WO2021216776A2 - Capping compounds, compositions and methods of use thereof - Google Patents

Capping compounds, compositions and methods of use thereof Download PDF

Info

Publication number
WO2021216776A2
WO2021216776A2 PCT/US2021/028486 US2021028486W WO2021216776A2 WO 2021216776 A2 WO2021216776 A2 WO 2021216776A2 US 2021028486 W US2021028486 W US 2021028486W WO 2021216776 A2 WO2021216776 A2 WO 2021216776A2
Authority
WO
WIPO (PCT)
Prior art keywords
sequence
nucleic acid
encoding nucleic
acid sequence
epitope
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2021/028486
Other languages
English (en)
French (fr)
Other versions
WO2021216776A3 (en
Inventor
Karin Jooss
Amy Rachel Rappaport
Ciaran Daniel SCALLAN
Leonid Gitlin
Sue-Jean HONG
Arvin AKOOPIE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Gritstone Bio Inc
Original Assignee
Gritstone Bio Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2022563870A priority Critical patent/JP2023523414A/ja
Priority to CA3173803A priority patent/CA3173803A1/en
Priority to IL296855A priority patent/IL296855A/en
Priority to KR1020227040442A priority patent/KR20230015914A/ko
Priority to CN202180044091.7A priority patent/CN115768437A/zh
Priority to EP21792935.5A priority patent/EP4138854A4/en
Application filed by Gritstone Bio Inc filed Critical Gritstone Bio Inc
Priority to AU2021260932A priority patent/AU2021260932A1/en
Publication of WO2021216776A2 publication Critical patent/WO2021216776A2/en
Publication of WO2021216776A3 publication Critical patent/WO2021216776A3/en
Priority to US18/048,407 priority patent/US20230303614A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H21/00Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/713Double-stranded nucleic acids or oligonucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/54Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
    • A61K47/549Sugars, nucleosides, nucleotides or nucleic acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H1/00Processes for the preparation of sugar derivatives
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H1/00Processes for the preparation of sugar derivatives
    • C07H1/02Phosphorylation
    • C07H1/04Introducing polyphosphoric acid radicals
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07HSUGARS; DERIVATIVES THEREOF; NUCLEOSIDES; NUCLEOTIDES; NUCLEIC ACIDS
    • C07H21/00Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids
    • C07H21/02Compounds containing two or more mononucleotide units having separate phosphate or polyphosphate groups linked by saccharide radicals of nucleoside groups, e.g. nucleic acids with ribosyl as saccharide radical
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6018Lipids, e.g. in lipopeptides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/36011Togaviridae
    • C12N2770/36111Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
    • C12N2770/36134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/36011Togaviridae
    • C12N2770/36111Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
    • C12N2770/36141Use of virus, viral particle or viral elements as a vector
    • C12N2770/36143Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/36011Togaviridae
    • C12N2770/36111Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
    • C12N2770/36151Methods of production or purification of viral material
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011Details
    • C12N2770/36011Togaviridae
    • C12N2770/36111Alphavirus, e.g. Sindbis virus, VEE, EEE, WEE, Semliki
    • C12N2770/36171Demonstrated in vivo effect

Definitions

  • mRNA messenger RNA
  • mRNA messenger RNA
  • mRNA messenger RNA
  • One of these elements is a Cap structure on the 5'- end of mRNAs, which is present in all eukaryotic organisms (and some viruses).
  • Naturally occurring Cap structures comprise a ribo-guanosine residue that is methylated at position N7 of the guanine base. This 7-methylguanosine ( 7m G) is linked via a 5'- to 5 '-triphosphate chain at the 5 '-end of the mRNA molecule.
  • the presence of the 7m Gppp fragment on the 5'- end is essential for mRNA maturation, it protects the mRNAs from degradation by exonucleases, facilitates transport of mRNAs from the nucleus to the cytoplasm, and plays a key role in assembly of the translation initiation complex.
  • compositions and methods that allow for large scale synthesis of mRNAs that are (a) less laborious than conventional methods, (b) eliminate or reduce bi-directional initiation during transcription, (c) result in higher yields of mRNA, at a (d) reduced cost compared to current methods, (e) reduces production of heterogeneous products with different 5 '-sequences and (f) does not require additional enzymatic reactions to incorporate Cap 1 and Cap 2 structures into the synthesized mRNA.
  • the present disclosure includes, among other things, a compound of formula (I): or a pharmaceutically acceptable salt thereof. Additionally, the present disclosure includes, among other things, pharmaceutical compositions, methods of using and methods of making a compound of formula (I).
  • R 1 is a nucleoside
  • R 2 is a nucleoside
  • R 3 is a halogen, optionally substituted C1-C3 alkyl, or a substituted C1-C3 alkoxy;
  • R 4 is hydrogen or optionally substituted C1-C 3 aliphatic;
  • R 5 is hydrogen or optionally substituted C1-C 3 aliphatic; and each X is independently O or S, and optionally, wherein the compound is of Formula (1-1):
  • R 1 is adenine. In some aspects, R 1 is N6-methylated adenine. In some aspects, R 2 is uracil. In some aspects, R 3 is selected from the group consisting of fluorine, -CF3, -OCF3 and -OCH2CH2OCH3. In some aspects, the compound is selected from the group consisting of:
  • RNA oligonucleotide comprises any of the compounds described herein.
  • the cancer is selected from the group consisting of lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, bladder cancer, brain cancer, B-cell lymphoma, acute myelogenous leukemia, adult acute lymphoblastic leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, non-small cell lung cancer, and small cell lung cancer.
  • the cancer is a solid tumor.
  • the cancer is selected from the group consisting of: MSS-CRC, NSCLC, and PDA.
  • the cancer is selected from the group consisting of: microsatellite stable-colorectal cancer (MSS-CRC), non-small cell lung cancer (NSCLC), pancreatic ductal adenocarcinoma (PDA), and gastroesophageal adenocarcinoma (GEA).
  • MSS-CRC microsatellite stable-colorectal cancer
  • NSCLC non-small cell lung cancer
  • PDA pancreatic ductal adenocarcinoma
  • GSA gastroesophageal adenocarcinoma
  • RNA oligonucleotide comprises any of the compounds described herein.
  • the infection is a fungal infection.
  • the infection is a viral infection.
  • the viral infection is an HIV infection.
  • a complex comprising an initiating capped oligonucleotide primer and a DNA template, wherein the initiating capped oligonucleotide primer comprises any of the compounds described herein, wherein the DNA template comprises a promoter region comprising a transcriptional start site having a first nucleotide at nucleotide position + 1 and a second nucleotide at nucleotide position +2; and wherein the initiating capped oligonucleotide primer is hybridized to the DNA template at least at nucleotide positions +1 and +2.
  • a self-amplifying expression system comprising a self-amplifying backbone, wherein the self-amplifying backbone comprises one or more polynucleotide sequences of a self-replicating RNA virus; and wherein the self-amplifying expression system comprises a nucleic acid sequence, wherein each element is linked from 5’ to 3’, described by the formula: m 7 G-ppp-Ni-N2-Nv, wherein m 7 G is a 7-methylguanylate (m 7 G) cap, ppp is a triphosphate bridge,
  • Ni is a first nucleotide of the self-amplifying backbone corresponding to a first endogenous 5’ nucleotide of the self-replicating RNA virus
  • Nz is a second nucleotide of the self-amplifying backbone corresponding to a second endogenous 5’ nucleotide of the self-replicating RNA virus
  • Nv comprises (1) one or more additional nucleic acid sequences of the self-amplifying backbone, and (2) a cassette comprising at least one exogenous nucleic acid sequence for delivery, optionally wherein the at least one exognous nucleic acid sequence comprises a polypeptide-encoding nucleic acid sequence, optionally wherein the polypeptide encoding nucleic acid sequence is an antigen-encoding nucleic acid sequence, and wherein the cassette is operably linked to or operably inserted into the self-amplifying backbone.
  • the composition for delivery of the self-amplifying expression system comprises: (A) the self-amplifying expression system, wherein the self-amplifying expression system comprises one or more self-amplifying mRNA (SAM) vectors, wherein the one or more SAM vectors comprise: (a) the self-amplifying backbone, wherein the self- amplifying backbone comprises: (i) at least one promoter nucleotide sequence, (ii) at least one polyadenylation (poly(A)) sequence, and (b) the cassette, optionally wherein the cassette comprises one or more of: (i) the least one antigen-encoding nucleic acid sequence comprising: a.
  • SAM self-amplifying mRNA
  • an epitope-encoding nucleic acid sequence optionally comprising: (1) at least one alteration that makes the encoded epitope sequence distinct from the corresponding peptide sequence encoded by a wild-type nucleic acid sequence, or (2) a nucleic acid sequence encoding an infectious disease organism peptide selected from the group consisting of: a pathogen-derived peptide, a virus-derived peptide, a bacteria-derived peptide, a fungus- derived peptide, and a parasite-derived peptide, b. optionally a 5’ linker sequence, and c.
  • a 3’ linker sequence optionally a second promoter nucleotide sequence operably linked to the at least one antigen-encoding nucleic acid sequence; or (iii) optionally, at least one second poly (A) sequence, wherein the second poly (A) sequence is a native poly (A) sequence or an exogenous poly(A) sequence to the self-replicating RNA virus; and (B) optionally, a lipid- nanoparticle (LNP), wherein the LNP encapsulates the self-amplifying expression system.
  • LNP lipid- nanoparticle
  • the composition for delivery of the self-amplifying expression system comprises: (A) the self-amplifying expression system, wherein the self-amplifying expression system comprises one or more self-amplifying mRNA (SAM) vectors, wherein the one or more SAM vectors comprise: (a) the self-amplifying backbone, wherein the self-amplifying backbone comprises the nucleic acid sequence set forth in SEQ ID NO: 6, wherein the self-amplifying backbone sequence comprises a subgenomic promoter nucleotide sequence and a poly(A) sequence, wherein the subgenomic promoter sequence is endogenous to the self-replicating RNA virus, wherein the poly(A) sequence is endogenous to the self- replicating RNA virus backbone; and (b) the cassette integrated between the subgenomic promoter nucleotide sequence and the poly(A) sequence, wherein the cassette is operably linked to the subgenomic promoter nucleotide sequence, and optionally wherein
  • SAM self-amp
  • an epitope encoding nucleic acid sequence optionally comprising: (1) at least one alteration that makes the encoded epitope sequence distinct from the corresponding peptide sequence encoded by a wild-type nucleic acid sequence, or (2) a nucleic acid sequence encoding an infectious disease organism peptide selected from the group consisting of: a pathogen-derived peptide, a virus-derived peptide, a bacteria-derived peptide, a fungus-derived peptide, and a parasite- derived peptide, b. optionally a 5’ linker sequence, and c. optionally a 3’ linker sequence; and (B) optionally, a lipid-nanoparticle (LNP), wherein the LNP encapsulates the self-amplifying expression system.
  • LNP lipid-nanoparticle
  • Ni is a modified nucleotide, optionally wherein the modified nucleotide comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • Ni is a modified adenosine.
  • Ni is a N6-methyladenosine 2’-OH-methylated.
  • N2 is a modified nucleotide, optionally wherein the modified nucleotide comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • Ni and N2 are modified nucleotides, optionally wherein the modified nucleotides each independently comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • Ni is an adenosine or modified adenosine, optionally wherein the modified adenosine comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • N2 is a uridine or modified uridine, optionally wherein the modified uridine comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • Ni is a modified adenosine, optionally wherein the modified adenosine comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose, and N2 is a uridine.
  • the modified adenosine comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose, and N2 is a uridine.
  • m 7 G-ppp-Ni-N2 is represented by Formula (1-1):
  • R 1 is a nucleoside, optionally wherein R 1 is adenine, optionally wherein R 1 is N6-methylated adenine;
  • R 2 is a nucleoside, optionally wherein R 2 is uracil;
  • R 3 is a halogen, optionally substituted C1-C3 alkyl, or substituted C1-C3 alkoxy.
  • R 3 is selected from the group consisting of fluorine, -CF3, -OCF3 and -OCH2CH2OCH3.
  • m 7 G-ppp-Ni-N2 is represented by a formula selected from the group consisting of:
  • the self-amplifying expression system is produced by in vitro transcription.
  • the in vitro transscription process comprises use of an iniating capped oligonucleotide comprising any of m 7 G-ppp-Ni-N2 described herein.
  • a complex comprising an initiating capped oligonucleotide primer and a DNA template, wherein the initiating capped oligonucleotide primer comprises any compound with formula m 7 G-ppp-Ni-N2 described herein, wherein the DNA template, from 5’ to 3’, comprises: (A) an RNA transcriptional promoter region comprising a transcriptional start site having a first nucleotide at nucleotide position + 1 and a second nucleotide at nucleotide position +2, and (B) a sequence comprising any sequence with formula N1-N2-NV described herein operably linked to the RNA transcriptional promoter region.
  • the RNA transcriptional promoter region comprises a T7 promoter sequence, optionally wherein the T7 promoter sequence is the nucleotide sequence TAATACGACTCACTATA or TAATACGACTCACTATT, a SP6 promoter sequence, optionally wherein the SP6 promoter sequence is the nucleotide sequence ATTTAGGTGACACTATA, or a K11 RNAP promoter sequence, optionally wherein the K11 RNAP promoter sequence is the nucleotide sequence AATTAGGGCACACTATA.
  • the DNA template comprises the sequence set forth in SEQ ID NO:57, and wherein the cassette is inserted at position 7544 as set forth in the sequence of SEQ ID NO:6 to replace the deletion between base pairs 7544 and 11175 as set forth in the sequence of SEQ ID NO:3 or SEQ ID NO:5.
  • an ordered sequence of each element of the cassette in the composition for delivery of the self-amplifying expression system is described in the formula, from 5’ to 3’, comprising: Pa-(L5 b -Nc-L3 d )x-(G5e-Uf) Y -G3g
  • P comprises the second promoter nucleotide sequence
  • a 0 or 1
  • N comprises one of the epitope-encoding nucleic acid sequences
  • the epitope-encoding nucleic acid sequence comprises an MHC class I epitope-encoding nucleic acid sequence
  • c 1
  • L5 comprises the 5’ linker sequence
  • b 0 or 1
  • L3 comprises the 3’ linker sequence
  • d 0 or 1
  • G5 comprises one of the at least one nucleic acid sequences encoding a GPGPG amino acid linker
  • e 0 or 1
  • G3 comprises one of the at least one nucleic acid sequences encoding a GPGPG
  • the corresponding N c is a distinct MHC class I epitope-encoding nucleic acid sequence.
  • the corresponding Uf is a distinct MHC class II epitope-encoding nucleic acid sequence.
  • the at least one promoter nucleotide sequence is a single subgenomic promoter nucleotide sequence provided by the self-amplifying backbone
  • the at least one polyadenylation poly(A) sequence is a poly(A) sequence of at least 80 consecutive A nucleotides provided by the self-amplifying backbone
  • the cassette is integrated between the subgenomic promoter nucleotide sequence and the poly(A) sequence, wherein the cassette is operably linked to the subgenomic promoter nucleotide sequence and the poly(A) sequence, each N encodes a MHC class I epitope 7-15 amino acids in length
  • L5 is a native 5’ linker sequence that encodes a native N-terminal amino acid sequence of the MHC I epitope, and wherein the 5’ linker sequence encodes a peptide that is at least 3 amino acids in length
  • L5 is a native 5’ linker sequence that encodes a native N-terminal amino acid sequence of the MHC I epitope
  • the at least one exogenous nucleic acid sequence for delivery comprises the polypeptide-encoding nucleic acid sequence.
  • the polypeptide encoding nucleic acid sequence encodes the antigen-encoding nucleic acid sequence.
  • the antigen-encoding nucleic acid sequence comprises a MHC class I epitope, a MHC class II epitope, an epitope capable of stimulating a B cell response, or a combination thereof.
  • the antigen-encoding nucleic acid sequence comprises sequence encoding a full-length protein, a protein subunit, a protein domain, or a combination thereof.
  • the polypeptide-encoding nucleic acid sequence encodes a full-length protein or functional portion thereof.
  • the full-length protein or functional portion thereof is selected from the group consisting of: an antibody, a cytokine, a chimeric antigen receptor (CAR), a T-cell receptor, and a genome-editing system nuclease.
  • the at least one exogenous nucleic acid sequence for delivery comprises at least one nucleic acid sequence comprising a non-coding nucleic acid sequence.
  • the non-coding nucleic acid sequence is an RNA interference (RNAi) polynucleotide or genome-editing system polynucleotide.
  • the LNP comprises a lipid selected from the group consisting of: an ionizable amino lipid, a cationic lipid, a phosphatidylcholine, cholesterol, a PEG-based coat lipid, or a combination thereof.
  • the LNP comprises an ionizable amino lipid, a phosphatidylcholine, cholesterol, and a PEG-based coat lipid.
  • the ionizable amino lipids comprise MC3-like (dilinoleylmethyl-4-dimethylaminobutyrate) molecules.
  • the LNP-encapsulated expression system has a diameter of about lOOnm. In some aspects, the LNP-encapsulated expression system has a diameter between 60-140nm.
  • composition for delivery of the self-amplifying expression system is formulated for intramuscular (IM), intradermal (ID), subcutaneous (SC), intravitreal (IVT), intrathecal, or intravenous (IV) administration.
  • composition for delivery of the self-amplifying expression system is formulated for intramuscular (IM) administration.
  • the cassette is integrated between the at least one promoter nucleotide sequence and the at least one poly(A) sequence.
  • the at least one promoter nucleotide sequence is operably linked to the cassette.
  • the one or more SAM vectors comprises one or more positive- stranded RNA vectors. In some aspects, the one or more SAM vectors comprise one or more negative- stranded RNA vectors. In some aspects, the one or more negative- stranded RNA vector comprises at least one polynucleotide sequence of a measles virus or a rhabdovirus. [0028] In some aspects, the one or more SAM vectors are self-amplifying within a mammalian cell. In some aspects, the self-replicating RNA virus is selected from the group consisting of: an alphavirus; a flavivirus, a measles, and a rhabdovirus.
  • the self-amplifying backbone comprises at least one polynucleotide sequence of an alphavirus, optionally wherein the alphavirus is selected from the group consisting of: Aura virus, a Fort Morgan virus, a Venezuelan equine encephalitis virus, a Ross River virus, a Semliki Forest virus, a Sindbis virus, and a Mayaro virus.
  • the self-amplifying backbone comprises at least one nucleotide sequence of a Venezuelan equine encephalitis virus.
  • the self-amplifying backbone comprises at least sequences for nonstructural protein-mediated amplification, a subgenomic promoter sequence, a poly (A) sequence, a nonstructural protein 1 (nsPl) gene, a nsP2 gene, a nsP3 gene, and a nsP4 gene encoded by the nucleotide sequence of the Aura virus, the Fort Morgan virus, the Venezuelan equine encephalitis virus, the Ross River virus, the Semliki Forest virus, the Sindbis virus, or the Mayaro virus.
