was heated at 80 °C for 3 h.
- the reaction crude was cooled to rt and filtered under reduced pressure.
- the filter cake was washed by ACN (50 mL).
- the filtrate was concentrated in vacuum to give the crude product, which was purified by silica gel chromatography column, using EA/Heptane as eluents (20-80% EA in heptane) to afford the desired product (2.1 g, 72.9 % yield over two steps) as a colorless oil.
- Example 53 (5-(1-((2S,4R)-4-hydroxy-2-(((S)-1-(4-(4-methylthiazol-5- yl)phenyl)ethyl)carbamoyl)pyrrolidin-1-yl)-3-methyl-1-oxobutan-2-yl)isoxazol-3- yl)methyl 4-((S)-2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)piperidine-1-carboxylate Step 1: (5-(1-((2R,4R)-4-((tert-butyldimethylsilyl)oxy)-2-(((S)-1-(4-(4-methylthiazol-5- yl)phenyl)ethyl)carbamoyl)pyrrolidin-1-
- Step 3 (2S,4R)-4-hydroxy-1-(2-(3-(((4-(2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H- pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)pyridin-2-yl)oxy)methyl)isoxazol-5-yl)-3- methylbutanoyl)-N-((S)-1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2-carboxamide [0559] To a stirred solution of (2S,4R)-4-((tert-butyldimethylsilyl)oxy)-1-(2-(3-(((4-(2-(2- hydroxyphenyl)-5,6,6a,7,9,10-hexahydro-8H-pyrazino[1',2':4,5]pyrazino
- Step 2 (2S,4R)-1-((S)-2-(azetidine-3-carboxamido)-3,3-dimethylbutanoyl)-4-hydroxy-N- ((S)-1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2-carboxamide
- Step 3 (2S,4R)-4-hydroxy-1-((2S)-2-(1-(3-(2-(2-hydroxyphenyl)-5,6,6a,7,9,10-hexahydro- 8H-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazin-8-yl)propyl)azetidine-3-carboxamido)-3,3- dimethylbutanoyl)-N-((S)-1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2- carboxamide [0562] To a stirred solution of (2S,4R)-1-((S)-2-(azetidine-3-carboxamido)-3,3- dimethylbutanoyl)-4-hydroxy-N-((S)-1-(4-(4-methylthiazol-5-yl)phenyl)ethyl)pyrrolidine-2- carboxamide (55
- VHL/ElonginB/ElonginC N-terminal his 6 -tagged VHL (uniprot accession number P40337; M54-D213; MEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIH SYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVV RSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD), Elongin B (Q15370; M1-K104; MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTL GEC GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPP ELPDVMK), Elongin C (Q15369; M17-C112; MYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETN
- the assay mixture was prepared by mixing SMARCA2 (10 nM final), biotinylated probe (25 nM final), and assay buffer or VCB (5 ⁇ M) in 1x AlphaLISA Epigenetics Buffer (PerkinElmer AL008F) with 1 mM TCEP.
- the compounds in DMSO were added to each well in 3-fold serial dilution by dispenser (TECAN D300E) and incubate for 20 minutes at room temperature before addition of detection reagents, Lance Eu W1024 anti-6xHis (0.6 nM final, PerkinElmer AD0110) and Streptavidin Surelight APC (6 nM final, PerkinElmer CR130-100).
- the inhibitory activity of compounds was evaluated in vitro using TR-FRET assay with white 384-well low volume microplate (PerkinElmer ProxiPlate Plus), in which the compound competes the same binding site with the ligand, and thus lead to dose- dependent TR-FRET signal reduction.
- TR-FRET assay with white 384-well low volume microplate (PerkinElmer ProxiPlate Plus), in which the compound competes the same binding site with the ligand, and thus lead to dose- dependent TR-FRET signal reduction.
- the cooperativity of the compounds for ternary complex formation with E3 ligase was evaluated in the absence or presence of saturating concentrations of VCB. Testing compounds were dissolved in DMSO at 10 mM and tested in 9-point IC50 mode.
- the assay mixture was prepared by mixing SMARCA4 (20 nM final), biotinylated probe (25 nM final), and assay buffer or VCB (5 ⁇ M) in 1x AlphaLISA Epigenetics Buffer (PerkinElmer AL008F) with 1 mM TCEP.
- the compounds of interest in DMSO were added to each well in 3-fold serial dilution by dispenser (TECAN D300E). and incubate for 20 minutes at room temperature before addition of detection reagents, Lance Eu W1024 anti-6xHis (0.6 nM final, PerkinElmer AD0110) and Streptavidin Surelight APC (6 nM final, PerkinElmer CR130-100).
- %inhibition 100x(F DMSO -F)/( F DMSO -F PC ), in which F DMSO is DMSO control, and FPC is positive control.
- IC50 values were determined from dose response curve by fitting the percent inhibition against compound concentration using GraphPad Prism software.
- cells were fixed within the plates with 40 ⁇ L of 4% formaldehyde by incubating at room temperature for 30 minutes, and then permeabilized with wash buffer (1X PBS with 0.1% Triton X-100) by washing the plate 5 times with 50 ⁇ L/well. Before labeling with primary antibodies, cells were blocked with 30 ⁇ L/well of blocking buffer (Licor Odyssey blocking buffer PBS #927-40000) for 30 minutes at room temperature.
- blocking buffer Lior Odyssey blocking buffer PBS #927-40000
- SMARCA2 or SMARCA4 proteins were labeled with 20 ⁇ L/well of anti SMARCA2 or SMACRA4 antibodies (Cell Signaling BRM #11966S 1:1000, Cell Signaling BRG #49360S 1:1000) diluted in Li-Cor Odyssey blocking buffer-PBS #927-40000, followed by overnight incubation at 4 °C. [0570] The next day, plates were washed 5X5 minutes with 50 ⁇ L/well of washing buffer to remove all the excess primary antibody and then 20 ⁇ L from a mixture of secondary antibody and fluorescent DNA specific dye (Goat anti rabbit 1:500 IRDye-800CW #92632211, and DRAQ5TM 1:2000- # ab108410 ) was added to each well.
- anti SMARCA2 or SMACRA4 antibodies Cell Signaling BRM #11966S 1:1000, Cell Signaling BRG #49360S 1:1000
- Li-Cor Odyssey blocking buffer-PBS #927-40000 Li-Cor Odyssey blocking buffer-PBS #927-40000
- NCIH1693 or NCIH1703 cells per well were seeded in 96 well plate and incubated at 37 °C for 5 hrs. A series of three-fold dilution of compounds from 10 mM stock concentration were added to the cells by using digital Dispenser D300-Tecan, keeping highest concentration 10 ⁇ M and normalizing with DMSO at the highest dispensed volume). Cells incubated with DMSO was used as a vehicle control. After compound treatment plates were incubated at 37 °C for 4 days and cell viability was measured by measuring ATP content from the cell lysate using ATPlite Luminescence assay system (PerkinElmer Cat.no# 6016941).
- IC 50 _SM2_T refers to ternary binding potency in SMARCA2 FRET assay
- IC 50 _SM4_T refers to ternary binding potency in SMARCA4 FRET assay
- DC50/Dmax%(SM2_H520) refers to SMARCA2 degradation potency/ maximum SMARCA2 degradation within the concentrations tested in H520 cells
- DC50/Dmax%(SM4_H520) refers to SMARCA4 degradation potency/ maximum SMARCA4 degradation within the concentrations tested in H520 cells
- DC 50 /D max % (SM2_H1693) refers to SMARCA2 degradation potency/ maximum SMARCA2 degradation within the concentrations tested in H520 cells in H1693 cells
- SMARCA2 HiBiT and SMARCA4 HiBiT degradation assay (cellular) Preparation of SMARCA2/4-HiBiT knock-in cells
- HiBiT peptide knock-in of SMARCA2 in LgBiT expressing HEK293T cells was performed by CRISPR-mediated tagging system as described Promega. The homozygous HiBiT knock-in on c-terminus SMARCA2 was confirmed by sanger sequence.
- SMARCA2- HiBiT knock-in Hela monoclonal cell (CS302366) and SMARCA4-HiBiT knock-in Hela monoclonal cell (CS3023226) were purchased from Promega.
- SMARCA2 HiBiT degradation assay in HEK293T cells [0573] Compounds were prepared in a low dead volume plate at 3-fold serial dilution, and then transferred 25 nL/well into a 384 well plate (Corning: #356661) by Agilent Bravo liquid dispenser. SMARCA2-HiBiT monoclonal HEK293T cells were added at 5,000/well/25 uL into the compound containing 384 well plate.
- DC 50 /D max %(SM2-293T) refers to SMARCA2 degradation potency/ maximum SMARCA2 degradation within the concentrations tested in 293T HiBiT assay
- DC 50 /D max %(SM2-HeLa) refers to SMARCA2 degradation potency/ maximum SMARCA2 degradation within the concentrations tested in HeLa HiBiT assay
- DC 50 /D max %(SM4-HeLa) refers to SMARCA4 degradation potency/ maximum SMARCA4 degradation within the concentrations tested in HeLa HiBiT assay
- A IC 50 or DC 50 ⁇ 0.1 ⁇ M
- A D max >75%
- B 50% ⁇ D
- Aspect 2 The compound according to aspect 1, wherein R 1 is a covalent bond.
- Aspect 6 The compound according to any one of aspects 1-5, wherein the compound of Formula IA is a compound of Formula IA-1: Aspect 7. The compound according to any one of aspects 1-5, wherein the compound of Formula IA is a compound of Formula IA-2: Aspect 8. The compound according to any one of aspects 1-5 or 7, wherein the compound of Formula IA is a compound of Formula IA-3:
- X is optionally substituted -CH 2 -, or NH; or, if R 1 is attached to X, then X is -CH- or N; and Q is optionally substituted -CH 2 -, optionally substituted -(CH 2 ) 2 -, -C(O)-, optionally substituted -CH 2 C(O)-, -S(O)-, -S(O) 2 -, optionally substituted -CH 2 S(O) 2 - , or optionally substituted -CH 2 S(O)-.