  • A poly
  • nsPl nonstructural protein 1
  • the self-amplifying backbone comprises at least sequences for nonstructural protein-mediated amplification, a subgenomic promoter sequence, and a poly(A) sequence encoded by the nucleotide sequence of the Aura virus, the Fort Morgan virus, the Venezuelan equine encephalitis virus, the Ross River virus, the Semliki Forest virus, the Sindbis virus, or the Mayaro virus.
  • sequences for nonstructural protein-mediated amplification are selected from the group consisting of: an alphavirus 5’ UTR, a 51-nt CSE, a 24-nt CSE, a 26S subgenomic promoter sequence, a 19-nt CSE, an alphavirus 3’ UTR, or combinations thereof.
  • the self-amplifying backbone does not encode structural virion proteins capsid, E2 and El, optionally wherein El is a full-length El, or does not encode structural virion proteins Capsid, E3, E2, 6K.
  • the cassette is inserted in place of structural virion proteins within the polynucleotide sequence of the Aura virus, the Fort Morgan virus, the Venezuelan equine encephalitis virus, the Ross River virus, the Semliki Forest virus, the Sindbis virus, or the Mayaro virus.
  • the Venezuelan equine encephalitis virus comprises the sequence of SEQ ID NO:3 or SEQ ID NO:5.
  • Venezuelan equine encephalitis virus comprises the sequence of SEQ ID NO:3 or SEQ ID NO:5 further comprising a deletion between base pair 7544 and 11175.
  • the self- amplifying backbone comprises the sequence set forth in SEQ ID NO:6 or SEQ ID NO:7.
  • the cassette is inserted at position 7544 to replace the deletion between base pairs 7544 and 11175 as set forth in the sequence of SEQ ID NO: 3 or SEQ ID NO: 5.
  • the insertion of the cassette provides for transcription of a polycistronic RNA comprising the nsPl-4 genes and the at least one nucleic acid sequence, wherein the nsPl-4 genes and the at least one nucleic acid sequence are in separate open reading frames.
  • the at least one promoter nucleotide sequence is the native (also referred to as “endogenous”) promoter nucleotide sequence encoded by the self-replicating RNA virus, optionally wherein the native promoter nucleotide sequence is a subgenomic promoter nucleotide sequence.
  • the at least one promoter nucleotide sequence is an exogenous RNA promoter.
  • the second promoter nucleotide sequence is a subgenomic promoter nucleotide sequence.
  • the second promoter nucleotide sequence comprises multiple subgenomic promoter nucleotide sequences, wherein each subgenomic promoter nucleotide sequence provides for transcription of one or more of the separate open reading frames.
  • the one or more SAM vectors are each at least 300nt in size. In some aspects, the one or more SAM vectors are each at least lkb in size. In some aspects, the one or more SAM vectors are each 2kb in size. In some aspects, the SAM vectors are each less than 5kb in size.
  • the at least one antigen-encoding nucleic acid sequence comprises two or more antigen-encoding nucleic acid sequences. In some aspects, each antigen-encoding nucleic acid sequence is linked directly to one another.
  • each antigen-encoding nucleic acid sequence is linked to a distinct antigen-encoding nucleic acid sequence with a nucleic acid sequence encoding a linker.
  • the linker links two MHC class I epitope-encoding nucleic acid sequences or an MHC class I epitope-encoding nucleic acid sequence to an MHC class II epitope-encoding nucleic acid sequence.
  • the linker is selected from the group consisting of: (1) consecutive glycine residues, at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 residues in length; (2) consecutive alanine residues, at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 residues in length; (3) two arginine residues (RR); (4) alanine, alanine, tyrosine (AAY); (5) a consensus sequence at least 2, 3, 4, 5, 6, 7, 8 , 9, or 10 amino acid residues in length that is processed efficiently by a mammalian proteasome; and (6) one or more native sequences flanking the antigen derived from the cognate protein of origin and that is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 2-20 amino acid residues in length.
  • the linker links two MHC class II epitope-encoding nucleic acid sequences or an MHC class II sequence to an MHC class I epitope-encoding nucleic acid sequence.
  • the linker comprises the sequence GPGPG.
  • the antigen-encoding nucleic acid sequences is linked, operably or directly, to a separate or contiguous sequence that enhances the expression, stability, cell trafficking, processing and presentation, and/or immunogenicity of the epitope-encoding nucleic acid sequence.
  • the separate or contiguous sequence comprises at least one of: a ubiquitin sequence, a ubiquitin sequence modified to increase proteasome targeting (e.g., the ubiquitin sequence contains a Gly to Ala substitution at position 76), an immunoglobulin signal sequence (e.g., IgK), a major histocompatibility class I sequence, lysosomal-associated membrane protein (LAMP)-l, human dendritic cell lysosomal- associated membrane protein, and a major histocompatibility class II sequence; optionally wherein the ubiquitin sequence modified to increase proteasome targeting is A76.
  • a ubiquitin sequence e.g., the ubiquitin sequence contains a Gly to Ala substitution at position 76
  • an immunoglobulin signal sequence e.g., IgK
  • a major histocompatibility class I sequence e.g., lysosomal-associated membrane protein (LAMP)-l, human dendritic cell ly
  • the at least one antigen-encoding nucleic acid sequence comprises at least 2-10, 2, 3, 4, 5, 6, 7, 8, 9, or 10 antigen-encoding nucleic acid sequences, optionally wherein each antigen-encoding nucleic acid sequence encodes a distinct antigen encoding nucleic acid sequence.
  • the at least one antigen-encoding nucleic acid sequence comprises at least 11-20, 15-20, 11-100, 11-200, 11-300, 11-400, 11, 12, 13,
  • each antigen-encoding nucleic acid sequence encodes a distinct antigen-encoding nucleic acid sequence.
  • the at least one antigen-encoding nucleic acid sequence comprises at least 11-20, 15-20, 11-100, 11-200, 11-300, 11-400, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or up to 400 antigen-encoding nucleic acid sequences.
  • the at least one antigen-encoding nucleic acid sequence comprises at least 2-400 antigen encoding nucleic acid sequences and wherein at least two of the antigen-encoding nucleic acid sequences encode epitope sequences or portions thereof that are presented by MHC class I on a cell surface.
  • each antigen-encoding nucleic acid sequence independently comprises at least 2-10, 2, 3, 4, 5, 6, 7, 8, 9, or 10 epitope-encoding nucleic acid sequences, optionally wherein each epitope-encoding nucleic acid sequence encodes a distinct epitope-encoding nucleic acid sequence.
  • each antigen-encoding nucleic acid sequence independently comprises at least 11-20, 15-20, 11-100, 11-200, 11- 300, 11-400, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or up to 400 epitope-encoding nucleic acid sequences, optionally wherein each epitope-encoding nucleic acid sequence encodes a distinct epitope-encoding nucleic acid sequence.
  • each antigen-encoding nucleic acid sequence independently comprises at least 11-20, 15-20, 11-100, 11-200, 11- 300, 11-400, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or up to 400 epitope-encoding nucleic acid sequences.
  • each antigen-encoding nucleic acid sequence independently comprises at least 2-400 epitope-encoding nucleic acid sequences and wherein at least two of the epitope-encoding nucleic acid sequences encode epitope sequences or portions thereof that are presented by MHC class I on a cell surface.
  • At least two of the MHC class I epitopes are presented by MHC class I on a cell surface, optionally a tumor cell surface or an infected cell surface.
  • the epitope-encoding nucleic acid sequences comprises at least one MHC class I epitope-encoding nucleic acid sequence, and wherein each antigen-encoding nucleic acid sequence encodes a polypeptide sequence between 8 and 35 amino acids in length, optionally 9-17, 9-25, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
  • the at least one MHC class II epitope-encoding nucleic acid sequence is present. In some aspects, the at least one MHC class II epitope-encoding nucleic acid sequence is present and comprises at least one MHC class II epitope-encoding nucleic acid sequence that comprises at least one alteration that makes the encoded epitope sequence distinct from the corresponding peptide sequence encoded by a wild-type nucleic acid sequence.
  • the epitope-encoding nucleic acid sequence comprises an MHC class II epitope-encoding nucleic acid sequence and wherein each antigen-encoding nucleic acid sequence encodes a polypeptide sequence that is 12-20, 12, 13, 14, 15, 16, 17, 18, 19,
  • the epitope-encoding nucleic acid sequences comprises an MHC class II epitope-encoding nucleic acid sequence, wherein the at least one MHC class II epitope-encoding nucleic acid sequence is present, and wherein the at least one MHC class II epitope-encoding nucleic acid sequence comprises at least one universal MHC class II epitope-encoding nucleic acid sequence, optionally wherein the at least one universal sequence comprises at least one of Tetanus toxoid and PADRE.
  • the at least one promoter nucleotide sequence or the second promoter nucleotide sequence is inducible. In some aspects, the at least one promoter nucleotide sequence or the second promoter nucleotide sequence is non-inducible. In some aspects, the at least one poly(A) sequence comprises a poly(A) sequence native to the self- replicating virus. In some aspects, the at least one poly(A) sequence comprises a poly(A) sequence exogenous to the self-replicating virus. In some aspects, the at least one poly(A) sequence is operably linked to at least one of the at least one nucleic acid sequences.
  • the at least one poly(A) sequence is at least 20 , at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, or at least 120 consecutive A nucleotides. In some aspects, the at least one poly(A) sequence is at least 80 consecutive A nucleotides.
  • the epitope-encoding nucleic acid sequence comprises a MHC class I epitope-encoding nucleic acid sequence
  • the MHC class I epitope encoding nucleic acid sequence is selected by performing the steps of: (a) obtaining at least one of exome, transcriptome, or whole genome nucleotide sequencing data from a tumor, an infected cell, or an infectious disease organism, wherein the nucleotide sequencing data is used to obtain data representing peptide sequences of each of a set of epitopes; (b) inputting the peptide sequence of each epitope into a presentation model to generate a set of numerical likelihoods that each of the epitopes is presented by one or more of the MHC alleles on a cell surface, optionally a tumor cell surface or an infected cell surface, the set of numerical likelihoods having been identified at least based on received mass spectrometry data; and (c) selecting a subset of the set of epitopes based on the
  • each of the MHC class I epitope-encoding nucleic acid sequences is selected by performing the steps of: (a) obtaining at least one of exome, transcriptome, or whole genome nucleotide sequencing data from a tumor, an infected cell, or an infectious disease organism, wherein the nucleotide sequencing data is used to obtain data representing peptide sequences of each of a set of epitopes; (b) inputting the peptide sequence of each epitope into a presentation model to generate a set of numerical likelihoods that each of the epitopes is presented by one or more of the MHC alleles on a cell surface, optionally a tumor cell surface or an infected cell surface, the set of numerical likelihoods having been identified at least based on received mass spectrometry data; and (c) selecting a subset of the set of epitopes based on the set of numerical likelihoods to generate a set of selected epitopes which are used to generate the at least 20 MHC class I epitop
  • the presentation model represents dependence between: (a) presence of a pair of a particular one of the MHC alleles and a particular amino acid at a particular position of a peptide sequence; and (b) likelihood of presentation on a cell surface, optionally a tumor cell surface or an infected cell surface, by the particular one of the MHC alleles of the pair, of such a peptide sequence comprising the particular amino acid at the particular position.
  • selecting the set of selected epitopes comprises selecting epitopes that have an increased likelihood of being presented on a cell surface, optionally a tumor cell surface or an infected cell surface, relative to unselected epitopes based on the presentation model.
  • selecting the set of selected epitopes comprises selecting epitopes that have an increased likelihood of being capable of stimulating a tumor-specific or infectious disease organism-specific immune response in the subject relative to unselected epitopes based on the presentation model. In some aspects, selecting the set of selected epitopes comprises selecting epitopes that have an increased likelihood of being capable of being presented to naive T cells by professional antigen presenting cells (APCs) relative to unselected epitopes based on the presentation model, optionally wherein the APC is a dendritic cell (DC). In some aspects, selecting the set of selected epitopes comprises selecting epitopes that have a decreased likelihood of being subject to inhibition via central or peripheral tolerance relative to unselected epitopes based on the presentation model.
  • APCs professional antigen presenting cells
  • DC dendritic cell
  • selecting the set of selected epitopes comprises selecting epitopes that have a decreased likelihood of being capable of stimulating an autoimmune response to normal tissue in the subject relative to unselected epitopes based on the presentation model.
  • exome or transcriptome nucleotide sequencing data is obtained by performing sequencing on a tumor cell or tissue, an infected cell, or an infectious disease organism.
  • the sequencing is next generation sequencing (NGS) or any massively parallel sequencing approach.
  • a method of producing a self-amplifying expression system comprising the steps of: a) providing a DNA template, wherein each element is linked from 5’ to 3’, described by the formula: P-N1-N2-N V wherein, P comprises an RNA transcriptional promoter region comprising a transcriptional start site having a first nucleotide at nucleotide position + 1 and a second nucleotide at nucleotide position +2, Ni is a first nucleotide of a self-amplifying backbone corresponding to a first endogenous 5’ nucleotide of a self-replicating RNA virus, N2 is a second nucleotide of the self-amplifying backbone corresponding to a second endogenous 5’ nucleotide of the self- replicating RNA virus, and Nv comprises (1) one or more additional nucleic acid sequences of the self-amplifying backbone, and (2) a cassette comprising at least
  • the RNA transcriptional promoter region comprises a T7 promoter sequence, optionally wherein the T7 promoter sequence is the nucleotide sequence TAATACGACTCACTATA or TAATACGACTCACTATT, a SP6 promoter sequence, optionally wherein the SP6 promoter sequence is the nucleotide sequence ATTTAGGTGACACTATA, or a K11 RNAP promoter sequence, optionally wherein the K11 RNAP promoter sequence is the nucleotide sequence AATTAGGGCACACTATA.
  • the DNA template comprises the sequence set forth in SEQ ID NO:57, and wherein the cassette is inserted at position 7544 as set forth in the sequence of SEQ ID NO:6 to replace the deletion between base pairs 7544 and 11175 as set forth in the sequence of SEQ ID NO:3 or SEQ ID NO:5.
  • Nr is a modified nucleotide, optionally wherein the modified nucleotide comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • N2' is a modified nucleotide, optionally wherein the modified nucleotide comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • Nr is a adenosine or modified adenosine, optionally wherein the modified adenosine comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • N2' is a uridine or modified uridine, optionally wherein the modified uridine comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • Nr is a modified adenosine, optionally wherein the modified adenosine comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose, and N2' is a uridine.
  • the initiating capped oligonucleotide primer is represented by Formula (1-1):
  • R 1 is a nucleoside, optionally wherein R 1 is adenine, optionally wherein R 1 is N6-methylated adenine;
  • R 2 is a nucleoside, optionally wherein R 2 is uracil; and
  • R 3 is a halogen, optionally substituted C1-C3 alkyl, or substituted C1-C3 alkoxy.
  • R 3 is selected from the group consisting of fluorine, -CF3, -OCF3 and -OCH2CH2OCH3.
  • the initiating capped oligonucleotide primer is represented by a formula is selected from the group consisting of:
  • a method of stimulating an immune response in a subject comprising administering to the subject a composition for delivery of a self-amplifying expression system, wherein the self-amplifying expression system comprises a self-amplifying backbone, wherein the self-amplifying backbone comprises one or more polynucleotide sequences of a self-replicating RNA virus; and wherein the self-amplifying expression system comprises a nucleic acid sequence, wherein each element is linked from 5’ to 3’, described by the formula: m 7 G-ppp-Ni-N2-Nv, wherein m 7 G is a 7-methylguanylate (m 7 G) cap, ppp is a triphosphate bridge, Ni is a first nucleotide of the self-amplifying backbone corresponding to a first endogenous 5’ nucleotide of the self-replicating RNA virus, N2 is a second nucleotide of the self-amplifying
  • the composition for delivery of the self-amplifying expression system comprises: (A) the self-amplifying expression system, wherein the self-amplifying expression system comprises one or more self-amplifying mRNA (SAM) vectors, wherein the one or more SAM vectors comprise: (a) the self-amplifying backbone, wherein the self- amplifying backbone comprises: (i) at least one promoter nucleotide sequence, (ii) at least one polyadenylation (poly(A)) sequence, and (b) the cassette, optionally wherein the cassette comprises one or more of: (i) the least one antigen-encoding nucleic acid sequence comprising: a.
  • SAM self-amplifying mRNA
  • an epitope-encoding nucleic acid sequence optionally comprising: (1) at least one alteration that makes the encoded epitope sequence distinct from the corresponding peptide sequence encoded by a wild-type nucleic acid sequence, or (2) a nucleic acid sequence encoding an infectious disease organism peptide selected from the group consisting of: a pathogen-derived peptide, a virus-derived peptide, a bacteria-derived peptide, a fungus- derived peptide, and a parasite-derived peptide, b. optionally a 5’ linker sequence, and c.
  • a 3’ linker sequence optionally a second promoter nucleotide sequence operably linked to the at least one antigen-encoding nucleic acid sequence; or (iii) optionally, at least one second poly (A) sequence, wherein the second poly (A) sequence is a native poly (A) sequence or an exogenous poly(A) sequence to the self-replicating RNA virus; and (B) optionally, a lipid- nanoparticle (LNP), wherein the LNP encapsulates the self-amplifying expression system.
  • LNP lipid- nanoparticle
  • the composition for delivery of the self-amplifying expression system comprises: (A) the self-amplifying expression system, wherein the self-amplifying expression system comprises one or more self-amplifying mRNA (SAM) vectors, wherein the one or more SAM vectors comprise: (a) the self-amplifying backbone, wherein the self- amplifying backbone comprises the nucleic acid sequence set forth in SEQ ID NO:6, wherein the self-amplifying backbone sequence comprises a subgenomic promoter nucleotide sequence and a poly(A) sequence, wherein the subgenomic promoter sequence is endogenous to the self-replicating RNA virus, wherein the poly(A) sequence is endogenous to the self- amplifying backbone; and (b) the cassette integrated between the subgenomic promoter nucleotide sequence and the poly(A) sequence, wherein the cassette is operably linked to the subgenomic promoter nucleotide sequence, and optionally wherein the cassette
  • an epitope-encoding nucleic acid sequence optionally comprising: (1) at least one alteration that makes the encoded epitope sequence distinct from the corresponding peptide sequence encoded by a wild-type nucleic acid sequence, or (2) a nucleic acid sequence encoding an infectious disease organism peptide selected from the group consisting of: a pathogen-derived peptide, a virus-derived peptide, a bacteria-derived peptide, a fungus-derived peptide, and a parasite-derived peptide, b. optionally a 5’ linker sequence, and c. optionally a 3’ linker sequence; and (B) optionally, a lipid-nanoparticle (LNP), wherein the LNP encapsulates the self-amplifying expression system.
  • LNP lipid-nanoparticle
  • Ni is a modified nucleotide, optionally wherein the modified nucleotide comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • N2 is a modified nucleotide, optionally wherein the modified nucleotide comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • Ni and N2 are modified nucleotides, optionally wherein the modified nucleotides each independently comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • Ni is an adenosine or modified adenosine, optionally wherein the modified adenosine comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • N2 is a uridine or modified uridine, optionally wherein the modified uridine comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose.
  • Ni is a modified adenosine, optionally wherein the modified adenosine comprises a modification selected from the group consisting of: a modifed sugar, a modified nucleoside, a nucleoside analogue, or combinations thereof, optionally wherein the modifed sugar is a modified ribose, and N2 is a uridine.
  • m 7 G-ppp-Ni-N2 is represented by Formula (1-1):
  • R 1 is a nucleoside, optionally wherein R 1 is adenine, optionally wherein R 1 is N6-methylated adenine;
  • R 2 is a nucleoside, optionally wherein R 2 is uracil; and
  • R 3 is a halogen or substituted C1-C3 alkoxy.
  • R 3 is selected from the group consisting of fluorine, -CF3, -OCF3 and -OCH2CH2OCH3.
  • m 7 G-ppp-Ni-N2 is represented by a formula is selected from the group consisting of:
  • the self-amplifying expression system is produced by in vitro transcription.
  • the in vitro transscription process comprises use of an iniating capped oligonucleotide comprising any one of the m 7 G-ppp-Ni-N2 compositions described herein.
  • the corresponding N c is a distinct MHC class I epitope-encoding nucleic acid sequence.
  • the corresponding Uf is a distinct MHC class II epitope-encoding nucleic acid sequence.
  • the at least one promoter nucleotide sequence is a single subgenomic promoter nucleotide sequence provided by the self-amplifying backbone
  • the at least one polyadenylation poly(A) sequence is a poly(A) sequence of at least 80 consecutive A nucleotides provided by the self-amplifying backbone
  • the cassette is integrated between the subgenomic promoter nucleotide sequence and the poly(A) sequence, wherein the cassette is operably linked to the subgenomic promoter nucleotide sequence and the poly(A) sequence, each N encodes a MHC class I epitope 7-15 amino acids in length
  • L5 is a native 5’ linker sequence that encodes a native N-terminal amino acid sequence of the MHC I epitope, and wherein the 5’ linker sequence encodes a peptide that is at least 3 amino acids in length
  • L5 is a native 5’ linker sequence that encodes a native N-terminal amino acid sequence of the MHC I epitope
  • the at least one exogenous nucleic acid sequence for delivery comprises the polypeptide-encoding nucleic acid sequence.
  • the polypeptide encoding nucleic acid sequence encodes the antigen-encoding nucleic acid sequence.
  • the antigen-encoding nucleic acid sequence comprises a MHC class I epitope, a MHC class II epitope, an epitope capable of stimulating a B cell response, or a combination thereof.
  • the antigen-encoding nucleic acid sequence comprises sequence encoding a full-length protein, a protein subunit, a protein domain, or a combination thereof.
  • polypeptide-encoding nucleic acid sequence encodes a full-length protein or functional portion thereof.
  • the full-length protein or functional portion thereof is selected from the group consisting of: an antibody, a cytokine, a chimeric antigen receptor (CAR), a T-cell receptor, and a genome-editing system nuclease.
  • the at least one exogenous nucleic acid sequence for delivery comprises at least one nucleic acid sequence comprising a non-coding nucleic acid sequence.
  • the non-coding nucleic acid sequence is an RNA interference (RNAi) polynucleotide or genome-editing system polynucleotide.
  • the LNP comprises a lipid selected from the group consisting of: an ionizable amino lipid, a phosphatidylcholine, cholesterol, a PEG-based coat lipid, or a combination thereof.
  • the LNP comprises an ionizable amino lipid, a phosphatidylcholine, cholesterol, and a PEG-based coat lipid.
  • the ionizable amino lipids comprise MC3-like (dilinoleylmethyl-4-dimethylaminobutyrate) molecules.
  • the LNP-encapsulated expression system has a diameter of about lOOnm.
  • the LNP-encapsulated expression system has a diameter between 60-140nm.
  • the composition for delivery of the self-amplifying expression system is formulated for intramuscular (IM), intradermal (ID), subcutaneous (SC), intravitreal (IVT), intrathecal, or intravenous (IV) administration.
  • the composition for delivery of the self-amplifying expression system is formulated for intramuscular (IM) administration.
  • cassette is integrated between the at least one promoter nucleotide sequence and the at least one poly(A) sequence.
  • the at least one promoter nucleotide sequence is operably linked to the cassette.
  • the one or more SAM vectors comprises one or more positive- stranded RNA vectors. In some aspects, the one or more SAM vectors comprise one or more negative- stranded RNA vectors. In some aspects, the one or more negative- stranded RNA vector comprises at least one polynucleotide sequence of a measles virus or a rhabdovirus. [0063] In some aspects, the one or more SAM vectors are self-amplifying within a mammalian cell.
  • the self-amplifying backbone comprises at least one polynucleotide sequence of a self-replicating RNA virus selected from the group consisting of: an alphavirus; a flavivirus, a measles, and a rhabdovirus.
  • the self-amplifying backbone comprises at least one polynucleotide sequence of an alphavirus, optionally wherein the alphavirus is selected from the group consisting of: Aura virus, a Fort Morgan virus, a Venezuelan equine encephalitis virus, a Ross River virus, a Semliki Forest virus, a Sindbis virus, and a Mayaro virus.
  • the self-amplifying backbone comprises at least one nucleotide sequence of a Venezuelan equine encephalitis virus.
  • the self-amplifying backbone comprises at least sequences for nonstructural protein-mediated amplification, a subgenomic promoter sequence, a poly (A) sequence, a nonstructural protein 1 (nsPl) gene, a nsP2 gene, a nsP3 gene, and a nsP4 gene encoded by the nucleotide sequence of the Aura virus, the Fort Morgan virus, the Venezuelan equine encephalitis virus, the Ross River virus, the Semliki Forest virus, the Sindbis virus, or the Mayaro virus.
  • A poly
  • nsPl nonstructural protein 1
  • the self-amplifying backbone comprises at least sequences for nonstructural protein-mediated amplification, a subgenomic promoter sequence, and a poly(A) sequence encoded by the nucleotide sequence of the Aura virus, the Fort Morgan virus, the Venezuelan equine encephalitis virus, the Ross River virus, the Semliki Forest virus, the Sindbis virus, or the Mayaro virus.
  • sequences for nonstructural protein-mediated amplification are selected from the group consisting of: an alphavirus 5’ UTR, a 51-nt CSE, a 24-nt CSE, a 26S subgenomic promoter sequence, a 19-nt CSE, an alphavirus 3’ UTR, or combinations thereof.
  • the self-amplifying backbone does not encode structural virion proteins capsid, E2 and El, optionally wherein El is a full-length El, or does not encode structural virion proteins Capsid, E3, E2, 6K.
  • the cassette is inserted in place of structural virion proteins within the polynucleotide sequence of the Aura virus, the Fort Morgan virus, the Venezuelan equine encephalitis virus, the Ross River virus, the Semliki Forest virus, the Sindbis virus, or the Mayaro virus.
  • the Venezuelan equine encephalitis virus comprises the sequence of SEQ ID NO:3 or SEQ ID NO:5.
  • Venezuelan equine encephalitis virus comprises the sequence of SEQ ID NO:3 or SEQ ID NO:5 further comprising a deletion between base pair 7544 and 11175.
  • the self- amplifying backbone comprises the sequence set forth in SEQ ID NO:6 or SEQ ID NO:7.
  • the cassette is inserted at position 7544 to replace the deletion between base pairs 7544 and 11175 as set forth in the sequence of SEQ ID NO: 3 or SEQ ID NO: 5.
  • the insertion of the cassette provides for transcription of a polycistronic RNA comprising the nsPl-4 genes and the at least one nucleic acid sequence, wherein the nsPl-4 genes and the at least one nucleic acid sequence are in separate open reading frames.
  • the at least one promoter nucleotide sequence is the native promoter nucleotide sequence encoded by the self-amplifying backbone, optionally wherein the native promoter nucleotide sequence is a subgenomic promoter nucleotide sequence.
  • the at least one promoter nucleotide sequence is an exogenous RNA promoter.
  • the second promoter nucleotide sequence is a subgenomic promoter nucleotide sequence.
  • the second promoter nucleotide sequence comprises multiple subgenomic promoter nucleotide sequences, wherein each subgenomic promoter nucleotide sequence provides for transcription of one or more of the separate open reading frames.
  • the one or more SAM vectors are each at least 300nt in size. In some aspects, the one or more SAM vectors are each at least lkb in size. In some aspects, the one or more SAM vectors are each 2kb in size. In some aspects, the one or more SAM vectors are each less than 5kb in size.
  • the at least one antigen-encoding nucleic acid sequence comprises two or more antigen-encoding nucleic acid sequences.
  • each antigen-encoding nucleic acid sequence is linked directly to one another.
  • each antigen-encoding nucleic acid sequence is linked to a distinct antigen-encoding nucleic acid sequence with a nucleic acid sequence encoding a linker.
  • the linker links two MHC class I epitope-encoding nucleic acid sequences or an MHC class I epitope encoding nucleic acid sequence to an MHC class II epitope-encoding nucleic acid sequence.
  • the linker is selected from the group consisting of: (1) consecutive glycine residues, at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 residues in length; (2) consecutive alanine residues, at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 residues in length; (3) two arginine residues (RR); (4) alanine, alanine, tyrosine (AAY); (5) a consensus sequence at least 2, 3, 4, 5, 6, 7, 8 , 9, or 10 amino acid residues in length that is processed efficiently by a mammalian proteasome; and (6) one or more native sequences flanking the antigen derived from the cognate protein of origin and that is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or 2- 20 amino acid residues in length.
  • the linker links two MHC class II epitope encoding nucleic acid sequences or an MHC class II sequence to an MHC class I epitope encoding nucleic acid sequence.
  • the linker comprises the sequence GPGPG.
  • the antigen-encoding nucleic acid sequences is linked, operably or directly, to a separate or contiguous sequence that enhances the expression, stability, cell trafficking, processing and presentation, and/or immunogenicity of the epitope-encoding nucleic acid sequence.
  • the separate or contiguous sequence comprises at least one of: a ubiquitin sequence, a ubiquitin sequence modified to increase proteasome targeting (e.g., the ubiquitin sequence contains a Gly to Ala substitution at position 76), an immunoglobulin signal sequence (e.g., IgK), a major histocompatibility class I sequence, lysosomal-associated membrane protein (LAMP)-l, human dendritic cell lysosomal- associated membrane protein, and a major histocompatibility class II sequence; optionally wherein the ubiquitin sequence modified to increase proteasome targeting is A76.
  • a ubiquitin sequence e.g., the ubiquitin sequence contains a Gly to Ala substitution at position 76
  • an immunoglobulin signal sequence e.g., IgK
  • a major histocompatibility class I sequence e.g., lysosomal-associated membrane protein (LAMP)-l, human dendritic cell ly
  • the at least one antigen-encoding nucleic acid sequence comprises at least 2-10, 2, 3, 4, 5, 6, 7, 8, 9, or 10 antigen-encoding nucleic acid sequences, optionally wherein each antigen-encoding nucleic acid sequence encodes a distinct antigen- encoding nucleic acid sequence.
  • the at least one antigen-encoding nucleic acid sequence comprises at least 11-20, 15-20, 11-100, 11-200, 11-300, 11-400, 11, 12, 13,
  • each antigen-encoding nucleic acid sequence encodes a distinct antigen-encoding nucleic acid sequence.
  • the at least one antigen-encoding nucleic acid sequence comprises at least 11-20, 15-20, 11-100, 11-200, 11-300, 11-400, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or up to 400 antigen-encoding nucleic acid sequences.
  • the at least one antigen-encoding nucleic acid sequence comprises at least 2-400 antigen encoding nucleic acid sequences and wherein at least two of the antigen-encoding nucleic acid sequences encode epitope sequences or portions thereof that are presented by MHC class I on a cell surface.
  • each antigen-encoding nucleic acid sequence independently comprises at least 2-10, 2, 3, 4, 5, 6, 7, 8, 9, or 10 epitope-encoding nucleic acid sequences, optionally wherein each epitope-encoding nucleic acid sequence encodes a distinct epitope-encoding nucleic acid sequence.
  • each antigen-encoding nucleic acid sequence independently comprises at least 11-20, 15-20, 11-100, 11-200, 11- 300, 11-400, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or up to 400 epitope-encoding nucleic acid sequences, optionally wherein each epitope-encoding nucleic acid sequence encodes a distinct epitope-encoding nucleic acid sequence.
  • each antigen-encoding nucleic acid sequence independently comprises at least 11-20, 15-20, 11-100, 11-200, 11- 300, 11-400, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or up to 400 epitope-encoding nucleic acid sequences.
  • each antigen-encoding nucleic acid sequence independently comprises at least 2-400 epitope-encoding nucleic acid sequences and wherein at least two of the epitope-encoding nucleic acid sequences encode epitope sequences or portions thereof that are presented by MHC class I on a cell surface. In some aspects, at least two of the MHC class I epitopes are presented by MHC class I on a cell surface, optionally a tumor cell surface or an infected cell surface.
  • the epitope-encoding nucleic acid sequences comprises at least one MHC class I epitope-encoding nucleic acid sequence, and wherein each antigen-encoding nucleic acid sequence encodes a polypeptide sequence between 8 and 35 amino acids in length, optionally 9-17, 9-25, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
  • the at least one MHC class II epitope-encoding nucleic acid sequence is present. In some aspects, the at least one MHC class II epitope-encoding nucleic acid sequence is present and comprises at least one MHC class II epitope-encoding nucleic acid sequence that comprises at least one alteration that makes the encoded epitope sequence distinct from the corresponding peptide sequence encoded by a wild-type nucleic acid sequence.
  • the epitope-encoding nucleic acid sequence comprises an MHC class II epitope-encoding nucleic acid sequence and wherein each antigen-encoding nucleic acid sequence encodes a polypeptide sequence that is 12-20, 12, 13, 14, 15, 16, 17, 18, 19,
  • the epitope-encoding nucleic acid sequences comprises an MHC class II epitope-encoding nucleic acid sequence, wherein the at least one MHC class II epitope-encoding nucleic acid sequence is present, and wherein the at least one MHC class II epitope-encoding nucleic acid sequence comprises at least one universal MHC class II epitope-encoding nucleic acid sequence, optionally wherein the at least one universal sequence comprises at least one of Tetanus toxoid and PADRE.
  • the at least one promoter nucleotide sequence or the second promoter nucleotide sequence is inducible. In some aspects, the at least one promoter nucleotide sequence or the second promoter nucleotide sequence is non-inducible.
  • the at least one poly(A) sequence comprises a poly(A) sequence native to the self-replicating RNA. In some aspects, the at least one poly(A) sequence comprises a poly(A) sequence exogenous to the self-replicating RNA. In some aspects, the at least one poly(A) sequence is operably linked to at least one of the at least one nucleic acid sequences. In some aspects, the at least one poly(A) sequence is at least 20 , at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, or at least 120 consecutive A nucleotides. In some aspects, the at least one poly(A) sequence is at least 80 consecutive A nucleotides. In some aspects, the at least one poly(A) sequence is at least 100 consecutive A nucleotides.
  • the epitope-encoding nucleic acid sequence comprises a MHC class I epitope-encoding nucleic acid sequence
  • the MHC class I epitope encoding nucleic acid sequence is selected by performing the steps of: (a) obtaining at least one of exome, transcriptome, or whole genome nucleotide sequencing data from a tumor, an infected cell, or an infectious disease organism, wherein the nucleotide sequencing data is used to obtain data representing peptide sequences of each of a set of epitopes; (b) inputting the peptide sequence of each epitope into a presentation model to generate a set of numerical likelihoods that each of the epitopes is presented by one or more of the MHC alleles on a cell surface, optionally a tumor cell surface or an infected cell surface, the set of numerical likelihoods having been identified at least based on received mass spectrometry data; and (c) selecting a subset of the set of epitopes based on the
  • each of the MHC class I epitope-encoding nucleic acid sequences is selected by performing the steps of: (a) obtaining at least one of exome, transcriptome, or whole genome nucleotide sequencing data from a tumor, an infected cell, or an infectious disease organism, wherein the nucleotide sequencing data is used to obtain data representing peptide sequences of each of a set of epitopes; (b) inputting the peptide sequence of each epitope into a presentation model to generate a set of numerical likelihoods that each of the epitopes is presented by one or more of the MHC alleles on a cell surface, optionally a tumor cell surface or an infected cell surface, the set of numerical likelihoods having been identified at least based on received mass spectrometry data; and (c) selecting a subset of the set of epitopes based on the set of numerical likelihoods to generate a set of selected epitopes which are used to generate the at least 20 MHC class I epitop
  • a number of the set of selected epitopes is 2-20.
  • the presentation model represents dependence between: (a) presence of a pair of a particular one of the MHC alleles and a particular amino acid at a particular position of a peptide sequence; and (b) likelihood of presentation on a cell surface, optionally a tumor cell surface or an infected cell surface, by the particular one of the MHC alleles of the pair, of such a peptide sequence comprising the particular amino acid at the particular position.
  • selecting the set of selected epitopes comprises selecting epitopes that have an increased likelihood of being presented on a cell surface, optionally a tumor cell surface or an infected cell surface, relative to unselected epitopes based on the presentation model. In some aspects, selecting the set of selected epitopes comprises selecting epitopes that have an increased likelihood of being capable of stimulating a tumor-specific or infectious disease organism- specific immune response in the subject relative to unselected epitopes based on the presentation model.
  • selecting the set of selected epitopes comprises selecting epitopes that have an increased likelihood of being capable of being presented to naive T cells by professional antigen presenting cells (APCs) relative to unselected epitopes based on the presentation model, optionally wherein the APC is a dendritic cell (DC).
  • selecting the set of selected epitopes comprises selecting epitopes that have a decreased likelihood of being subject to inhibition via central or peripheral tolerance relative to unselected epitopes based on the presentation model.
  • selecting the set of selected epitopes comprises selecting epitopes that have a decreased likelihood of being capable of stimulating an autoimmune response to normal tissue in the subject relative to unselected epitopes based on the presentation model.
  • exome or transcriptome nucleotide sequencing data is obtained by performing sequencing on a tumor cell or tissue, an infected cell, or an infectious disease organism.
  • the sequencing is next generation sequencing (NGS) or any massively parallel sequencing approach.
  • the composition for delivery of the self-amplifying expression system is administered as a priming vaccine.
  • the method further comprises administering a second composition, optionally wherein the second composition is a vaccine composition.
  • the second composition is administered prior to the composition for delivery of the self-amplifying expression system.
  • the second composition is administered subsequent to the administration of the composition for delivery of the self-amplifying expression system.
  • the second composition is the same as the composition for delivery of the self-amplifying expression system.
  • the second composition is different from the composition for delivery of the self- amplifying expression system.
  • the second composition comprises the cassette of the self-amplifying expression system, optionally wherein the second composition comprises a chimpanzee adenovirus vector encoding the cassette of the self-amplifying expression system.