- ULM is a moiety having the Formula ULM-I wherein the dashed line (----) indicates the position of attachment of ULM-I to R 1 ;
- V is H or F;
- R 3 is optionally substituted phenyl, optionally substituted napthyl, or an optionally substituted 5-10 membered heteroaryl;
- one of R 4 or R 5 is H, D, haloalkyl, optionally substituted alkyl, optionally substituted cycloalkyl, optionally substituted heterocycloalkyl, -COR d , CONR e1 R e2 ; the other of R 4 or R 5 is H or D; or R 4 and R 5 , together with the carbon atom to which they are both attached, form an optionally substituted 3-5 membered cycloalkyl, heterocyclyl;
- W 3 is an optionally substituted aryl
- Aspect 19 The compound according to aspect 18, wherein R 8 is optionally substituted heterocyclyl.
- Aspect 20 The compound according to aspect 18, wherein R 8 is optionally substituted heteroaryl.
- Aspect 21 The compound according to aspect 18, wherein R 8 is optionally substituted aryl.
- Aspect 22 The compound according to aspect 18, wherein R 8 is CONR a R b .
- Aspect 23 The compound according to aspect 18, wherein R 8 is NR a R b .
- Aspect 24. The compound according to aspect 18, wherein R 8 is .
- Aspect 25 The compound according to aspect 18, wherein R 8 is .
- Aspect 26 The compound according to aspect 18, wherein R 8 is .
- Aspect 27 The compound according to aspect 18, wherein R 8 is .
- Aspect 28 The compound according to aspect 18, wherein R 8 is .
- R 3 is optionally substituted phenyl having the formula: wherein R 9 is H, D, halo, -CN, -OH, -NO 2 , -NR e1 R e2 , -OR e1 , -CONR e1 R e2 , -NR e1 COR e2 , - SO 2 NR e1 R e2 , -NR e1 SO 2 R e2 , optionally substituted alkyl, optionally substituted alkoxyl, optionally substituted haloalkyl, optionally substituted haloalkoxy; optionally substituted aryl; optionally substituted heteroaryl; optionally substituted cycloalkyl; or optionally substituted heterocyclyl; R 10 is H, D, halo, CN, optionally substituted alkyl, optionally substituted haloalkyl, hydroxy, -NH(optionally substituted alkyl),
- Aspect 34 The compound according to aspect 33, wherein R 9 is , each optionally substituted.
- Aspect 35 The compound according to aspect 34, wherein R 9 is .
- Aspect 36 The compound according to any one of aspects 33-35, wherein R 10 is H, D, hydroxy, halogen, -NH(C 1 -C 4 alkyl), or C 1 -C 6 alkoxy, and z is 0, 1, 2, 3, or 4.
- Aspect 41 The compound of aspect 40, wherein R 9 is optionally substituted ; and R 10 is H, D, hydroxy, halogen, -NH(C 1 -C 6 alkyl), or -OC 1 -C 6 alkyl.
- Aspect 42 The compound according to aspect 40 or 41, wherein the compound of Formula I is a compound of Formula IA-7 or IA-8:
- Aspect 43 The compound according to aspect 42, wherein the compound of Formula I is a compound of Formula IA-9 or IA-10:
- Aspect 45 The compound according to any one of aspects 1-43, wherein R 1 is - (CR 1a R 1b ) 1-5 .
- Aspect 46 The compound according to any one of aspects 1-43, wherein R 1 is - (CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c .
- Aspect 47 The compound according to any one of aspects 1-43, wherein R 1 is - (CR 1a R 1b ) 1-5 -A-(CR 1a R 1b ) 1-5 - wherein A is O, S, or NR 1c .
- Aspect 48 The compound according to any one of aspects 1-43, wherein R 1 is - (CR 1a R 1b ) 1-5 -A-(CR 1a R 1b ) 1-5 - wherein A is O, S, or NR 1c .
- R 1 is -(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups) - (CR 1a R 1b ) 1-5 -.
- Aspect 54 The compound according to any one of aspects 1-43, wherein R 1 is - (CR 1a R 1b ) 1-5 -(3-11 membered cycloalkyl optionally substituted with 0-6 R 1a and/or R 1b groups)-(CR 1a R 1b ) 1-5 -A- wherein A is O, S, or NR 1c .
- Aspect 55 is O, S, or NR 1c .
- R 1 is - (CR 1a R 1b ) 1-5 -A-(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)- wherein A is O, S, or NR 1c .
- Aspect 58 The compound according to any one of aspects 1-43, wherein R 1 is - (CR 1a R 1b ) 1-5 -A-(3-11 membered cycloalkyl optionally substituted with 0-6 R 1a and/or R 1b groups)- wherein A is O, S, or NR 1c .
- Aspect 59 is - (CR 1a R 1b ) 1-5 -A-(3-11 membered heterocyclyl optionally substituted with 0-6 R 1a and/or R 1b groups)- wherein A is O, S, or NR 1c .
- a pharmaceutical composition comprising a compound according to any one of aspects 1 to 59 and a pharmaceutically acceptable excipient.
- Aspect 61. A method of treating cancer in a subject in need thereof comprising administering to the subject a compound of any one of aspects 1 to 59.
- Aspect 62. The method of aspect 61, wherein the cancer is SMARCA4 deleted cancer.