  • two or more second compositions are administered, optionally wherein the composition for delivery of the self-amplifying expression system is administered as a priming vaccine.
  • the composition for delivery of the self-amplifying expression system is administered intramuscularly (IM), intradermally (ID), subcutaneously (SC), intravitreal (IVT), intrathecal, or intravenously (IV).
  • the method further comprises administering an immune modulator, optionally wherein the immune modulator is an anti-CTLA4 antibody or an antigen-binding fragment thereof, an anti -PD- 1 antibody or an antigen-binding fragment thereof, an anti-PD-Ll antibody or an antigen-binding fragment thereof, an anti-4- IBB antibody or an antigen-binding fragment thereof, an anti-OX-40 antibody or an antigen-binding fragment thereof, or a cytokine, optionally wherein the cytokine is at least one of IL-2, IL-7, IL-12, IL-15, or IL-21 or variants thereof.
  • the method further comprises administering an adjuvant.
  • FIG. 1 illustrates transcription of SAM vectors using either a canonical T7 promoter or a modified (“minimal”) T7 promoter.
  • FIG. 2 provides a schematic of a representative AU-SAM vector.
  • FIG. 3 shows capped AU-SAM RNA yield produced by IVT using either a trinucleotide m 7 G-ppp-A-U cap analogue or dinucleotide m 7 G-ppp-A cap analogue.
  • the number of antigen-specific T-cells were measured by intracellular cytokine staining for IFNg, following 6-hour stimulation with the AH1-A5 antigen (SPSYAYHQF).
  • SPSYAYHQF the AH1-A5 antigen
  • FIG. 5 illustrates AU-SAM study arm details (top panel) and model antigens used (bottom panel).
  • FIG. 6 shows a timecourse of antigen-specific immune responses for each of the six Mamu-A*01 following immunizations (prime/boost) with AU-SAM.
  • FIG. 7 shows a timecourse of antigen-specific immune responses for each of the six Mamu-A*01 following immunizations (prime/boost) with AU-SAM.
  • present disclosure includes a compound of formula (I): or a pharmaceutically acceptable salt thereof, wherein
  • R 1 is a nucleoside
  • R 2 is a nucleoside
  • R 3 is halogen optionally substituted C1-C3 alkyl, or substituted C1-C3 alkoxy.
  • R 4 is hydrogen or optionally substituted C1-C 3 aliphatic
  • R 5 is hydrogen or optionally substituted C1-C 3 aliphatic; and each X is independently O or S.
  • present disclosure includes a compound of formula (1-1):
  • present disclosure includes a compound of formula (1-2):
  • R 1 and R 2 are defined above and described in classes and subclasses herein.
  • present disclosure includes a compound of formula (1-3):
  • present disclosure includes a compound of formula (1-4):
  • R 1 and R 2 are defined above and described in classes and subclasses herein.
  • present disclosure includes a compound of formula (1-5):
  • present disclosure includes a compound of formula (II):
  • present disclosure includes a compound of formula (II- 1 ) :
  • present disclosure includes a compound of formula (II-2):
  • R 1 is selected from the group consisting of adenine, uracil, guanine and cytosine.
  • R 1 is adenine.
  • R 1 is N6- methylated adenine.
  • R 1 is uracil.
  • R 1 is guanine.
  • R 1 is cytosine.
  • R 1 is thymine.
  • R 2 is selected from the group consisting of adenine, uracil, guanine and cytosine. In some embodiments, R 2 is adenine. In some embodiments, R 2 is uracil. In some embodiments, R 2 is guanine. In some embodiments, R 2 is cytosine. In some embodiments, R 2 is thymine.
  • R 3 is halogen, optionally substituted C1-C3 alkyl, or substituted C1-C3 alkoxy. In some embodiments, R 3 is halogen. In some embodiments, R 3 is F. In some embodiments, R 3 is optionally substituted C1-C 3 alkyl. In some embodiments, R 3 is -CF 3. In some embodiments, R 3 is substituted C1-C 3 alkoxy. In some embodiments, R 3 is C1-C 3 haloalkoxy. In some embodiments, R 3 is -OCF 3. In some embodiments, R 3 is C1-C 3 alkoxy substituted with C1-C 3 alkoxy. In some embodiments, R 3 is -OCH2CH2OCH 3.
  • R 4 is hydrogen or optionally substituted C1-C 3 aliphatic. In some embodiments, R 4 is hydrogen. In some embodiments, R 4 is optionally substituted Ci- C 3 aliphatic. In some embodiments, R 4 is hydrogen or optionally substituted methyl. In some embodiments, R 4 is methyl.
  • R 5 is hydrogen or optionally substituted C1-C 3 aliphatic. In some embodiments, R 5 is hydrogen. In some embodiments, R 5 is optionally substituted Ci- C 3 aliphatic. In some embodiments, R 5 is hydrogen or optionally substituted methyl. In some embodiments, R 5 is methyl.
  • the present disclosure includes a compound selected the group consisting of
  • the present disclosure includes a compound including: or a pharmaceutically acceptable salt thereof.
  • aliphatic or "aliphatic group”, as used herein, means a straight-chain (i.e., unbranched) or branched, substituted or unsubstituted hydrocarbon chain that is completely saturated or that contains one or more units of unsaturation, or a monocyclic hydrocarbon or bicyclic hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic (also referred to herein as “carbocycle” "cycloaliphatic” or “cycloalkyl”), that has a single point of attachment to the rest of the molecule.
  • aliphatic groups contain 1-6 aliphatic carbon atoms.
  • aliphatic groups contain 1-5 aliphatic carbon atoms. In other embodiments, aliphatic groups contain 1-4 aliphatic carbon atoms. In still other embodiments, aliphatic groups contain 1-3 aliphatic carbon atoms, and in yet other embodiments, aliphatic groups contain 1-2 aliphatic carbon atoms.
  • cycloaliphatic (or “carbocycle” or “cycloalkyl”) refers to a monocyclic C3-C6 hydrocarbon that is completely saturated or that contains one or more units of unsaturation, but which is not aromatic, that has a single point of attachment to the rest of the molecule.
  • Suitable aliphatic groups include, but are not limited to, linear or branched, substituted or unsubstituted alkyl, alkenyl, alkynyl groups and hybrids thereof such as (cycloalkyl)alkyl, (cycloalkenyl)alkyl or (cycloalkyl)alkenyl.
  • haloaliphatic refers to an aliphatic group that is substituted with one or more halogen atoms.
  • alkyl refers to a straight or branched alkyl group.
  • exemplary alkyl groups are methyl, ethyl, propyl, isopropyl, butyl, isobutyl, and tert-butyl.
  • haloalkyl refers to a straight or branched alkyl group that is substituted with one or more halogen atoms.
  • halogen means F, Cl, Br, or I.
  • aryloxy refers to monocyclic and bicyclic ring systems having a total of five to fourteen ring members, wherein at least one ring in the system is aromatic and wherein each ring in the system contains three to seven ring members.
  • aryl may be used interchangeably with the term “aryl ring”.
  • aryl refers to an aromatic ring system which includes, but not limited to, phenyl, biphenyl, naphthyl, anthracyl and the like, which may bear one or more substituents.
  • aryl is a group in which an aromatic ring is fused to one or more non-aromatic rings, such as indanyl, phthalimidyl, naphthimidyl, phenanthridinyl, or tetrahydronaphthyl, and the like.
  • partially unsaturated refers to a ring moiety that includes at least one double or triple bond.
  • partially unsaturated is intended to encompass rings having multiple sites of unsaturation, but is not intended to include aryl or heteroaryl moieties, as herein defined.
  • compounds of the present disclosure may contain “optionally substituted” moieties.
  • substituted whether preceded by the term “optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent.
  • an “optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at every position.
  • Combinations of substituents envisioned by this present disclosure are preferably those that result in the formation of stable or chemically feasible compounds.
  • stable refers to compounds that are not substantially altered when subjected to conditions to allow for their production, detection, and, in certain embodiments, their recovery, purification, and use for one or more of the purposes disclosed herein.
  • Suitable monovalent substituents on R° are independently halogen, — (CH 2 )O-2R ⁇ , -(haloR * ), — (CH 2 )o-20H, — (CH 2 )O-20R ⁇ , — (CH 2 )O-2CH(OR * )2; — 0(haloR ⁇ ), — CN, — Ns, — (CH 2 )O-2C(0)R ⁇ , — (CH 2 )O-2C(0)OH, — (CH 2 )O-2C(0)OR ⁇ , — (CH 2 )O-2SR ⁇ , — (CH 2 )O-2SH, — (CH 2 )O-2NH2, — (CH 2 )O-2NHR ⁇ , — (CH 2 )O-2NR ⁇ 2, — NO2, — SiR* 3, — OSiR* 3, — C(0)SR ⁇ , — (Ci
  • each R * is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently selected from Ci-4 aliphatic, — CfhPh, — 0(CH2)o-iPh, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
  • Suitable divalent substituents that are bound to vicinal substitutable carbons of an “optionally substituted” group include: — 0(CR*2)2- 3 0 — , wherein each independent occurrence of R* is selected from hydrogen, Ci- 6 aliphatic which may be substituted as defined below, or an unsubstituted 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
  • Suitable substituents on the aliphatic group of R* include halogen, — R*, - (haloR * ), —OH, —OR * , — 0(haloR * ), — CN, — C(0)OH, — C(0)OR * , — NH 2 , — NHR * , — NR* 2, or — NCte, wherein each R* is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently Ci-4 aliphatic, — CH2PI1, — 0(CH2)o- l Ph, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
  • Suitable substituents on a substitutable nitrogen of an “optionally substituted” group include — R ⁇ , — NR ⁇ 2, — C(0)R ⁇ , — C(0)0R ⁇ , — C(0)C(0)R ⁇ , — C(0)CH 2 C(0)R ⁇ ,
  • each R ⁇ is independently hydrogen, Ci- 6 aliphatic which may be substituted as defined below, unsubstituted — OPh, or an unsubstituted 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur, or, notwithstanding the definition above, two independent occurrences of R ⁇ , taken together with their intervening atom(s) form an unsubstituted 3-12-membered saturated, partially unsaturated, or aryl mono- or bicyclic ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
  • Suitable substituents on the aliphatic group of R ⁇ are independently halogen, — R ⁇ , -(haloR * ), —OH, —OR * , — 0(haloR * ), — CN, — C(0)OH, — C(0)OR * , — NH 2 , — NHR ⁇ , — NR* 2, or — NO2, wherein each R* is unsubstituted or where preceded by “halo” is substituted only with one or more halogens, and is independently Ci-4 aliphatic, — CH2PI1, — 0(CH2)o-iPh, or a 5-6-membered saturated, partially unsaturated, or aryl ring having 0-4 heteroatoms independently selected from nitrogen, oxygen, or sulfur.
  • the term "pharmaceutically acceptable salt” refers to those salts which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of humans and lower animals without undue toxicity, irritation, allergic response and the like, and are commensurate with a reasonable benefit/risk ratio.
  • Pharmaceutically acceptable salts are well known in the art. For example, S. M. Berge et ah, describe pharmaceutically acceptable salts in detail in J. Pharmaceutical Sciences, 1977, 66, 1-19, incorporated herein by reference.
  • Pharmaceutically acceptable salts of the compounds of this disclosure include those derived from suitable inorganic and organic acids and bases.
  • Examples of pharmaceutically acceptable, nontoxic acid addition salts are salts of an amino group formed with inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid or with organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • inorganic acids such as hydrochloric acid, hydrobromic acid, phosphoric acid, sulfuric acid and perchloric acid
  • organic acids such as acetic acid, oxalic acid, maleic acid, tartaric acid, citric acid, succinic acid or malonic acid or by using other methods used in the art such as ion exchange.
  • salts include adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecyl sulfate, ethanesulfonate, formate, fumarate, glucoheptonate, glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pect
  • Salts derived from appropriate bases include alkali metal, alkaline earth metal, ammonium and N(Cl-4alkyl)4 salts.
  • Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like.
  • Further pharmaceutically acceptable salts include, when appropriate, nontoxic ammonium, quaternary ammonium, and amine cations formed using counterions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, loweralkyl sulfonate and aryl sulfonate.
  • the recitation of a listing of chemical groups in any definition of a variable herein includes definitions of that variable as any single group or combination of listed groups.
  • the recitation of an embodiment for a variable herein includes that embodiment as any single embodiment or in combination with any other embodiments or portions thereof.
  • biological sample includes, without limitation, cell cultures or extracts thereof; biopsied material obtained from a mammal or extracts thereof; and blood, saliva, urine, feces, semen, tears, or other body fluids or extracts thereof.
  • a "therapeutically effective amount” means an amount of a substance (e.g., a therapeutic agent, composition, and/or formulation) that stimulates a desired biological response.
  • a therapeutically effective amount of a substance is an amount that is sufficient, when administered as part of a dosing regimen to a subject suffering from or susceptible to a disease, disorder, and/or condition, to treat, diagnose, prevent, and/or delay the onset of the disease, disorder, and/or condition.
  • the effective amount of a substance may vary depending on such factors as the desired biological endpoint, the substance to be delivered, the target cell or tissue, etc.
  • the effective amount of a provided compound in a formulation to treat a disease, disorder, and/or condition is the amount that alleviates, ameliorates, relieves, inhibits, prevents, delays onset of, reduces severity of and/or reduces incidence of one or more symptoms or features of the disease, disorder, and/or condition.
  • a "therapeutically effective amount" is at least a minimal amount of a provided compound, or composition containing a provided compound, which is sufficient for treating one or more symptoms of a disease or disorder.
  • treatment refers to partially or completely alleviating, inhibiting, delaying onset of, preventing, ameliorating and/or relieving a disorder or condition, or one or more symptoms of the disorder or condition, as described herein.
  • treatment may be administered after one or more symptoms have developed.
  • the term “treating” includes preventing or halting the progression of a disease or disorder.
  • treatment may be administered in the absence of symptoms.
  • treatment may be administered to a susceptible individual prior to the onset of symptoms (e.g., in light of a history of symptoms and/or in light of genetic or other susceptibility factors). Treatment may also be continued after symptoms have resolved, for example to prevent or delay their recurrence.
  • the term “treating” includes preventing relapse or recurrence of a disease or disorder.
  • a “subject” to which administration is contemplated includes, but is not limited to, humans (i.e., a male or female of any age group, e.g., a pediatric subject (e.g, infant, child, adolescent) or adult subject (e.g, young adult, middle-aged adult or senior adult)) and/or a non-human animal, e.g, a mammal such as primates (e.g, cynomolgus monkeys, rhesus monkeys), cattle, pigs, horses, sheep, goats, rodents, cats, and/or dogs.
  • the subject is a human.
  • the subject is a non-human animal.
  • the terms “patient,” and “subject” are used interchangeably herein.
  • compositions of the compounds disclosed herein include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, poly
  • compounds described herein may also comprise one or more isotopic substitutions.
  • hydrogen may be 2 H (D or deuterium) or 3 H (T or tritium); carbon may be, for example, 13 C or 14 C; oxygen may be, for example, 18 0; nitrogen may be, for example, 15 N, and the like.
  • a particular isotope e.g ., 3 H, 13 C, 14 C, 18 0, or 15 N
  • the present disclosure provides a composition comprising a compound of Formula (I) and a pharmaceutically acceptable carrier, adjuvant, or vehicle compounds of the present disclosure are preferably formulated in dosage unit form for ease of administration and uniformity of dosage.
  • RNA oligonucleotides [00128]
  • a compound of Formula (I) may be useful in the preparation of a 5’ -capped RNA.
  • Methods and compositions contemplated herein for preparation of 5 '-capped RNA include, but are not limited to, mRNA, small nuclear RNA (snRNA), small nucleolar RNA (snoRNA), small cajal body-specific RNA (scaRNA).
  • a method involves the use of a Cap containing oligonucleotide primers, nucleoside 5 '-triphosphates (NTPs) and RNA polymerase for DNA-templated and promoter- controlled synthesis of RNA.
  • NTPs nucleoside 5 '-triphosphates
  • a method uses an initiating capped oligonucleotide primer that provides utility in RNA synthesis, in particular synthesis of capped mRNAs.
  • a compound of formula (I) may be useful in a method for preparation of RNA including, but not limited to, mRNA, snRNA, snoRNA, scaRNA, transfer RNA (tRNA), ribosomal RNA (rRNA), and transfer-messenger RNA (tmRNA) that carry modifications at or near 5 '-end of the molecule.
  • a method involves the use of initiating oligonucleotide primers with or without Cap, nucleoside '- triphosphates (NTPs) and RNA polymerase for DNA-templated and promoter-controlled synthesis of RNA.
  • NTPs nucleoside '- triphosphates
  • a method uses a modified initiating oligonucleotide primer carrying structural modifications that provide utility in RNA synthesis; in particular synthesis of 5'-modified RNAs.
  • the initiating capped oligonucleotide primer has an open 3'-OH group that allows for initiation of RNA polymerase mediated synthesis of RNA on a DNA template by adding nucleotide units to the 3 '-end of the primer.
  • the initiating capped oligonucleotide primer is substantially complementary to template DNA sequence at the transcription initiation site (i.e., the initiation site is located closer to 3 '-terminus of a promoter sequence and may overlap with promoter sequence), in certain embodiments, the initiating capped oligonucleotide primer directs synthesis of RNA predominantly in one direction ("forward") starting from the 3' -end of the primer.
  • the initiating capped oligonucleotide primer outcompetes any nucleoside 5 '-triphosphate for initiation of RNA synthesis, thereby maximizing the production of the RNA that starts with initiating capped oligonucleotide primer and minimizing a production of RNA that starts with 5 '- triphosphate-nucleoside (typically GTP).
  • An initiating capped oligonucleotide primers of the present disclosure have a hybridization sequence which may be complementary to a sequence on DNA template at initiation site.
  • the presence of hybridization sequence forces an initiating capped oligonucleotide primer to predominantly align with complementary sequence of the DNA template at the initiation site in only the desired orientation (i. e., the "forward" orientation).
  • the RNA transcript begins with the inverted guanosine residue (i.e., 7m G(5')ppp(5') N... )
  • the dominance of the forward orientation of the primer alignment on DNA template over incorrect "reverse" orientation is maintained by the thermodynamics of the hybridization complex.
  • Hybridization in the desired forward orientation may also depend on the temperature and reaction conditions at which DNA template and initiating capped oligonucleotide primer are hybridized or used during in vitro transcription.
  • An initiating capped oligonucleotide primer of the present disclosure enhances efficacy of initiation of transcription compared to efficacy of initiation with standard GTP, ATP, CTP or UTP.
  • initiation of transcription is considered enhanced when synthesis of RNA starts predominantly from initiating capped oligonucleotide primer and not from any NTP in transcription mixture.
  • the enhanced efficiency of initiation of transcription results in a higher yield of RNA transcript.
  • the enhanced efficiency of initiation of transcription may be increased to about 10%, about 20%, about 40%, about 60%, about 80%, about 90%, about 100%, about 150%, about 200% or about 500% over synthesis of RNA with conventional methods without initiating capped primer.