- the cancer is squamous- cell carcinoma, basal cell carcinoma, adenocarcinoma, hepatocellular carcinomas, and renal cell carcinomas, cancer of the bladder, bowel, breast, cervix, colon, esophagus, head, kidney, liver, lung, neck, ovary, pancreas, prostate, and stomach; leukemias; benign and malignant lymphomas, particularly Burkitt's lymphoma and Non-Hodgkin's lymphoma; benign and malignant melanomas; myeloproliferative diseases; sarcomas, including Ewing's sarcoma, hemangiosarcoma, Kaposi's sarcoma, liposarcoma, myosarcomas, peripheral neuroepithelioma, synovial sarcoma, gliomas, astrocytomas, oligodendrogliomas, ependymo
- Additional cancers which may be treated using compounds according to the present disclosure include, for example, T-lineage Acute lymphoblastic Leukemia (T-ALL), T-lineage lymphoblastic Lymphoma (T-LL), Peripheral T-cell lymphoma, Adult T-cell Leukemia, Pre-B ALL, Pre-B Lymphomas, Large B-cell Lymphoma, Burkitts Lymphoma, B-cell ALL, Philadelphia chromosome positive ALL and Philadelphia chromosome positive CML.
- T-ALL T-lineage Acute lymphoblastic Leukemia
- T-LL T-lineage lymphoblastic Lymphoma
- Peripheral T-cell lymphoma Peripheral T-cell lymphoma
- Adult T-cell Leukemia Pre-B ALL
- Pre-B Lymphomas Large B-cell Lymphoma
- Burkitts Lymphoma B-cell ALL
- Philadelphia chromosome positive ALL Philadelphia chromosome positive CML.
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
- Nitrogen Condensed Heterocyclic Rings (AREA)
- Heterocyclic Carbon Compounds Containing A Hetero Ring Having Oxygen Or Sulfur (AREA)
- Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
- Epidemiology (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IL298933A IL298933B1 (en) | 2020-06-09 | 2021-06-09 | BRM-targeted compounds and related methods of use |
| FIEP21736890.1T FI4161935T3 (fi) | 2020-06-09 | 2021-06-09 | Brm:ään kohdennettuja yhdisteitä ja niihin liittyviä käyttömenetelmiä |
| AU2021289730A AU2021289730A1 (en) | 2020-06-09 | 2021-06-09 | BRM targeting compounds and associated methods of use |
| CA3185888A CA3185888A1 (en) | 2020-06-09 | 2021-06-09 | Brm targeting compounds and associated methods of use |
| CN202180049461.6A CN115867554B (zh) | 2020-06-09 | 2021-06-09 | Brm靶向化合物和相关使用方法 |
| EP25173100.6A EP4570319A3 (en) | 2020-06-09 | 2021-06-09 | Brm targeting compounds and associated methods of use |
| JP2022575824A JP2023529908A (ja) | 2020-06-09 | 2021-06-09 | Brm標的化化合物及び関連する使用方法 |
| MX2022015732A MX2022015732A (es) | 2020-06-09 | 2021-06-09 | Compuestos dirigidos a brm y métodos asociados de uso. |
| DK21736890.1T DK4161935T3 (da) | 2020-06-09 | 2021-06-09 | Brm-målrettende forbindelser og tilhørende anvendelsesmetoder |
| KR1020237000892A KR20230037549A (ko) | 2020-06-09 | 2021-06-09 | Brm 표적화 화합물 및 관련 사용 방법 |
| PL21736890.1T PL4161935T3 (pl) | 2020-06-09 | 2021-06-09 | Związki celowane brm i powiązane sposoby zastosowania |
| ES21736890T ES3034380T3 (en) | 2020-06-09 | 2021-06-09 | Brm targeting compounds and associated methods of use |
| BR112022025061A BR112022025061A2 (pt) | 2020-06-09 | 2021-06-09 | Compostos que estabelecem como alvo brm e métodos de uso associados |
| EP21736890.1A EP4161935B1 (en) | 2020-06-09 | 2021-06-09 | Brm targeting compounds and associated methods of use |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063036811P | 2020-06-09 | 2020-06-09 | |
| US63/036,811 | 2020-06-09 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021252666A1 true WO2021252666A1 (en) | 2021-12-16 |
Family
ID=76731093
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/036664 Ceased WO2021252666A1 (en) | 2020-06-09 | 2021-06-09 | Brm targeting compounds and associated methods of use |
Country Status (16)
| Country | Link |
|---|---|
| US (2) | US11702423B2 (https=) |
| EP (2) | EP4161935B1 (https=) |
| JP (1) | JP2023529908A (https=) |
| KR (1) | KR20230037549A (https=) |
| CN (1) | CN115867554B (https=) |
| AU (1) | AU2021289730A1 (https=) |
| BR (1) | BR112022025061A2 (https=) |
| CA (1) | CA3185888A1 (https=) |
| DK (1) | DK4161935T3 (https=) |
| ES (1) | ES3034380T3 (https=) |
| FI (1) | FI4161935T3 (https=) |
| IL (1) | IL298933B1 (https=) |
| MX (1) | MX2022015732A (https=) |
| PL (1) | PL4161935T3 (https=) |
| PT (1) | PT4161935T (https=) |
| WO (1) | WO2021252666A1 (https=) |
Cited By (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022099117A1 (en) * | 2020-11-06 | 2022-05-12 | Prelude Therapeutics Incorporated | Brm targeting compounds and associated methods of use |
| US11679109B2 (en) | 2019-12-23 | 2023-06-20 | Kymera Therapeutics, Inc. | SMARCA degraders and uses thereof |
| WO2023220577A1 (en) * | 2022-05-10 | 2023-11-16 | Prelude Therapeutics, Incorporated | 6,6a,7,8,9,10-hexahydro-5h-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazine derivatives as smarca4 protein degraders for the treatment of cancer |
| WO2024064316A1 (en) * | 2022-09-23 | 2024-03-28 | Regents Of The University Of Michigan | Compounds and compositions as smarca2/4 inhibitors and uses thereof |
| WO2024064328A1 (en) * | 2022-09-23 | 2024-03-28 | Regents Of The University Of Michigan | Compounds and compositions as smarca2/4 degraders and uses thereof |
| WO2024214019A1 (en) | 2023-04-12 | 2024-10-17 | Aurigene Oncology Limited | Tetracyclic compounds as smarca2 and/or smarca4 degraders |
| WO2025076347A1 (en) | 2023-10-04 | 2025-04-10 | Prelude Therapeutics Incorporated | Combination treatment regimens - smarca2 degrader with pd-1 inhibitors |
| WO2025076357A1 (en) | 2023-10-04 | 2025-04-10 | Prelude Therapeutics Incorporated | Combination treatment regimens - smarca2 degrader with taxane anticancer agent |
| WO2025076351A1 (en) | 2023-10-04 | 2025-04-10 | Prelude Therapeutics Incorporated | Combination treatment regimens - smarca2 degrader with gemcitabine |
| EP4363425A4 (en) * | 2021-06-28 | 2025-05-14 | Kymera Therapeutics, Inc. | SMARCA DEGRADERS AND USES THEREOF |
| WO2025106482A1 (en) * | 2023-11-13 | 2025-05-22 | Oncopia Therapeutics, Inc. D/B/A Sk Life Science Labs | Compounds and compositions as smarca2/4 degraders and uses thereof |
| JP2025516584A (ja) * | 2022-05-10 | 2025-05-30 | フォグホーン セラピューティクス インコーポレイテッド | 化合物及びその使用 |
| WO2025193454A1 (en) | 2024-03-01 | 2025-09-18 | Prelude Therapeutics Incorporated | Brm and brg1 targeting antibody-drug conjugates and methods of use thereof |
| US12454520B2 (en) | 2018-07-06 | 2025-10-28 | Kymera Therapeutics, Inc. | Protein degraders and uses thereof |
| US12516068B2 (en) | 2018-01-12 | 2026-01-06 | Kymera Therapeutics, Inc. | Protein degraders and uses thereof |
| US12521438B2 (en) | 2019-06-10 | 2026-01-13 | Kymera Therapeutics, Inc. | SMARCA degraders and uses thereof |
| US12569485B2 (en) | 2019-12-23 | 2026-03-10 | Kymera Therapeutics, Inc. | SMARCA inhibitors and uses thereof |
| US12606568B2 (en) | 2020-12-09 | 2026-04-21 | Kymera Therapeutics, Inc. | SMARCA degraders and uses thereof |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20240046498A (ko) * | 2021-08-09 | 2024-04-09 | 제넨테크, 인크. | Brm의 조절에 사용하기 위한 페놀 유도체 |
| CN120152970A (zh) * | 2022-10-03 | 2025-06-13 | 普莱鲁德疗法有限公司 | 使用smarca2降解剂和kras靶向疗法的组合实现的癌症治疗 |
| CN119638700B (zh) * | 2024-11-01 | 2025-11-14 | 中科中山药物创新研究院 | 一种nsd2降解剂及其应用 |
Citations (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3657744A (en) | 1970-05-08 | 1972-04-25 | Univ Minnesota | Method for fixing prosthetic implants in a living body |
| US4739762A (en) | 1985-11-07 | 1988-04-26 | Expandable Grafts Partnership | Expandable intraluminal graft, and method and apparatus for implanting an expandable intraluminal graft |
| US4992445A (en) | 1987-06-12 | 1991-02-12 | American Cyanamid Co. | Transdermal delivery of pharmaceuticals |
| US5001139A (en) | 1987-06-12 | 1991-03-19 | American Cyanamid Company | Enchancers for the transdermal flux of nivadipine |
| US5023252A (en) | 1985-12-04 | 1991-06-11 | Conrex Pharmaceutical Corporation | Transdermal and trans-membrane delivery of drugs |
| US5040548A (en) | 1989-06-01 | 1991-08-20 | Yock Paul G | Angioplasty mehtod |
| US5061273A (en) | 1989-06-01 | 1991-10-29 | Yock Paul G | Angioplasty apparatus facilitating rapid exchanges |
| US5195984A (en) | 1988-10-04 | 1993-03-23 | Expandable Grafts Partnership | Expandable intraluminal graft |
| US5292331A (en) | 1989-08-24 | 1994-03-08 | Applied Vascular Engineering, Inc. | Endovascular support device |
| US5451233A (en) | 1986-04-15 | 1995-09-19 | Yock; Paul G. | Angioplasty apparatus facilitating rapid exchanges |