  • initiating capped oligonucleotide primers out-compete any NTP (including GTP) for initiation of transcription.
  • NTP including GTP
  • One of ordinary skill in the art is able to readily determine the level of substrate activity and efficacy of initiating capped oligonucleotide primers.
  • One example of a method of determining substrate efficacy is illustrated in Example 13).
  • initiation takes place from the capped oligonucleotide primer rather than an NTP, which results in a higher level of capping of the transcribed mRNA.
  • RNA is synthesized utilizing an initiating capped oligonucleotide primer that has substitutions or modifications.
  • the substitutions and modifications of the initiating capped oligonucleotide primer do not substantially impair the synthesis of RNA. Routine test syntheses can be pre-formed to determine if desirable synthesis results can be obtained with the modified initiating capped oligonucleotide primers. Those skilled in the art can perform such routine experimentation to determine if desirable results can be obtained.
  • substitution or modification of initiating capped oligonucleotide primer include for example, one or more modified nucleoside bases, one or more modified sugars, one or more modified inter-nucleotide linkage and/or one or more modified triphosphate bridges.
  • the modified initiating capped oligonucleotide primer which may include one or more modification groups of the methods and compositions provided herein, can be elongated by RNA polymerase on DNA template by incorporation of NTP onto open 3 '-OH group.
  • the initiating capped oligonucleotide primer may include natural RNA and DNA nucleosides, modified nucleosides or nucleoside analogs.
  • the initiating capped oligonucleotide primer may contain natural internucleotide phosphodiester linkages or modifications thereof, or combination thereof.
  • the present disclosure provides a method for treating or lessening the severity of cancer in a patient comprising the step of administering to said patient an RNA oligonucleotide, wherein the RNA oligonucleotide comprises a compound of Formula (I).
  • a cancer is selected from the group consisting of lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, bladder cancer, brain cancer, B- cell lymphoma, acute myelogenous leukemia, adult acute lymphoblastic leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, non small cell lung cancer, and small cell lung cancer.
  • cancer is a solid tumor.
  • cancer is selected from the group consisting of: microsatellite stable-colorectal cancer (MSS-CRC), non-small cell lung cancer (NSCLC), pancreatic ductal adenocarcinoma (PDA), and gastroesophageal adenocarcinoma (GEA).
  • MSS-CRC microsatellite stable-colorectal cancer
  • NSCLC non-small cell lung cancer
  • PDA pancreatic ductal adenocarcinoma
  • GOA gastroesophageal adenocarcinoma
  • cancer is selected from the group consisting of: MSS-CRC, NSCLC, and PDA.
  • an RNA oligonucleotide comprising a compound of Formula (I)of the present disclosure is administered to a patient with cancer selected from the group consisting of lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, bladder cancer, brain cancer, B-cell lymphoma, acute myelogenous leukemia, adult acute lymphoblastic leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, non-small cell lung cancer, and small cell lung cancer.
  • cancer selected from the group consisting of lung cancer, melanoma, breast cancer, ovarian cancer, prostate cancer, kidney cancer, gastric cancer, colon cancer, testicular cancer, head and neck cancer, pancreatic cancer, bladder cancer, brain cancer, B-cell lymphoma, acute myelogenous leukemia, adult acute lymphoblastic leukemia, chronic my
  • an RNA oligonucleotide comprising a compound of Formula (I) is administer to a patient with an infection.
  • an infection is a viral infection, fungal, or a bacterial infection.
  • an infection is a viral infection.
  • a viral infection is an infection by a virus, wherein the virus is HIV.
  • an RNA oligonucleotide comprising a compound of Formula (I) is administer to a patient with AIDS.
  • a viral infection is an infection by a virus, wherein the virus is coronavirus.
  • an RNA oligonucleotide comprising a compound of Formula (I) is administer to a patient with COVID-19.
  • the present disclosure relates to a method of contacting a biological sample with an RNA oligonucleotide comprising a compound of Formula (I).
  • one or more additional therapeutic agents may also be administered in combination with an RNA oligonucleotide comprising a compound of Formula (I).
  • an RNA oligonucleotide comprising a compound of Formula (I) and one or more additional therapeutic agents may be administered as part of a multiple dosage regime.
  • an RNA oligonucleotide comprising a compound of Formula (I) and one or more additional therapeutic agents may be administered may be administered simultaneously, sequentially or within a period of time.
  • an RNA oligonucleotide comprising a compound of Formula (I) and one or more additional therapeutic agents may be administered within five hours of one another. In some embodiments, an RNA oligonucleotide comprising a compound of Formula (I) and one or more additional therapeutic agents may be administered within 24 hours of one another. In some embodiments, an RNA oligonucleotide comprising a compound of Formula (I) and one or more additional therapeutic agents may be administered within one week of one another.
  • all self-amplifying mRNA (SAM) vectors contain a self-amplifying backbone derived from a self-replicating virus.
  • self-amplifying backbone refers to minimal sequence(s) of a self-replicating virus that allows for self-replication of the viral genome.
  • minimal sequences that allow for self-replication of an alphavirus can include conserved sequences for nonstructural protein-mediated amplification (e.g, a nonstructural protein 1 (nsPl) gene, a nsP2 gene, a nsP3 gene, a nsP4 gene, and/or a poly A sequence).
  • a self-amplifying backbone can also include sequences for expression of subgenomic viral RNA (e.g, a subgenomic promoter, such as a 26S promoter element, for an alphavirus).
  • SAM vectors can be positive-sense RNA polynucleotides or negative-sense RNA polynucleotides, such as vectors with backbones derived from positive-sense or negative- sense self-replicating viruses.
  • Self-replicating viruses include, but are not limited to, alphaviruses, flaviviruses (e.g, Kunjin virus), measles viruses, and rhabdoviruses (e.g, rabies virus and vesicular stomatitis virus).
  • SAM vector systems derived from self- replicating viruses are described in greater detail in Lundstrom (Molecules. 2018 Dec 13;23(12). pii: E3310. doi: 10.3390/molecules23123310), herein incorporated by reference for all purposes.
  • RNA polymerase promoter at the 5’ end of the sequence desired to be transcribed into RNA (e.g ., SAM). Promoters include, but are not limited to, bacteriophage polymerase promoters such as T3, T7, SP6, or K11.
  • additional 5’ nucleotides can be transcribed in addition to the desired sequence.
  • the canonical T7 promoter can be referred to by the sequence TAATACGACTCACTATAGG, in which an IVT reaction using the DNA template TAATACGACTCACTATAGGNv for the production of desired sequence N will result in the mRNA sequence GG-Nv.
  • T7 polymerase more efficiently transcribes RNA transcripts beginning with guanosine.
  • additional 5’ nucleotides may not be desired and/or may be detrimental.
  • the RNA polymerase promoter contained in the DNA template can be a sequence the results in transcripts containing only the 5’ nucleotides of the desired sequence, e.g., a SAM having the endogenous (also referred to as “native” or “genomic”) 5’ sequence of the self-replicating virus from which the SAM vector is derived, referring to the native genomic sequence of the self-replicating virus (e.g, having endogenous 5’ VEEV nucleotides AU also referred to as “AU-SAM”).
  • SAM having the endogenous (also referred to as “native” or “genomic”) 5’ sequence of the self-replicating virus from which the SAM vector is derived
  • native genomic sequence of the self-replicating virus e.g, having endogenous 5’ VEEV nucleotides AU also referred to as “AU-SAM”.
  • a minimal T7 promoter can be referred to by the sequence TAATACGACTCACTATA (oriented 5’ -3’; cp6.5 T7 promoter), in which an IVT reaction using the DNA template TAATACGACTCACTATANriSkNv for the production of desired sequence N will result in the mRNA sequence NriSkNv.
  • An alternative minimal T7 promoter can be referred to by the sequence TAATACGACTCACTATT (oriented 5’ -3’; cp2.5 T7 promoter).
  • a minimal SP6 promoter referred to by the sequence ATTTAGGTGACACTATA can be used to generate transcripts without additional 5’ nucleotides.
  • a minimal K11 promoter referred to by the sequence AATTAGGGCACACTATA can be used to generate transcripts without additional 5’ nucleotides.
  • the DNA template is incubated with the appropriate RNA polymerase enzyme, buffer agents, and nucleotides (NTPs).
  • RNA polynucleotide can optionally be further modified including, but limited to, addition of a 5’ cap structure such as 7-methylguanosine or a related structure, and optionally modifying the 3’ end to include a polyadenylate (poly A) tail.
  • a 5’ cap structure such as 7-methylguanosine or a related structure
  • poly A polyadenylate
  • RNA is capped with a 5’ cap structure co-transcriptionally through the addition of cap analogues during IVT.
  • Cap analogues can include dinucleotide (m 7 G-ppp-N) cap analogues or trinucleotide (m 7 G-ppp-Ni-N2) cap analogues, where N represents a nucleotide or modified nucleotide (e.g, ribonucleosides including, but not limited to, adenosine, guanosine, cytidine, and uradine).
  • a modified nucleotide can include a modified adenosine, such as N6-methyladenosine 2’-OH-methylated.
  • Ni can be N6-methyladenosine T - OH-methylated.
  • Cap analogues can include any of the structures or formulas described herein. Exemplary cap analogues and their use in IVT reactions are also described in greater detail in U.S. Pat. No. 10,519,189, herein incorporated by reference for all purposes. As discussed, T7 polymerase more efficiently transcribes RNA transcripts beginning with guanosine.
  • a trinucleotide cap analogue (m 7 G-ppp-N-N) can be used.
  • the trinucleotide cap analogue can increase transcription efficiency 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20- fold or more relative to an IVT reaction using a dinucleotide cap analogue (m 7 G-ppp-N).
  • a 5’ cap structure can also be added following transcription, such as using a vaccinia capping system (e.g. , NEB Cat. No. M2080) containing mRNA 2’-0- methyltransferase and S-Adenosyl methionine.
  • RNA can then be purified using techniques well-known in the field, such as phenol- chloroform extraction or column purification (e.g, chromatography -based purification).
  • Alphaviruses are members of the family Togaviridae , and are positive-sense single stranded RNA viruses. Members are typically classified as either Old World, such as Sindbis, Ross River, Mayaro, Chikungunya, and Semliki Forest viruses, or New World, such as eastern equine encephalitis, Aura, Fort Morgan, or Venezuelan equine encephalitis virus and its derivative strain TC-83 (Strauss Microbrial Review 1994).
  • Old World such as Sindbis, Ross River, Mayaro, Chikungunya, and Semliki Forest viruses
  • New World such as eastern equine encephalitis, Aura, Fort Morgan, or Venezuelan equine encephalitis virus and its derivative strain TC-83 (Strauss Microbrial Review 1994).
  • a natural alphavirus genome is typically around 12kb in length, the first two-thirds of which contain genes encoding non-structural proteins (nsPs) that form RNA replication complexes for self- replication of the viral genome, and the last third of which contains a subgenomic expression cassette encoding structural proteins for virion production (Frolov RNA 2001).
  • nsPs non-structural proteins
  • a model lifecycle of an alphavirus involves several distinct steps (Strauss Microbrial Review 1994, Jose Future Microbiol 2009). Following virus attachment to a host cell, the virion fuses with membranes within endocytic compartments resulting in the eventual release of genomic RNA into the cytosol.
  • the genomic RNA which is in a plus- strand orientation and comprises a 5’ methylguanylate cap and 3’ polyA tail, is translated to produce non-structural proteins nsPl-4 that form the replication complex. Early in infection, the plus-strand is then replicated by the complex into a minus-stand template.
  • the replication complex is further processed as infection progresses, with the resulting processed complex switching to transcription of the minus-strand into both full-length positive-strand genomic RNA, as well as the 26S subgenomic positive-strand RNA containing the structural genes.
  • CSEs conserved sequence elements of alphavirus have been identified to potentially play a role in the various RNA replication steps including; a complement of the 5’ UTR in the replication of plus-strand RNAs from a minus-strand template, a 51-nt CSE in the replication of minus-strand synthesis from the genomic template, a 24-nt CSE in the junction region between the nsPs and the 26S RNA in the transcription of the subgenomic RNA from the minus-strand, and a 3’ 19-nt CSE in minus- strand synthesis from the plus-strand template.
  • CSEs conserved sequence elements
  • virus particles are then typically assembled in the natural lifecycle of the virus.
  • the 26S RNA is translated and the resulting proteins further processed to produce the structural proteins including capsid protein, glycoproteins El and E2, and two small polypeptides E3 and 6K (Strauss 1994). Encapsidation of viral RNA occurs, with capsid proteins normally specific for only genomic RNA being packaged, followed by virion assembly and budding at the membrane surface.
  • Alphaviruses can be used to generate alphavirus-based delivery vectors (also be referred to as alphavirus vectors, alphavirus viral vectors, alphavirus vaccine vectors, self-replicating RNA (srRNA) vectors, or self-amplifying mRNA (SAM) vectors).
  • alphavirus vectors also be referred to as alphavirus vectors, alphavirus viral vectors, alphavirus vaccine vectors, self-replicating RNA (srRNA) vectors, or self-amplifying mRNA (SAM) vectors.
  • Alphaviruses have previously been engineered for use as expression vector systems (Pushko 1997, Rheme 2004). Alphaviruses offer several advantages, particularly in a vaccine setting where heterologous antigen expression can be desired.
  • alphavirus vectors Due to its ability to self-replicate in the host cytosol, alphavirus vectors are generally able to produce high copy numbers of the expression cassette within a cell resulting in a high level of heterologous antigen production. Additionally, the vectors are generally transient, resulting in improved biosafety as well as reduced induction of immunological tolerance to the vector.
  • the public in general, also lacks pre-existing immunity to alphavirus vectors as compared to other standard viral vectors, such as human adenovirus.
  • Alphavirus based vectors also generally result in cytotoxic responses to infected cells. Cytotoxicity, to a certain degree, can be important in a vaccine setting to properly stimulate an immune response to the heterologous antigen expressed.
  • an antigen expression vector described herein can utilize an alphavirus backbone that allows for a high level of antigen expression, stimulates a robust immune response to antigen, does not stimulate an immune response to the vector itself, and can be used in a safe manner.
  • the antigen expression cassette can be designed to stimulate different levels of an immune response through optimization of which alphavirus sequences the vector uses, including, but not limited to, sequences derived from VEEV or its attenuated derivative TC- 83.
  • an alphavirus vector design includes inserting a second copy of the 26S promoter sequence elements downstream of the structural protein genes, followed by a heterologous gene (Frolov 1993).
  • a heterologous gene Frolov 1993.
  • an additional subgenomic RNA is produced that expresses the heterologous protein.
  • all the elements for production of infectious virions are present and, therefore, repeated rounds of infection of the expression vector in non- infected cells can occur.
  • helper virus systems Pushko 1997.
  • the structural proteins are replaced by a heterologous gene.
  • the 26S subgenomic RNA provides for expression of the heterologous protein.
  • additional vectors that expresses the structural proteins are then supplied in trans, such as by co-transfection of a cell line, to produce infectious virus.
  • a system is described in detail in USPN 8,093,021, which is herein incorporated by reference in its entirety, for all purposes.
  • the helper vector system provides the benefit of limiting the possibility of forming infectious particles and, therefore, improves biosafety.
  • helper vector system reduces the total vector length, potentially improving the replication and expression efficiency.
  • an example of an antigen expression vector described herein can utilize an alphavirus backbone wherein the structural proteins are replaced by an antigen cassette, the resulting vector both reducing biosafety concerns, while at the same time promoting efficient expression due to the reduction in overall expression vector size. Delivery Via Lipid Nanoparticles (LNP)
  • An important aspect to consider in vaccine vector design is immunity against the vector itself (Riley 2017). This may be in the form of preexisting immunity to the vector itself, such as with certain human adenovirus systems, or in the form of developing immunity to the vector following administration of the vaccine. The latter is an important consideration if multiple administrations of the same vaccine are performed, such as separate priming and boosting doses, or if the same vaccine vector system is to be used to deliver different antigen cassettes.
  • alphavirus vectors the standard delivery method is the previously discussed helper virus system that provides capsid, El, and E2 proteins in trans to produce infectious viral particles.
  • helper virus system that provides capsid, El, and E2 proteins in trans to produce infectious viral particles.
  • El and E2 proteins are often major targets of neutralizing antibodies (Strauss 1994).
  • the efficacy of using alphavirus vectors to deliver antigens of interest to target cells may be reduced if infectious particles are targeted by neutralizing antibodies.
  • Nanomaterials can be made of non-immunogenic materials and generally avoid eliciting immunity to the delivery vector itself.
  • These materials can include, but are not limited to, lipids, inorganic nanomaterials, and other polymeric materials.
  • Lipids can be cationic, anionic, or neutral. The materials can be synthetic or naturally derived, and in some instances biodegradable.
  • Lipids can include fats, cholesterol, phospholipids, lipid conjugates including, but not limited to, polyethyleneglycol (PEG) conjugates (PEGylated lipids), waxes, oils, glycerides, and fat soluble vitamins.
  • PEG polyethyleneglycol
  • LNPs Lipid nanoparticles
  • lipid conjugated ligands e.g., mannose
  • LNP membrane-tethering lipoprotein
  • the anchor can be protein A/G and any structural form of antibodies including scFv, Fab, and VHH single domain antibody or nanobodies with extrinsic lipidation signal (e.g., palmitoylation, prenylation, and miristoylation) encoded either at its N-terminus or at its C-terminus.
  • extrinsic lipidation signal e.g., palmitoylation, prenylation, and miristoylation
  • Lipid compositions generally include defined mixtures of cationic, neutral, anionic, and amphipathic lipids. In some instances, specific lipids are included to prevent LNP aggregation, prevent lipid oxidation, or provide functional chemical groups that facilitate attachment of additional moieties. Lipid composition can influence overall LNP size and stability.
  • the lipid composition comprises dilinoleylmethyl- 4-dimethylaminobutyrate (MC3) or MC3-like molecules.
  • MC3 and MC3- like lipid compositions can be formulated to include one or more other lipids, such as a PEG or PEG-conjugated lipid, phosphocholine, phosphoethanolamine, a sterol, or neutral lipids.
  • Nucleic-acid vectors, such as expression vectors, exposed directly to serum can have several undesirable consequences, including degradation of the nucleic acid by serum nucleases or off-target stimulation of the immune system by the free nucleic acids.
  • an alphavirus vector is fully encapsulated within the delivery vehicle, such as within the aqueous interior of an LNP.
  • Encapsulation of the alphavirus vector within an LNP can be carried out by techniques well-known to those skilled in the art, such as microfluidic mixing and droplet generation carried out on a microfluidic droplet generating device. Such devices include, but are not limited to, standard T-junction devices or flow-focusing devices.
  • the desired lipid formulation such as MC3 or MC3-like containing compositions
  • the droplet generating device can control the size range and size distribution of the LNPs produced.
  • the LNP can have a size ranging from 1 to 1000 nanometers in diameter, e.g., 1, 10, 50, 100, 500, or 1000 nanometers.