| US5496346A (en) | 1987-01-06 | 1996-03-05 | Advanced Cardiovascular Systems, Inc. | Reinforced balloon dilatation catheter with slitted exchange sleeve and method |
| US5674278A (en) | 1989-08-24 | 1997-10-07 | Arterial Vascular Engineering, Inc. | Endovascular support device |
| US6344053B1 (en) | 1993-12-22 | 2002-02-05 | Medtronic Ave, Inc. | Endovascular support device and method |
| WO2016138114A1 (en) * | 2015-02-25 | 2016-09-01 | Genentech, Inc. | Therapeutic pyridazine compounds and uses thereof |
| WO2018140809A1 (en) | 2017-01-26 | 2018-08-02 | Arvinas, Inc. | Modulators of estrogen receptor proteolysis and associated methods of use |
| WO2019084030A1 (en) | 2017-10-24 | 2019-05-02 | Genentech, Inc. | (4-HYDROXYPYRROLIDIN-2-YL) -HYDROXAMATE COMPOUNDS AND METHODS OF USE |
| WO2019084026A1 (en) | 2017-10-24 | 2019-05-02 | Genentech, Inc. | (4-HYDROXYPYRROLIDIN-2-YL) -HETEROCYCLIC COMPOUNDS AND METHODS OF USE |
| US20190255066A1 (en) | 2016-09-14 | 2019-08-22 | University Of Dundee | Fluorohydroxyproline derivatives useful in the preparation of proteolysis targeted chimeras |
| US20190300521A1 (en) | 2018-04-01 | 2019-10-03 | Arvinas Operations, Inc. | Brm targeting compounds and associated methods of use |
| US20200038378A1 (en) | 2018-04-01 | 2020-02-06 | Arvinas Operations, Inc. | Brm targeting compounds and associated methods of use |
| WO2021133920A1 (en) * | 2019-12-23 | 2021-07-01 | Kymera Therapeutics, Inc. | Smarca degraders and uses thereof |
| WO2021133917A1 (en) * | 2019-12-23 | 2021-07-01 | Kymera Therapeutics, Inc. | Smarca inhibitors and uses thereof |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20250117470A (ko) | 2016-12-23 | 2025-08-04 | 아비나스 오퍼레이션스, 인코포레이티드 | 급속 진행성 섬유육종 폴리펩티드의 표적화 분해를 위한 화합물 및 방법 |
| WO2020251974A1 (en) | 2019-06-10 | 2020-12-17 | Kymera Therapeutics, Inc. | Smarca inhibitors and uses thereof |
| US20230072658A1 (en) | 2019-06-10 | 2023-03-09 | Kymera Therapeutics, Inc. | Smarca degraders and uses thereof |
| WO2020251972A1 (en) | 2019-06-10 | 2020-12-17 | Kymera Therapeutics, Inc. | Smarca degraders and uses thereof |
| WO2020251969A1 (en) | 2019-06-10 | 2020-12-17 | Kymera Therapeutics, Inc. | Smarca degraders and uses thereof |
| WO2022099117A1 (en) * | 2020-11-06 | 2022-05-12 | Prelude Therapeutics Incorporated | Brm targeting compounds and associated methods of use |
-
2021
- 2021-06-09 CN CN202180049461.6A patent/CN115867554B/zh active Active
- 2021-06-09 CA CA3185888A patent/CA3185888A1/en active Pending
- 2021-06-09 EP EP21736890.1A patent/EP4161935B1/en active Active
- 2021-06-09 JP JP2022575824A patent/JP2023529908A/ja active Pending
- 2021-06-09 IL IL298933A patent/IL298933B1/en unknown
- 2021-06-09 ES ES21736890T patent/ES3034380T3/es active Active
- 2021-06-09 AU AU2021289730A patent/AU2021289730A1/en active Pending
- 2021-06-09 US US17/343,341 patent/US11702423B2/en active Active
- 2021-06-09 WO PCT/US2021/036664 patent/WO2021252666A1/en not_active Ceased
- 2021-06-09 MX MX2022015732A patent/MX2022015732A/es unknown
- 2021-06-09 PT PT217368901T patent/PT4161935T/pt unknown
- 2021-06-09 DK DK21736890.1T patent/DK4161935T3/da active
- 2021-06-09 PL PL21736890.1T patent/PL4161935T3/pl unknown
- 2021-06-09 BR BR112022025061A patent/BR112022025061A2/pt unknown
- 2021-06-09 KR KR1020237000892A patent/KR20230037549A/ko active Pending
- 2021-06-09 FI FIEP21736890.1T patent/FI4161935T3/fi active
- 2021-06-09 EP EP25173100.6A patent/EP4570319A3/en active Pending
-
2023
- 2023-05-15 US US18/317,352 patent/US20240018158A1/en active Pending
Patent Citations (25)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3657744A (en) | 1970-05-08 | 1972-04-25 | Univ Minnesota | Method for fixing prosthetic implants in a living body |
| US4739762A (en) | 1985-11-07 | 1988-04-26 | Expandable Grafts Partnership | Expandable intraluminal graft, and method and apparatus for implanting an expandable intraluminal graft |
| US4739762B1 (en) | 1985-11-07 | 1998-10-27 | Expandable Grafts Partnership | Expandable intraluminal graft and method and apparatus for implanting an expandable intraluminal graft |
| US5023252A (en) | 1985-12-04 | 1991-06-11 | Conrex Pharmaceutical Corporation | Transdermal and trans-membrane delivery of drugs |
| US5451233A (en) | 1986-04-15 | 1995-09-19 | Yock; Paul G. | Angioplasty apparatus facilitating rapid exchanges |