  • the delivery vehicles encapsulating the expression vectors can be further treated or modified to prepare them for administration.
  • SAM Self-amplifying mRNA
  • compositions described herein can be used together with other compositions featuring distinct (e.g., non-SAM) vector backbones.
  • SAM compositions can be used as part of a vaccine strategy that also uses vector backbones of chimpanzee origin to encode an antigen cassette.
  • a nucleotide sequence of a chimpanzee C68 adenovirus also referred to herein as ChAdV68
  • ChAdV68 adenovirus
  • Use of C68 adenovirus derived vectors are described further in USPN 6,083,716, US Application Pub. No. US20200197500A1, and international patent application publication WO2020/243719, each of which is herein incorporated by reference in its entirety, for all purposes.
  • Antigens can include nucleotides or polypeptides.
  • an antigen can be an RNA sequence that encodes for a polypeptide sequence.
  • Antigens useful in vaccines can therefore include nucleotide sequences or polypeptide sequences.
  • Neoantigen peptides can be described in the context of their coding sequence where a neoantigen includes the nucleotide sequence (e.g., DNA or RNA) that codes for the related polypeptide sequence.
  • peptides derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue for example any polypeptide known to or have been found to be aberrantly expressed in a tumor cell or cancerous tissue in comparison to a normal cell or tissue.
  • Suitable polypeptides from which the antigenic peptides can be derived can be found for example in the COSMIC database.
  • COSMIC curates comprehensive information on somatic mutations in human cancer.
  • a peptide can contain a tumor specific mutation.
  • Tumor antigens e.g, shared tumor antigens and tumor neoantigens
  • peptides derived from any polypeptide associated with an infectious disease organism, an infection in a subject, or an infected cell of a subject.
  • Antigens can be derived from nucleotide sequences or polypeptide sequences of an infectious disease organism.
  • Polypeptide sequences of an infectious disease organism include, but are not limited to, a pathogen-derived peptide, a virus-derived peptide, a bacteria-derived peptide, a fungus-derived peptide, and/or a parasite-derived peptide.
  • Infectious disease organism include, but are not limited to, Severe acute respiratory syndrome-related coronavirus (SARS), severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), Ebola, HIV, Hepatitis B virus (HBV), influenza, Hepatitis C virus (HCV), Human papillomavirus (HPV), Cytomegalovirus (CMV), Chikungunya virus, Respiratory syncytial virus (RSV), Dengue virus, a orthymyxoviridae family virus, and tuberculosis.
  • SARS Severe acute respiratory syndrome-related coronavirus
  • SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
  • Ebola HIV
  • HBV Hepatitis B virus
  • HCV Hepatitis C virus
  • HPV Human papillomavirus
  • CMV Cytomegalovirus
  • Chikungunya virus Chikungunya virus
  • RSV Respiratory syncytial virus
  • peptides that comprise infectious disease organism specific antigens or epitopes identified by the methods disclosed herein, peptides that comprise known infectious disease organism specific antigens or epitopes, and mutant polypeptides or fragments thereof identified by methods disclosed herein.
  • Antigen peptides can be described in the context of their coding sequence where an antigen includes the nucleotide sequence (e.g., DNA or RNA) that codes for the related polypeptide sequence.
  • Vectors and associated compositions described herein can be used to deliver antigens from any organism, including their toxins or other by-products, to prevent and/or treat infection or other adverse reactions associated with the organism or its by-product.
  • Antigens that can be incorporated into a vaccine include immunogens which are useful to immunize a human or non-human animal against viruses, such as pathogenic viruses which infect human and non-human vertebrates. Antigens may be selected from a variety of viral families.
  • Example of desirable viral families against which an immune response would be desirable include, the picomavirus family, which includes the genera rhinoviruses, which are responsible for about 50% of cases of the common cold; the genera enteroviruses, which include polioviruses, coxsackieviruses, echoviruses, and human enteroviruses such as hepatitis A virus; and the genera apthoviruses, which are responsible for foot and mouth diseases, primarily in non-human animals.
  • target antigens include the VP1, VP2, VP3, VP4, and VPG.
  • Another viral family includes the calcivirus family, which encompasses the Norwalk group of viruses, which are an important causative agent of epidemic gastroenteritis.
  • Still another viral family desirable for use in targeting antigens for stimulating immune responses in humans and non-human animals is the togavirus family, which includes the genera alphavirus, which include Sindbis viruses, RossRiver vims, and Venezuelan, Eastern & Western Equine encephalitis, and rubivirus, including Rubella vims.
  • the Flaviviridae family includes dengue, yellow fever, Japanese encephalitis, St. Louis encephalitis and tick borne encephalitis viruses.
  • target antigens may be generated from the Hepatitis C or the coronavirus family, which includes a number of non-human viruses such as infectious bronchitis vims (poultry), porcine transmissible gastroenteric vims (pig), porcine hemagglutinating encephalomyelitis vims (pig), feline infectious peritonitis vims (cats), feline enteric coronavims (cat), canine coronavims (dog), and human respiratory coronavimses, which may cause the common cold and/or non-A, B or C hepatitis.
  • infectious bronchitis vims proultry
  • porcine transmissible gastroenteric vims pig
  • porcine hemagglutinating encephalomyelitis vims pig
  • feline infectious peritonitis vims cats
  • feline enteric coronavims cat
  • canine coronavims dog
  • human respiratory coronavimses which may cause the
  • target antigens include the El (also called M or matrix protein), E2 (also called S or Spike protein), E3 (also called HE or hemagglutin-elterose) glycoprotein (not present in all coronaviruses), or N (nucleocapsid). Still other antigens may be targeted against the rhabdovirus family, which includes the genera vesiculovirus (e.g., Vesicular Stomatitis Virus), and the general lyssavirus (e.g., rabies). Within the rhabdovirus family, suitable antigens may be derived from the G protein or the N protein.
  • the family filoviridae which includes hemorrhagic fever viruses such as Marburg and Ebola virus, may be a suitable source of antigens.
  • the paramyxovirus family includes parainfluenza Virus Type 1, parainfluenza Virus Type 3, bovine parainfluenza Virus Type 3, rubulavirus (mumps virus), parainfluenza Virus Type 2, parainfluenza virus Type 4, Newcastle disease virus (chickens), rinderpest, morbillivirus, which includes measles and canine distemper, and pneumovirus, which includes respiratory syncytial virus (e.g., the glyco-(G) protein and the fusion (F) protein, for which sequences are available from GenBank).
  • respiratory syncytial virus e.g., the glyco-(G) protein and the fusion (F) protein, for which sequences are available from GenBank.
  • Influenza virus is classified within the family orthomyxovirus and can be suitable source of antigens (e.g., the HA protein, the N1 protein).
  • the bunyavirus family includes the genera bunyavirus (California encephalitis, La Crosse), phlebovirus (Rift Valley Fever), hantavirus (puremala is a hemahagin fever virus), nairovirus (Nairobi sheep disease) and various unassigned bungaviruses.
  • the arenavirus family provides a source of antigens against LCM and Lassa fever virus.
  • the reovirus family includes the genera reovirus, rotavirus (which causes acute gastroenteritis in children), orbiviruses, and cultivirus (Colorado Tick fever, Lebombo (humans), equine encephalosis, blue tongue).
  • the retrovirus family includes the sub-family oncorivirinal which encompasses such human and veterinary diseases as feline leukemia virus, HTLVI and HTLVII, lentivirinal (which includes human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), feline immunodeficiency virus (FIV), equine infectious anemia virus, and spumavirinal).
  • suitable antigens include, without limitation the gag, pol, Vif, Vpx, VPR, Env, Tat, Nef, and Rev proteins, as well as various fragments thereof.
  • suitable fragments of the Env protein may include any of its subunits such as the gpl20, gpl60, gp41, or smaller fragments thereof, e.g., of at least about 8 amino acids in length.
  • fragments of the tat protein may be selected.
  • HIV and SIV immunogenic proteins or peptides may be used to form fusion proteins or other immunogenic molecules. See, e.g., the HIV-1 Tat and/or Nef fusion proteins and immunization regimens described in WO 01/54719, published Aug. 2, 2001, and WO 99/16884, published Apr. 8, 1999.
  • the invention is not limited to the HIV and/or SIV immunogenic proteins or peptides described herein.
  • the papovavirus family includes the sub-family polyomaviruses (BKU and JCU viruses) and the sub-family papillomavirus (associated with cancers or malignant progression of papilloma).
  • the adenovirus family includes viruses (EX, AD7, ART), O.B.) which cause respiratory disease and/or enteritis.
  • the parvovirus family feline parvovirus feline enteritis
  • feline panleucopeniavirus canine parvovirus
  • porcine parvovirus The herpesvirus family includes the sub-family alphaherpesvirinae, which encompasses the genera simplexvirus (HSVI, HSVII), varicellovirus (pseudorabies, varicella zoster) and the sub-family betaherpesvirinae, which includes the genera cytomegalovirus (Human CMV), muromegalovirus) and the sub-family gammaherpesvirinae, which includes the genera lymphocryptovirus, EBV (Burkitts lymphoma), infectious rhinotracheitis, Marek's disease virus, and rhadinovirus.
  • EBV Backitts lymphoma
  • infectious rhinotracheitis Marek's disease virus
  • rhadinovirus The herpesvirus family includes the sub-family alphaherpesvirinae, which encompasses
  • the poxvirus family includes the sub-family chordopoxyirinae, which encompasses the genera orthopoxvirus (Variola (Smallpox) and Vaccinia (Cowpox)), parapoxvirus, avipoxvirus, capripoxvirus, leporipoxvirus, suipoxvirus, and the sub-family entomopoxyirinae.
  • the hepadnavirus family includes the Hepatitis B virus.
  • One unclassified virus which may be suitable source of antigens is the Hepatitis delta virus.
  • Still other viral sources may include avian infectious bursal disease virus and porcine respiratory and reproductive syndrome virus.
  • the alphavirus family includes equine arteritis virus and various Encephalitis viruses.
  • Antigens that can be incorporated into a vaccine also include immunogens which are useful to immunize a human or non-human animal against pathogens including bacteria, fungi, parasitic microorganisms or multicellular parasites which infect human and non-human vertebrates.
  • pathogens including bacteria, fungi, parasitic microorganisms or multicellular parasites which infect human and non-human vertebrates.
  • pathogens include pathogenic gram-positive cocci include pneumococci; staphylococci; and streptococci.
  • Pathogenic gram-negative cocci include meningococcus; gonococcus.
  • Pathogenic enteric gram-negative bacilli include enterobacteriaceae; pseudomonas, acinetobacteria and eikenella, melioidosis; salmonella; shigella; Haemophilus (Haemophilus influenzae, Haemophilus somnus ); moraxella; H. ducreyi (which causes chancroid); brucella; Franisella tularensis (which causes tularemia); yersinia (pasteurella ); streptobacillus moniliformis and spirillum.
  • Gram-positive bacilli include listeria monocytogenes; erysipelothrix rhusiopathiae; Corynebacterium diphtheria (diphtheria); cholera; B. anthracis (anthrax); donovanosis (granuloma inguinale); and bartonellosis.
  • Diseases caused by pathogenic anaerobic bacteria include tetanus; botulism; other clostridia; tuberculosis; leprosy; and other mycobacteria.
  • Examples of specific bacterium species are, without limitation, Streptococcus pneumoniae, Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus faecalis, Moraxella catarrhalis, Helicobacter pylori, Neisseria meningitidis, Neisseria gonorrhoeae, Chlamydia trachomatis, Chlamydia pneumoniae, Chlamydia psittaci, Bordetella pertussis, Salmonella typhi, Salmonella typhimurium, Salmonella choleraesuis, Escherichia coli, Shigella, Vibrio cholerae, Corynebacterium diphtheriae, Mycobacterium tuberculosis, Mycobacterium avium, Mycobacterium intr acellular e complex, Proteus mirabilis, Proteus vulgaris, Staphyloc
  • Pathogenic spirochetal diseases include syphilis; treponematoses: yaws, pinta and endemic syphilis; and leptospirosis.
  • Other infections caused by higher pathogen bacteria and pathogenic fungi include actinomycosis; nocardiosis; cryptococcosis ( Cryptococcus ), blastomycosis ( Blastomyces ), histoplasmosis ( Histoplasma ) and coccidioidomycosis ( Coccidiodes ); candidiasis (Candida), aspergillosis ( Aspergillis ), and mucormycosis; sporotrichosis; paracoccidiodomycosis, petriellidiosis, torulopsosis, mycetoma and chromomycosis; and dermatophytosis.
  • Rickettsial infections include Typhus fever, Rocky Mountain spotted fever, Q fever, and Rickettsialpox.
  • mycoplasma and chlamydial infections include: mycoplasma pneumoniae; lymphogranuloma venereum; psittacosis; and perinatal chlamydial infections.
  • Pathogenic eukaryotes encompass pathogenic protozoans and helminths and infections produced thereby include: amebiasis; malaria; leishmaniasis (e.g., caused by Leishmania major); trypanosomiasis; toxoplasmosis (e.g., caused by Toxoplasma gondii); Pneumocystis carinii; Trichans; Toxoplasma gondii; babesiosis; giardiasis (e.g., caused by Giardia); trichinosis (e.g., caused by Trichomonas); filariasis; schistosomiasis (e.g., caused by Schistosoma); nematodes; trematodes or flukes; and cestode (tapeworm) infections.
  • amebiasis e.g., caused by Leishmania major
  • trypanosomiasis toxoplasmosis
  • peptides derived from any polypeptide associated with an infectious disease organism, an infection in a subject, or an infected cell of a subject are also disclosed herein.
  • Antigens can be derived from nucleic acid sequences or polypeptide sequences of an infectious disease organism.
  • Polypeptide sequences of an infectious disease organism include, but are not limited to, a pathogen-derived peptide, a virus-derived peptide, a bacteria-derived peptide, a fungus-derived peptide, and/or a parasite-derived peptide.
  • Infectious disease organism include, but are not limited to, Severe acute respiratory syndrome-related coronavirus (SARS), severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), Ebola, HIV, Hepatitis B virus (HBV), influenza, Hepatitis C virus (HCV), Human papillomavirus (HPV), Cytomegalovirus (CMV), Chikungunya virus, Respiratory syncytial virus (RSV), Dengue virus, a orthymyxoviridae family virus, and tuberculosis.
  • SARS Severe acute respiratory syndrome-related coronavirus
  • SARS-CoV-2 severe acute respiratory syndrome coronavirus 2
  • Ebola HIV
  • HBV Hepatitis B virus
  • HCV Hepatitis C virus
  • HPV Human papillomavirus
  • CMV Cytomegalovirus
  • Chikungunya virus Chikungunya virus
  • RSV Respiratory syncytial virus
  • Antigens can be selected that are predicted to be presented on the cell surface of a cell, such as a tumor cell, an infected cell, or an immune cell, including professional antigen presenting cells such as dendritic cells. Antigens can be selected that are predicted to be immunogenic.
  • One or more polypeptides encoded by an antigen nucleotide sequence can comprise at least one of: a binding affinity with MHC with an IC50 value of less than lOOOnM, for MHC Class I peptides a length of 8-15, 8, 9, 10, 11, 12, 13, 14, or 15 amino acids, presence of sequence motifs within or near the peptide promoting proteasome cleavage, and presence or sequence motifs promoting TAP transport.
  • MHC Class II peptides a length 6-30, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18,19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids, presence of sequence motifs within or near the peptide promoting cleavage by extracellular or lysosomal proteases (e.g., cathepsins) or HLA-DM catalyzed HLA binding.
  • extracellular or lysosomal proteases e.g., cathepsins
  • HLA-DM catalyzed HLA binding e.g., HLA-DM catalyzed HLA binding.
  • One or more antigens can be presented on the surface of a tumor.
  • One or more antigens can be presented on the surface of an infected cell.
  • One or more antigens can be immunogenic in a subject having a tumor, e.g., capable of stimulating a T cell response and/or a B cell response in the subject.
  • One or more antigens can be immunogenic in a subject having or suspected to have an infection, e.g., capable of stimulating a T cell response and/or a B cell response in the subject.
  • One or more antigens can be immunogenic in a subject at risk of an infection, e.g., capable of stimulating a T cell response and/or a B cell response in the subject that provides immunological protection (i.e., immunity) against the infection, e.g., such as stimulating the production of memory T cells, memory B cells, and/or antibodies specific to the infection.
  • immunological protection i.e., immunity
  • One or more antigens can be capable of stimulating a B cell response, such as the production of antibodies that recognize the one or more antigens (e.g ., antibodies that recognize an infectious disease antigen).
  • Antibodies can recognize linear polypeptide sequences or recognize secondary and tertiary structures.
  • B cell antigens can include linear polypeptide sequences or polypeptides having secondary and tertiary structures, including, but not limited to, full-length proteins, protein subunits, protein domains, or any polypeptide sequence known or predicted to have secondary and tertiary structures
  • Antigens capable of stimulating a B cell response to an infection can be an antigen found on the surface of an infectious disease organism.
  • Antigens capable of eliciting a B cell response to an infection can be an intracellular antigen expressed in an infectious disease organism.
  • One or more antigens can include a combination of antigens capable of stimulating a T cell response (e.g., peptides including predicted T cell epitope sequences) and distinct antigens capable of stimulating aB cell response (e.g., full-length proteins, protein subunits, protein domains).
  • a T cell response e.g., peptides including predicted T cell epitope sequences
  • distinct antigens capable of stimulating aB cell response e.g., full-length proteins, protein subunits, protein domains.
  • One or more antigens that stimulate an autoimmune response in a subject can be excluded from consideration in the context of vaccine generation for a subject.
  • the size of at least one antigenic peptide molecule can comprise, but is not limited to, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, about 30, about 31, about 32, about 33, about 34, about 35, about 36, about 37, about 38, about 39, about 40, about 41, about 42, about 43, about 44, about 45, about 46, about 47, about 48, about 49, about 50, about 60, about 70, about 80, about 90, about 100, about 110, about 120 or greater amino molecule residues, and any range derivable therein.
  • the antigenic peptide molecules are equal to or less than 50 amino acids.
  • Antigenic peptides and polypeptides can be: for MHC Class 1 15 residues or less in length and usually consist of between about 8 and about 11 residues, particularly 9 or 10 residues; for MHC Class II, 6-30 residues, inclusive.
  • a longer peptide can be designed in several ways.
  • a longer peptide could consist of either: (1) individual presented peptides with an extensions of 2-5 amino acids toward the N- and C-terminus of each corresponding gene product; (2) a concatenation of some or all of the presented peptides with extended sequences for each.
  • sequencing reveals a long (>10 residues) neoepitope sequence present in the tumor (e.g.
  • a longer peptide would consist of: (3) the entire stretch of novel tumor-specific or infectious disease-specific amino acids— thus bypassing the need for computational or in vitro test-based selection of the strongest HLA-presented shorter peptide.
  • use of a longer peptide allows endogenous processing by patient cells and may lead to more effective antigen presentation and stimulation of T cell responses.