| US5496346A (en) | 1987-01-06 | 1996-03-05 | Advanced Cardiovascular Systems, Inc. | Reinforced balloon dilatation catheter with slitted exchange sleeve and method |
| US4992445A (en) | 1987-06-12 | 1991-02-12 | American Cyanamid Co. | Transdermal delivery of pharmaceuticals |
| US5001139A (en) | 1987-06-12 | 1991-03-19 | American Cyanamid Company | Enchancers for the transdermal flux of nivadipine |
| US5195984A (en) | 1988-10-04 | 1993-03-23 | Expandable Grafts Partnership | Expandable intraluminal graft |
| US5061273A (en) | 1989-06-01 | 1991-10-29 | Yock Paul G | Angioplasty apparatus facilitating rapid exchanges |
| US5040548A (en) | 1989-06-01 | 1991-08-20 | Yock Paul G | Angioplasty mehtod |
| US5292331A (en) | 1989-08-24 | 1994-03-08 | Applied Vascular Engineering, Inc. | Endovascular support device |
| US5674278A (en) | 1989-08-24 | 1997-10-07 | Arterial Vascular Engineering, Inc. | Endovascular support device |
| US5879382A (en) | 1989-08-24 | 1999-03-09 | Boneau; Michael D. | Endovascular support device and method |
| US6344053B1 (en) | 1993-12-22 | 2002-02-05 | Medtronic Ave, Inc. | Endovascular support device and method |
| WO2016138114A1 (en) * | 2015-02-25 | 2016-09-01 | Genentech, Inc. | Therapeutic pyridazine compounds and uses thereof |
| US20190255066A1 (en) | 2016-09-14 | 2019-08-22 | University Of Dundee | Fluorohydroxyproline derivatives useful in the preparation of proteolysis targeted chimeras |
| WO2018140809A1 (en) | 2017-01-26 | 2018-08-02 | Arvinas, Inc. | Modulators of estrogen receptor proteolysis and associated methods of use |
| WO2019084030A1 (en) | 2017-10-24 | 2019-05-02 | Genentech, Inc. | (4-HYDROXYPYRROLIDIN-2-YL) -HYDROXAMATE COMPOUNDS AND METHODS OF USE |
| WO2019084026A1 (en) | 2017-10-24 | 2019-05-02 | Genentech, Inc. | (4-HYDROXYPYRROLIDIN-2-YL) -HETEROCYCLIC COMPOUNDS AND METHODS OF USE |
| US20190300521A1 (en) | 2018-04-01 | 2019-10-03 | Arvinas Operations, Inc. | Brm targeting compounds and associated methods of use |
| WO2019195201A1 (en) * | 2018-04-01 | 2019-10-10 | Arvinas Operations, Inc. | Brm targeting compounds and associated methods of use |
| US20200038378A1 (en) | 2018-04-01 | 2020-02-06 | Arvinas Operations, Inc. | Brm targeting compounds and associated methods of use |
| WO2021133920A1 (en) * | 2019-12-23 | 2021-07-01 | Kymera Therapeutics, Inc. | Smarca degraders and uses thereof |
| WO2021133917A1 (en) * | 2019-12-23 | 2021-07-01 | Kymera Therapeutics, Inc. | Smarca inhibitors and uses thereof |
Non-Patent Citations (7)
| Title |
|---|
| "Handbook of Clinical Drug Data", 2002, MCGRAW-HILL |
| "Principles of Drug Action", 1990, CHURCHILL LIVINGSTON |
| "Remingtons Pharmaceutical Sciences", 2000, LIPPINCOTT WILLIAMS & WILKINS |
| "The Pharmacological Basis of Therapeutics", 2001, MCGRAW HILL |
| CHOOI ET AL., CANCER RES, 2018 |
| MARTINDALE: "The Extra Pharmacopoeia", 1999, THE PHARMACEUTICAL PRESS |
| VANGAMUDI ET AL., CANCER RES, 2015 |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12516068B2 (en) | 2018-01-12 | 2026-01-06 | Kymera Therapeutics, Inc. | Protein degraders and uses thereof |
| US12454520B2 (en) | 2018-07-06 | 2025-10-28 | Kymera Therapeutics, Inc. | Protein degraders and uses thereof |
| US12521438B2 (en) | 2019-06-10 | 2026-01-13 | Kymera Therapeutics, Inc. | SMARCA degraders and uses thereof |
| US11679109B2 (en) | 2019-12-23 | 2023-06-20 | Kymera Therapeutics, Inc. | SMARCA degraders and uses thereof |
| US12569485B2 (en) | 2019-12-23 | 2026-03-10 | Kymera Therapeutics, Inc. | SMARCA inhibitors and uses thereof |
| WO2022099117A1 (en) * | 2020-11-06 | 2022-05-12 | Prelude Therapeutics Incorporated | Brm targeting compounds and associated methods of use |
| US12448389B2 (en) | 2020-11-06 | 2025-10-21 | Prelude Therapeutics Incorporated | BRM targeting compounds and associated methods of use |
| US12606568B2 (en) | 2020-12-09 | 2026-04-21 | Kymera Therapeutics, Inc. | SMARCA degraders and uses thereof |
| EP4363425A4 (en) * | 2021-06-28 | 2025-05-14 | Kymera Therapeutics, Inc. | SMARCA DEGRADERS AND USES THEREOF |
| JP2025516584A (ja) * | 2022-05-10 | 2025-05-30 | フォグホーン セラピューティクス インコーポレイテッド | 化合物及びその使用 |