  • Longer peptides can also include a full- length protein, a protein subunit, a protein domain, and combinations thereof of a peptide, such as those expressed in an infectious disease organism. Longer peptides (e.g., full-length protein, protein subunit, or protein domain) and combinations thereof can be included to stimulate a B cell response.
  • Antigenic peptides and polypeptides can be presented on an HLA protein. In some aspects antigenic peptides and polypeptides are presented on an HLA protein with greater affinity than a wild-type peptide. In some aspects, an antigenic peptide or polypeptide can have an IC50 of at least less than 5000 nM, at least less than 1000 nM, at least less than 500 nM, at least less than 250 nM, at least less than 200 nM, at least less than 150 nM, at least less than 100 nM, at least less than 50 nM or less.
  • antigenic peptides and polypeptides do not stimulate an autoimmune response and/or invoke immunological tolerance when administered to a subject.
  • compositions comprising at least two or more antigenic peptides.
  • the composition contains at least two distinct peptides.
  • At least two distinct peptides can be derived from the same polypeptide.
  • distinct polypeptides is meant that the peptide vary by length, amino acid sequence, or both.
  • Tumor-specific peptides can be derived from any polypeptide known to or have been found to contain a tumor specific mutation or peptides derived from any polypeptide known to or have been found to have altered expression in a tumor cell or cancerous tissue in comparison to a normal cell or tissue, for example any polypeptide known to or have been found to be aberrantly expressed in a tumor cell or cancerous tissue in comparison to a normal cell or tissue.
  • Peptides can be derived from any polypeptide known to or suspected to be associated with an infectious disease organism, or peptides derived from any polypeptide known to or have been found to have altered expression in an infected cell in comparison to a normal cell or tissue (e.g, an infectious disease polynucleotide or polypeptide, including infectious disease polynucleotides or polypeptides with expression restricted to a host cell).
  • Suitable polypeptides from which the antigenic peptides can be derived can be found for example in the COSMIC database or the AACR Genomics Evidence Neoplasia Information Exchange (GENIE) database.
  • COSMIC curates comprehensive information on somatic mutations in human cancer.
  • AACR GENIE aggregates and links clinical-grade cancer genomic data with clinical outcomes from tens of thousands of cancer patients.
  • a peptide can include a tumor- specific mutation. In some aspects the tumor specific mutation is a driver mutation for a particular cancer type.
  • Antigenic peptides and polypeptides having a desired activity or property can be modified to provide certain desired attributes, e.g., improved pharmacological characteristics, while increasing or at least retaining substantially all of the biological activity of the unmodified peptide to bind the desired MHC molecule and activate the appropriate T cell.
  • antigenic peptide and polypeptides can be subject to various changes, such as substitutions, either conservative or non-conservative, where such changes might provide for certain advantages in their use, such as improved MHC binding, stability or presentation.
  • conservative substitutions is meant replacing an amino acid residue with another which is biologically and/or chemically similar, e.g., one hydrophobic residue for another, or one polar residue for another.
  • the substitutions include combinations such as Gly, Ala; Val, lie, Leu, Met; Asp, Glu; Asn, Gin; Ser, Thr; Lys, Arg; and Phe, Tyr.
  • the effect of single amino acid substitutions may also be probed using D-amino acids.
  • Modifications of peptides and polypeptides with various amino acid mimetics or unnatural amino acids can be particularly useful in increasing the stability of the peptide and polypeptide in vivo. Stability can be assayed in a number of ways. For instance, peptidases and various biological media, such as human plasma and serum, have been used to test stability. See, e.g., Verhoef et ak, Eur. J. Drug Metab Pharmacokin. 11:291-302 (1986). Half- life of the peptides can be conveniently determined using a 25% human serum (v/v) assay. The protocol is generally as follows.
  • pooled human serum (Type AB, non-heat inactivated) is delipidated by centrifugation before use. The serum is then diluted to 25% with RPMI tissue culture media and used to test peptide stability. At predetermined time intervals a small amount of reaction solution is removed and added to either 6% aqueous trichloracetic acid or ethanol. The cloudy reaction sample is cooled (4 degrees C) for 15 minutes and then spun to pellet the precipitated serum proteins. The presence of the peptides is then determined by reversed-phase HPLC using stability-specific chromatography conditions.
  • the peptides and polypeptides can be modified to provide desired attributes other than improved serum half-life. For instance, the ability of the peptides to stimulate CTL activity can be enhanced by linkage to a sequence which contains at least one epitope that is capable of stimulating a T helper cell response.
  • Immunogenic peptides/T helper conjugates can be linked by a spacer molecule.
  • the spacer is typically comprised of relatively small, neutral molecules, such as amino acids or amino acid mimetics, which are substantially uncharged under physiological conditions.
  • the spacers are typically selected from, e.g., Ala, Gly, or other neutral spacers of nonpolar amino acids or neutral polar amino acids.
  • the optionally present spacer need not be comprised of the same residues and thus can be a hetero- or homo-oligomer.
  • the spacer will usually be at least one or two residues, more usually three to six residues.
  • the peptide can be linked to the T helper peptide without a spacer.
  • An antigenic peptide can be linked to the T helper peptide either directly or via a spacer either at the amino or carboxy terminus of the peptide.
  • the amino terminus of either the antigenic peptide or the T helper peptide can be acylated.
  • Exemplary T helper peptides include tetanus toxoid 830-843, influenza 307-319, malaria circumsporozoite 382-398 and 378-389.
  • Proteins or peptides can be made by any technique known to those of skill in the art, including the expression of proteins, polypeptides or peptides through standard molecular biological techniques, the isolation of proteins or peptides from natural sources, or the chemical synthesis of proteins or peptides.
  • the nucleotide and protein, polypeptide and peptide sequences corresponding to various genes have been previously disclosed, and can be found at computerized databases known to those of ordinary skill in the art.
  • One such database is the National Center for Biotechnology Information's Genbank and GenPept databases located at the National Institutes of Health website.
  • the coding regions for known genes can be amplified and/or expressed using the techniques disclosed herein or as would be known to those of ordinary skill in the art.
  • various commercial preparations of proteins, polypeptides and peptides are known to those of skill in the art.
  • an antigen includes a nucleic acid (e.g. polynucleotide) that encodes an antigenic peptide or portion thereof.
  • the polynucleotide can be, e.g., DNA, cDNA, PNA, CNA, RNA (e.g., mRNA), either single- and/or double-stranded, or native or stabilized forms of polynucleotides, such as, e.g., polynucleotides with a phosphorothiate backbone, or combinations thereof and it may or may not contain introns.
  • a polynucleotide sequence encoding an antigen can be sequence-optimized to improve expression, such as through improving transcription, translation, post-transcriptional processing, and/or RNA stability.
  • polynucleotide sequence encoding an antigen can be codon-optimized.
  • Codon-optimization herein refers to replacing infrequently used codons, with respect to codon bias of a given organism, with frequently used synonymous codons.
  • Polynucleotide sequences can be optimized to improve post-transcriptional processing, for example optimized to reduce unintended splicing, such as through removal of splicing motifs (e.g ., canonical and/or cryptic/non-canonical splice donor, branch, and/or acceptor sequences) and/or introduction of exogenous splicing motifs (e.g., splice donor, branch, and/or acceptor sequences) to bias favored splicing events.
  • splicing motifs e.g ., canonical and/or cryptic/non-canonical splice donor, branch, and/or acceptor sequences
  • exogenous splicing motifs e.g., splice donor, branch, and/or acceptor sequences
  • Exogenous intron sequences include, but are not limited to, those derived from SV40 (e.g, an SV40 mini-intron) and derived from immunoglobulin
  • Exogenous intron sequences can be incorporated between a promoter/enhancer sequence and the antigen(s) sequence. Exogenous intron sequences for use in expression vectors are described in more detail in Callendret et al. (Virology. 2007 Jul 5; 363(2): 288-302), herein incorporated by reference for all purposes.
  • Polynucleotide sequences can be optimized to improve transcript stability, for example through removal of RNA instability motifs (e.g, AU-rich elements and 3’ UTR motifs) and/or repetitive nucleotide sequences. Polynucleotide sequences can be optimized to improve accurate transcription, for example through removal of cryptic transcriptional initiators and/or terminators.
  • Polynucleotide sequences can be optimized to improve translation and translational accuracy, for example through removal of cryptic AUG start codons, premature polyA sequences, and/or secondary structure motifs. Polynucleotide sequences can be optimized to improve nuclear export of transcripts, such as through addition of a Constitutive Transport Element (CTE), RNA Transport Element (RTE), or Woodchuck Posttranscriptional Regulatory Element (WPRE). Nuclear export signals for use in expression vectors are described in more detail in Callendret et al. (Virology. 2007 Jul 5; 363(2): 288- 302), herein incorporated by reference for all purposes.
  • CTE Constitutive Transport Element
  • RTE RNA Transport Element
  • WPRE Woodchuck Posttranscriptional Regulatory Element
  • Polynucleotide sequences can be optimized with respect to GC content, for example to reflect the average GC content of a given organism. Sequence optimization can balance one or more sequence properties, such as transcription, translation, post-transcriptional processing, and/or RNA stability. Sequence optimization can generate an optimal sequence balancing each of transcription, translation, post-transcriptional processing, and RNA stability. Sequence optimization algorithms are known to those of skill in the art, such as GeneArt (Thermo Fisher), Codon Optimization Tool (IDT), Cool Tool (University of Singapore), SGI-DNA (La Jolla California). One or more regions of an antigen-encoding protein can be sequence-optimized separately.
  • a still further aspect provides an expression vector capable of expressing a polypeptide or portion thereof.
  • Expression vectors for different cell types are well known in the art and can be selected without undue experimentation.
  • DNA is inserted into an expression vector, such as a plasmid, in proper orientation and correct reading frame for expression. If necessary, DNA can be linked to the appropriate transcriptional and translational regulatory control nucleotide sequences recognized by the desired host, although such controls are generally available in the expression vector.
  • the vector is then introduced into the host through standard techniques. Guidance can be found e.g. in Sambrook et al. (1989) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N. Y. Vaccine Compositions
  • an immunogenic composition e.g., a vaccine composition, capable of raising a specific immune response, e.g., a tumor-specific immune response or an infectious disease organism-specific immune response.
  • Vaccine compositions typically comprise one or a plurality of antigens, e.g., selected using a method described herein or selected from a pathogen-derived peptide, a virus-derived peptide, a bacteria- derived peptide, a fungus-derived peptide, and/or a parasite-derived peptide.
  • Vaccine compositions can also be referred to as vaccines.
  • a vaccine can contain between 1 and 30 peptides, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 different peptides, 6, 7, 8, 9, 10 11, 12, 13, or 14 different peptides, or 12, 13 or 14 different peptides.
  • Peptides can include post-translational modifications.
  • a vaccine can contain between 1 and 100 or more nucleotide sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
  • a vaccine can contain between 1 and 30 antigen sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18,
  • a vaccine can contain between 1 and 30 antigen-encoding nucleic acid sequences,
  • Antigen-encoding nucleic acid sequences can refer to the antigen encoding portion of an “antigen cassette.” Features of an antigen cassette are described in greater detail herein.
  • An antigen-encoding nucleic acid sequence can contain one or more epitope-encoding nucleic acid sequences ( e.g ., an antigen-encoding nucleic acid sequence encoding concatenated T cell epitopes).
  • a vaccine can contain between 1 and 30 distinct epitope-encoding nucleic acid sequences, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25,
  • Epitope-encoding nucleic acid sequences can refer to sequences for individual epitope sequences, such as each of the T cell epitopes in an antigen-encoding nucleic acid sequence encoding concatenated T cell epitopes.
  • a vaccine can contain at least two repeats of an epitope-encoding nucleic acid sequence.
  • a “repeat” refers to two or more iterations of an identical nucleic acid epitope-encoding nucleic acid sequence (inclusive of the optional 5’ linker sequence and/or the optional 3’ linker sequences described herein) within an antigen-encoding nucleic acid sequence.
  • the antigen-encoding nucleic acid sequence portion of a cassette encodes at least two repeats of an epitope-encoding nucleic acid sequence.
  • the antigen-encoding nucleic acid sequence portion of a cassette encodes more than one distinct epitope, and at least one of the distinct epitopes is encoded by at least two repeats of the nucleic acid sequence encoding the distinct epitope (i.e., at least two distinct epitope-encoding nucleic acid sequences).
  • an antigen-encoding nucleic acid sequence encodes epitopes A, B, and C encoded by epitope encoding nucleic acid sequences epitope-encoding sequence A (EA), epitope-encoding sequence B (EB), and epitope-encoding sequence C (Ec), and examplary antigen-encoding nucleic acid sequences having repeats of at least one of the distinct epitopes are illustrated by, but is not limited to, the formulas below:
  • the antigen-encoding nucleic acid sequences having repeats of at least one of the distinct epitopes can encode each of the distinct epitopes in any order or frequency.
  • the order and frequency can be a random arangement of the distinct epitopes, e.g ., in an example with epitopes A, B, and C, by the formula EA-EB-EC-EC-EA-EB-EA-EC-EA-EC-EC-EC-EB.
  • an antigen-encoding cassette having at least one antigen-encoding nucleic acid sequence described, from 5’ to 3’, by the formula:
  • E represents a nucleotide sequence comprising at least one of the at least one distinct epitope-encoding nucleic acid sequences
  • n represents the number of separate distinct epitope-encoding nucleic acid sequences and is any integer including 0,
  • Each E or E N can independently comprise any epitope-encoding nucleic acid sequence described herein (e.g, a peptide encoding an infectious disease T cell epitope and/or a neoantigen epitope).
  • Epitopes and linkers that can be used are further described herein.
  • Repeats of an epitope-encoding nucleic acid sequences can be linearly linked directly to one another (e.g ., EA-EA-... as illustrated above). Repeats of an epitope-encoding nucleic acid sequences can be separated by one or more additional nucleotides sequences. In general, repeats of an epitope-encoding nucleic acid sequences can be separated by any size nucleotide sequence applicable for the compositions described herein.
  • repeats of an epitope-encoding nucleic acid sequences can be separated by a separate distinct epitope-encoding nucleic acid sequence (e.g., EA-EB-EC-EA..., as illustrated above).
  • each epitope-encoding nucleic acid sequences (inclusive of optional 5’ linker sequence and/or the optional 3’ linker sequences) encodes a peptide 25 amino acids in length
  • the repeats can be separated by 75 nucleotides, such as in antigen-encoding nucleic acid represented by EA-EB-EA. . . , EA is separated by 75 nucleotides.
  • Trpl VTNTEMFVTAPDNLGYMYEVQWPGQTQPQIANCSVYDFFVWLHYYSVRDTVTNTE MFVTAPDNLGYMYEVQWPGQTQPQIANCSVYDFFVWLHYYSVRDT
  • Trpl the repeats of Trpl are separated by the 25mer Trp2 and thus the repreats of the Trpl epitope-encoding nucleic acid sequences are separated the 75 nucleotide Trp2 epitope-encoding nucleic acid sequence.
  • repeats are separated by 2, 3, 4, 5, 6, 7, 8, or 9 separate distinct epitope-encoding nucleic acid sequence, and each epitope-encoding nucleic acid sequences (inclusive of optional 5’ linker sequence and/or the optional 3’ linker sequences) encodes a peptide 25 amino acids in length
  • the repeats can be separated by 150, 225, 300, 375, 450, 525, 600, or 675 nucleotides, respectively.
  • different peptides and/or polypeptides or nucleotide sequences encoding them are selected so that the peptides and/or polypeptides capable of associating with different MHC molecules, such as different MHC class I molecules and/or different MHC class II molecules.
  • one vaccine composition comprises coding sequence for peptides and/or polypeptides capable of associating with the most frequently occurring MHC class I molecules and/or different MHC class II molecules.
  • vaccine compositions can comprise different fragments capable of associating with at least 2 preferred, at least 3 preferred, or at least 4 preferred MHC class I molecules and/or different MHC class II molecules.
  • the vaccine composition can be capable of stimulating a specific cytotoxic T-cell response and/or a specific helper T-cell response.
  • the vaccine composition can be capable of stimulating a specific cytotoxic T-cell response and a specific helper T-cell response.
  • the vaccine composition can be capable of stimulating a specific B-cell response e.g ., an antibody response).
  • the vaccine composition can be capable of stimulating a specific cytotoxic T-cell response, a specific helper T-cell response, and/or a specific B-cell response.
  • the vaccine composition can be capable of stimulating a specific cytotoxic T-cell response and a specific B-cell response.
  • the vaccine composition can be capable of stimulating a specific helper T- cell response and a specific B-cell response.
  • the vaccine composition can be capable of stimulating a specific cytotoxic T-cell response, a specific helper T-cell response, and a specific B-cell response.
  • a vaccine composition can further comprise an adjuvant and/or a carrier.
  • an adjuvant and/or a carrier examples of useful adjuvants and carriers are given herein below.
  • a composition can be associated with a carrier such as e.g. a protein or an antigen-presenting cell such as, e.g., a dendritic cell (DC) capable of presenting the peptide to a T-cell.
  • a carrier such as e.g. a protein or an antigen-presenting cell such as, e.g., a dendritic cell (DC) capable of presenting the peptide to a T-cell.
  • DC dendritic cell
  • Adjuvants are any substance whose admixture into a vaccine composition increases or otherwise modifies the immune response to an antigen.
  • Carriers can be scaffold structures, for example a polypeptide or a polysaccharide, to which an antigen, is capable of being associated.
  • adjuvants are conjugated covalently or non-covalently.
  • an adjuvant to increase an immune response to an antigen is typically manifested by a significant or substantial increase in an immune-mediated reaction, or reduction in disease symptoms.
  • an increase in humoral immunity is typically manifested by a significant increase in the titer of antibodies raised to the antigen
  • an increase in T-cell activity is typically manifested in increased cell proliferation, or cellular cytotoxicity, or cytokine secretion.
  • An adjuvant may also alter an immune response, for example, by changing a primarily humoral or Th response into a primarily cellular, or Th response.
  • Suitable adjuvants include, but are not limited to 1018 ISS, alum, aluminium salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, IC30, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PepTel vector system, PLG microparticles, resiquimod, SRL172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, R848, beta-glucan, Pam3Cys, Aquila's QS21 stimulon (Aquila Biol Biol
  • Adjuvants such as incomplete Freund's or GM-CSF are useful.
  • GM-CSF Several immunological adjuvants (e.g., MF59) specific for dendritic cells and their preparation have been described previously (Dupuis M, et al., Cell Immunol. 1998; 186(1): 18-27; Allison A C; Dev Biol Stand. 1998; 92:3-11).
  • cytokines can be used.
  • cytokines have been directly linked to influencing dendritic cell migration to lymphoid tissues (e.g., TNF-alpha), accelerating the maturation of dendritic cells into efficient antigen-presenting cells for T- lymphocytes (e.g., GM-CSF, IL-1 and IL-4) (U.S. Pat. No. 5,849,589, specifically incorporated herein by reference in its entirety) and acting as immunoadjuvants (e.g., IL-12) (Gabrilovich D I, et al., J Immunother Emphasis Tumor Immunol. 1996 (6):414-418).