| WO2023220577A1 (en) * | 2022-05-10 | 2023-11-16 | Prelude Therapeutics, Incorporated | 6,6a,7,8,9,10-hexahydro-5h-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazine derivatives as smarca4 protein degraders for the treatment of cancer |
| WO2024064328A1 (en) * | 2022-09-23 | 2024-03-28 | Regents Of The University Of Michigan | Compounds and compositions as smarca2/4 degraders and uses thereof |
| WO2024064316A1 (en) * | 2022-09-23 | 2024-03-28 | Regents Of The University Of Michigan | Compounds and compositions as smarca2/4 inhibitors and uses thereof |
| WO2024214019A1 (en) | 2023-04-12 | 2024-10-17 | Aurigene Oncology Limited | Tetracyclic compounds as smarca2 and/or smarca4 degraders |
| WO2025076351A1 (en) | 2023-10-04 | 2025-04-10 | Prelude Therapeutics Incorporated | Combination treatment regimens - smarca2 degrader with gemcitabine |
| WO2025076357A1 (en) | 2023-10-04 | 2025-04-10 | Prelude Therapeutics Incorporated | Combination treatment regimens - smarca2 degrader with taxane anticancer agent |
| WO2025076347A1 (en) | 2023-10-04 | 2025-04-10 | Prelude Therapeutics Incorporated | Combination treatment regimens - smarca2 degrader with pd-1 inhibitors |
| WO2025106482A1 (en) * | 2023-11-13 | 2025-05-22 | Oncopia Therapeutics, Inc. D/B/A Sk Life Science Labs | Compounds and compositions as smarca2/4 degraders and uses thereof |
| WO2025193454A1 (en) | 2024-03-01 | 2025-09-18 | Prelude Therapeutics Incorporated | Brm and brg1 targeting antibody-drug conjugates and methods of use thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3185888A1 (en) | 2021-12-16 |
| EP4161935A1 (en) | 2023-04-12 |
| JP2023529908A (ja) | 2023-07-12 |
| FI4161935T3 (fi) | 2025-08-19 |
| BR112022025061A2 (pt) | 2023-01-31 |
| PL4161935T3 (pl) | 2025-09-08 |
| EP4570319A3 (en) | 2025-08-20 |
| US11702423B2 (en) | 2023-07-18 |
| IL298933B1 (en) | 2026-04-01 |
| PT4161935T (pt) | 2025-08-14 |
| EP4570319A2 (en) | 2025-06-18 |
| EP4161935B1 (en) | 2025-05-21 |
| IL298933A (en) | 2023-02-01 |
| DK4161935T3 (da) | 2025-08-18 |
| US20240018158A1 (en) | 2024-01-18 |
| AU2021289730A8 (en) | 2023-02-02 |
| US20220033409A1 (en) | 2022-02-03 |
| MX2022015732A (es) | 2023-02-13 |
| ES3034380T3 (en) | 2025-08-18 |
| CN115867554B (zh) | 2025-09-02 |
| CN115867554A (zh) | 2023-03-28 |
| AU2021289730A1 (en) | 2023-01-19 |
| KR20230037549A (ko) | 2023-03-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP4161935B1 (en) | Brm targeting compounds and associated methods of use | |
| JP2023549341A (ja) | Brm標的化化合物及び関連する使用方法 | |
| AU2023269778A1 (en) | 6,6a,7,8,9,10-hexahydro-5h-pyrazino[1',2':4,5]pyrazino[2,3-c]pyridazine derivatives as smarca4 protein degraders for the treatment of cancer | |
| US20240190886A1 (en) | BRM Targeting Compounds and Associated Methods of Use | |
| AU2023264018A1 (en) | Tetrahydroisoquinoline heterobifunctional bcl-xl degraders | |
| US20230416240A1 (en) | Kat6 targeting compounds | |
| US20240336612A1 (en) | BRM Targeting Compounds And Associated Methods Of Use | |
| HK40128204A (en) | Brm targeting compounds and associated methods of use | |
| EA048707B1 (ru) | Brm направленные соединения и связанные способы применения | |
| EA050840B1 (ru) | Brm направленные соединения и связанные способы применения | |
| US20250161289A1 (en) | KAT6 Targeting Compounds | |
| WO2025117881A1 (en) | Compounds and methods for inhibiting autophagy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21736890 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3185888 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022575824 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022025061 Country of ref document: BR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202317000173 Country of ref document: IN |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021289730 Country of ref document: AU Date of ref document: 20210609 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2021736890 Country of ref document: EP Effective date: 20230109 |
|
| ENP | Entry into the national phase |
Ref document number: 112022025061 Country of ref document: BR Kind code of ref document: A2 Effective date: 20221208 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2021736890 Country of ref document: EP |
|
| WWG | Wipo information: grant in national office |
Ref document number: 202180049461.6 Country of ref document: CN |