  • CpG immunostimulatory oligonucleotides have also been reported to enhance the effects of adjuvants in a vaccine setting.
  • Other TLR binding molecules such as RNA binding TLR 7, TLR 8 and/or TLR 9 may also be used.
  • CpGs e.g. CpR, Idera
  • Poly(I:C)(e.g. polyi:CI2U) non-CpG bacterial DNA or RNA
  • immunoactive small molecules and antibodies such as cyclophosphamide, sunitinib, bevacizumab, celebrex, NCX-4016, sildenafil, tadalafil, vardenafil, sorafmib, XL- 999, CP-547632, pazopanib, ZD2171, AZD2171, ipilimumab, tremelimumab, and SC58175, which may act therapeutically and/or as an adjuvant.
  • CpGs e.g. CpR, Idera
  • Poly(I:C)(e.g. polyi:CI2U) e.g. polyi:CI2U
  • non-CpG bacterial DNA or RNA as well as immunoactive small molecules and antibodies
  • adjuvants and additives can readily be determined by the skilled artisan without undue experimentation.
  • Additional adjuvants include colony-stimulating factors, such as Granulocyte Macrophage Colony Stimulating Factor (GM-CSF, sargramostim).
  • GM-CSF Granulocyte Macrophage Colony Stimulating Factor
  • a vaccine composition can comprise more than one different adjuvant.
  • a therapeutic composition can comprise any adjuvant substance including any of the above or combinations thereof. It is also contemplated that a vaccine and an adjuvant can be administered together or separately in any appropriate sequence.
  • a carrier (or excipient) can be present independently of an adjuvant. The function of a carrier can for example be to increase the molecular weight of in particular mutant to increase activity or immunogenicity, to confer stability, to increase the biological activity, or to increase serum half-life.
  • a carrier can aid presenting peptides to T-cells.
  • a carrier can be any suitable carrier known to the person skilled in the art, for example a protein or an antigen presenting cell.
  • a carrier protein could be but is not limited to keyhole limpet hemocyanin, serum proteins such as transferrin, bovine serum albumin, human serum albumin, thyroglobulin or ovalbumin, immunoglobulins, or hormones, such as insulin or palmitic acid.
  • the carrier is generally a physiologically acceptable carrier acceptable to humans and safe.
  • tetanus toxoid and/or diptheria toxoid are suitable carriers.
  • the carrier can be dextrans for example sepharose.
  • Cytotoxic T-cells recognize an antigen in the form of a peptide bound to an MHC molecule rather than the intact foreign antigen itself.
  • the MHC molecule itself is located at the cell surface of an antigen presenting cell.
  • an activation of CTLs is possible if a trimeric complex of peptide antigen, MHC molecule, and APC is present.
  • it may enhance the immune response if not only the peptide is used for activation of CTLs, but if additionally APCs with the respective MHC molecule are added. Therefore, in some embodiments a vaccine composition additionally contains at least one antigen presenting cell.
  • Antigens can also be included in viral vector-based vaccine platforms, such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et ak, Adenoviruses, Molecular Therapy (2004) 10, 616 — 629), or lentivirus, including but not limited to second, third or hybrid second/third generation lentivirus and recombinant lentivirus of any generation designed to target specific cell types or receptors (See, e.g, Hu et ak, Immunization Delivered by Lentiviral Vectors for Cancer and Infectious Diseases, Immunol Rev.
  • viral vector-based vaccine platforms such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et ak, Adenoviruses, Molecular Therapy (2004) 10, 616 — 629), or lentivirus,
  • this approach can deliver one or more nucleotide sequences that encode one or more antigen peptides.
  • the sequences may be flanked by non-mutated sequences, may be separated by linkers or may be preceded with one or more sequences targeting a subcellular compartment (See, e.g., Gros et al., Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of melanoma patients, Nat Med. (2016) 22 (4):433-8, Stronen et al., Targeting of cancer neoantigens with donor-derived T cell receptor repertoires, Science.
  • antigen cassette is meant the combination of a selected antigen or plurality of antigens (e.g., antigen-encoding nucleic acid sequences) and the other regulatory elements necessary to transcribe the antigen(s) and express the transcribed product.
  • the selected antigen or plurality of antigens can refer to distinct epitope sequences, e.g, an antigen-encoding nucleic acid sequence in the cassette can encode an epitope-encoding nucleic acid sequence (or plurality of epitope-encoding nucleic acid sequences) such that the epitopes are transcribed and expressed.
  • An antigen or plurality of antigens can be operatively linked to regulatory components in a manner which permits transcription. Such components include conventional regulatory elements that can drive expression of the antigen(s) in a cell transfected with the viral vector.
  • the antigen cassette can also contain a selected promoter which is linked to the antigen(s) and located, with other, optional regulatory elements, within the selected viral sequences of the recombinant vector.
  • a cassette can include one or more antigens, such as one or more pathogen-derived peptides, virus-derived peptides, bacteria-derived peptides, fungus-derived peptides, parasite-derived peptides, and/or tumor-derived peptides.
  • a cassette can have one or more antigen-encoding nucleic acid sequences, such as a cassette containing multiple antigen-encoding nucleic acid sequences each independently operably linked to separate promoters and/or linked together using other multicistonic systems, such as 2A ribosome skipping sequence elements (e.g ., E2A, P2A, F2A, or T2A sequences) or Internal Ribosome Entry Site (IRES) sequence elements.
  • 2A ribosome skipping sequence elements e.g ., E2A, P2A, F2A, or T2A sequences
  • IRS Internal Ribosome Entry Site
  • a linker can also have a cleavage site, such as a TEV or furin cleavage site.
  • Linkers with cleavage sites can be used in combination with other elements, such as those in a multi cistronic system.
  • a furin protease cleavage site can be used in conjuction with a 2A ribosome skipping sequence element such that the furin protease cleavage site is configured to facilitate removal of the 2A sequence following translation.
  • each antigen-encoding nucleic acid sequence can contain one or more epitope-encoding nucleic acid sequences (e.g., an antigen-encoding nucleic acid sequence encoding concatenated T cell epitopes).
  • Useful promoters can be constitutive promoters or regulated (inducible) promoters, which will enable control of the amount of antigen(s) to be expressed.
  • a desirable promoter is that of the cytomegalovirus immediate early promoter/enhancer [see, e.g., Boshart et al, Cell, 41:521-530 (1985)].
  • Another desirable promoter includes the Rous sarcoma virus LTR promoter/enhancer.
  • Still another promoter/enhancer sequence is the chicken cytoplasmic beta-actin promoter [T. A. Kost et al, Nucl. Acids Res., 11(23):8287 (1983)].
  • Other suitable or desirable promoters can be selected by one of skill in the art.
  • the antigen cassette can also include nucleic acid sequences heterologous to the viral vector sequences including sequences providing signals for efficient polyadenylation of the transcript (poly(A), poly-A or pA) and introns with functional splice donor and acceptor sites.
  • a common poly-A sequence which is employed in the exemplary vectors of this invention is that derived from the papovavirus SV-40.
  • the poly-A sequence generally can be inserted in the cassette following the antigen-based sequences and before the viral vector sequences.
  • a common intron sequence can also be derived from SV-40, and is referred to as the SV-40 T intron sequence.
  • An antigen cassette can also contain such an intron, located between the promoter/enhancer sequence and the antigen(s).
  • An antigen cassette can have one or more antigens.
  • a given cassette can include 1-10, 1-20, 1-30, 10-20, 15-25, 15-20, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more antigens.
  • Antigens can be linked directly to one another.
  • Antigens can also be linked to one another with linkers.
  • Antigens can be in any orientation relative to one another including N to C or C to N.
  • the antigen cassette can be located in the site of any selected deletion in a viral vector, such as the deleted structural proteins of a VEEV backbone or the site of the El gene region deletion or E3 gene region deletion of a Ch Ad- based vector, among others which may be selected.
  • the antigen cassette can be described using the following formula to describe the ordered sequence of each element, from 5’ to 3’:
  • N comprises an MHC class I epitope-encoding nucleic acid sequence
  • L5 comprises a 5’ linker sequence
  • L3 comprises a 3’ linker sequence
  • G5 comprises a nucleic acid sequences encoding an amino acid linker
  • G3 comprises one of the at least one nucleic acid sequences encoding an amino acid linker
  • El comprises an MHC class II antigen-encoding nucleic acid sequence, where for each X the corresponding Nc is a epitope encoding nucleic acid sequence, where for each Y the corresponding Uf is a universal MHC class II epitope-encoding nucleic acid sequence.
  • a universal sequence can comprise at least one of Tetanus toxoid and PADRE.
  • a universal sequence can comprise a Tetanus toxoid peptide.
  • a universal sequence can comprise a PADRE peptide.
  • a universal sequence can comprise a Tetanus toxoid and PADRE peptides.
  • a vector backbone
  • Examples of linking the 3’ end of the antigen cassette to a vector backbone include linking directly to the 3’ UTR elements provided by the vector backbone, such as a 3’ 19-nt CSE.
  • Examples of linking the 5’ end of the antigen cassette to a vector backbone include linking directly to a promoter or 5’ UTR element of the vector backbone, such as subgenomic promoter sequence (e.g, a 26S subgenomic promoter sequence), an alphavirus 5’ UTR, a 51-nt CSE, or a 24-nt CSE.
  • each MHC class I epitope that is present can have a 5’ linker, a 3’ linker, neither, or both.
  • some MHC class I epitopes may have both a 5’ linker and a 3’ linker, while other MHC class I epitopes may have either a 5’ linker, a 3’ linker, or neither.
  • some MHC class I epitopes may have either a 5’ linker or a 3’ linker, while other MHC class I epitopes may have either a 5’ linker, a 3’ linker, or neither.
  • MHC class II epitopes may have both a 5’ linker and a 3’ linker, while other MHC class II epitopes may have either a 5’ linker, a 3’ linker, or neither.
  • some MHC class II epitopes may have either a 5’ linker or a 3’ linker, while other MHC class II epitopes may have either a 5’ linker, a 3’ linker, or neither.
  • each antigen that is present can have a 5’ linker, a 3’ linker, neither, or both.
  • some antigens may have both a 5’ linker and a 3’ linker, while other antigens may have either a 5’ linker, a 3’ linker, or neither.
  • some antigens may have either a 5’ linker or a 3’ linker, while other antigens may have either a 5’ linker, a 3’ linker, or neither.
  • the promoter nucleotide sequences P and/or P2 can be the same as a promoter nucleotide sequence provided by a vector backbone, such as an RNA alphavirus backbone.
  • the promoter sequence provided by the vector backbone, Pn and P2 can each comprise a subgenomic promoter sequence (e.g ., a 26S subgenomic promoter) or a CMV promoter.
  • the promoter nucleotide sequences P and/or P2 can be different from the promoter nucleotide sequence provided by a vector backbone (e.g., an RNA alphavirus backbone), as well as can be different from each other.
  • the 5’ linker L5 can be a native sequence or a non-natural sequence.
  • Non-natural sequence include, but are not limited to, AAY, RR, and DPP.
  • the 3’ linker L3 can also be a native sequence or a non-natural sequence. Additionally, L5 and L3 can both be native sequences, both be non-natural sequences, or one can be native and the other non-natural.
  • the amino acid linkers can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18,
  • amino acid linkers can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least
  • amino acid linker G5 for each Y, can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13,
  • the amino acid linkers can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
  • the amino acid linker G3 can be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94,95, 96, 97, 98, 99, 100 or more amino acids in length.
  • G3 can be also be at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
  • each N can encode a MHC class I epitope, a MHC class II epitope, an epitope/antigen capable of stimulating a B cell response, or a combination thereof.
  • each N can encode a combination of a MHC class I epitope, a MHC class II epitope, and an epitope/antigen capable of stimulating a B cell response.
  • each N can encode a combination of a MHC class I epitope and a MHC class II epitope.
  • each N can encode a combination of a MHC class I epitope and an epitope/antigen capable of stimulating a B cell response.
  • each N can encode a combination of a MHC class II epitope and an epitope/antigen capable of stimulating a B cell response.
  • each N can encode a MHC class II epitope.
  • each N can encode an epitope/antigen capable of stimulating a B cell response.
  • each N can encode a MHC class I epitope 7-15 amino acids in length.
  • each N can also encodes a MHC class I epitope 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acids in length.
  • each N can also encodes a MHC class I epitope at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 26, at least 27, at least 28, at least 29, or at least 30 amino acids in length.
  • the cassette encoding the one or more antigens can be 700 nucleotides or less.
  • the cassette encoding the one or more antigens can be 700 nucleotides or less and encode 2 distinct epitope-encoding nucleic acid sequences (e.g ., encode 2 distinct infectious disease or tumor derived nucleic acid sequences encoding an immunogenic polypeptide).
  • the cassette encoding the one or more antigens can be 700 nucleotides or less and encode at least 2 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 700 nucleotides or less and encode 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 700 nucleotides or less and encode at least 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 700 nucleotides or less and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7,
  • the cassette encoding the one or more antigens can be between 375-700 nucleotides in length.
  • the cassette encoding the one or more antigens can be between 375- 700 nucleotides in length and encode 2 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-700 nucleotides in length and encode at least 2 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-700 nucleotides in length and encode 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens be between 375-700 nucleotides in length and encode at least 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-700 nucleotides in length and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode 2 distinct epitope encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode at least 2 distinct epitope encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode 3 distinct epitope encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and encode at least 3 distinct epitope encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be 600, 500, 400, 300, 200, or 100 nucleotides in length or less and include 1-10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode 2 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode at least 2 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode 3 distinct epitope-encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and encode at least 3 distinct epitope encoding nucleic acid sequences.
  • the cassette encoding the one or more antigens can be between 375-600, between 375-500, or between 375-400 nucleotides in length and include 1- 10, 1-5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more antigens.
  • Vectors described herein can comprise a nucleic acid which encodes at least one antigen and the same or a separate vector can comprise a nucleic acid which encodes at least one immune modulator.
  • An immune modulator can include a binding molecule (e.g., an antibody such as an scFv) which binds to and blocks the activity of an immune checkpoint molecule.
  • An immune modulator can include a cytokine, such as IL-2, IL-7, IL-12 (including IL-12 p35, p40, p70, and/or p70-fusion constructs), IL-15, or IL-21.
  • An immune modulator can include a modified cytokine (e.g., pegIL-2).
  • Vectors can comprise an antigen cassette and one or more nucleic acid molecules encoding an immune modulator.
  • Illustrative immune checkpoint molecules that can be targeted for blocking or inhibition include, but are not limited to, CTLA-4, 4-1BB (CD137), 4-1BBL (CD137L), PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3, TIM3, B7H3, B7H4, VISTA, KIR, 2B4 (belongs to the CD2 family of molecules and is expressed on all NK, gd, and memory CD8+ (ab) T cells), CD160 (also referred to as BY55), and CGEN- 15049.
  • CTLA-4 CTLA-4
  • 4-1BB CD137
  • 4-1BBL CD137L
  • Immune checkpoint inhibitors include antibodies, or antigen binding fragments thereof, or other binding proteins, that bind to and block or inhibit the activity of one or more of CTLA-4, PDL1, PDL2, PD1, B7-H3, B7-H4, BTLA, HVEM, TIM3, GAL9, LAG3,
  • Illustrative immune checkpoint inhibitors include Tremelimumab (CTLA-4 blocking antibody), anti-OX40, PD- L1 monoclonal Antibody (Anti-B7-Hl; MEDI4736), ipilimumab, MK-3475 (PD-1 blocker), Nivolumamb (anti-PDl antibody), CT-011 (anti-PDl antibody), BY55 monoclonal antibody, AMP224 (anti-PDLl antibody), BMS-936559 (anti-PDLl antibody), MPLDL3280A (anti- PDL1 antibody), MSB0010718C (anti-PDLl antibody) and Yervoy/ipilimumab (anti-CTLA- 4 checkpoint inhibitor).
  • CTLA-4 blocking antibody CTLA-4 blocking antibody
  • Anti-B7-Hl PD- L1 monoclonal Antibody
  • ipilimumab MK-3475
  • MK-3475 PD-1 blocker
  • Nivolumamb anti-PDl antibody
  • Antibody-encoding sequences can be engineered into vectors such as C68 using ordinary skill in the art.
  • An exemplary method is described in Fang et al., Stable antibody expression at therapeutic levels using the 2A peptide. Nat Biotechnol. 2005 May;23(5):584-90. Epub 2005 Apr 17; herein incorporated by reference for all purposes. Payload-Encoding SAM Compositions
  • a SAM vector having the endogenous 5’ sequence of the self-replicating virus from which the SAM vector is derived e.g. , having endogenous 5’ VEEV nucleotides AU also referred to as “AU-SAM”) encoding one or more payload nucleic acid sequences, such as in a cassette.
  • cassette is meant the combination of a selected polynucleotide(s) (e.g, antigen-encoding nucleic acid sequences) and the other regulatory elements necessary to transcribe the polynucleotide (s) and, generally in instances of coding sequences, express the transcribed product.
  • a payload nucleic acid sequence can be any nucleic acid sequence desired to be delivered to a cell of interest.
  • the payload is a nucleic acid sequence linked to a promoter or any translational tools (e.g., IRES, any 2A self-cleaving peptide sequences such as P2A, E2A, F2A, and T2A) to drive expression of the nucleic acid sequence.
  • the payload nucleic acid sequence can encode a polypeptide (i.e., a nucleic acid sequence capable of being transcribed and translated into a protein).
  • a payload nucleic acid sequence encoding a peptide can encode any protein desired to be expressed in a cell.
  • proteins include, but are not limited to, an antigen (e.g, a MHC class I epitope, a MHC class II epitope, or an epitope capable of stimulating a B cell response), an antibody, a cytokine, a chimeric antigen receptor (CAR), a T-cell receptor, or a genome-editing system component (e.g, a nuclease used in a genome-editing system).
  • Genome-editing systems include, but are not limited to, a CRISPR system, a zinc-finger system, a meganuclease system, or a TALEN system.
  • the payload nucleic acid sequence can be non-coding (i.e., a nucleic acid sequence capable of being transcribed but is not translated into a protein).
  • a non-coding payload nucleic acid sequence can be any non-coding polynucleotide desired to be expressed in a cell.
  • Non-coding polynucleotides include, but are not limited to, RNA interference (RNAi) polynucleotides (e.g, antisense oligonucleotides, shRNAs, siRNAs, miRNAs etc.) or genome-editing system polynucleotide (e.g, a guide RNA [gRNA] with various/different lengths, a single-guide RNA [sgRNA], a trans-activating CRISPR [tracrRNA], and/or a CRISPR RNA [crRNA]).
  • RNA interference (RNAi) polynucleotides e.g, antisense oligonucleotides, shRNAs, siRNAs, miRNAs etc.
  • genome-editing system polynucleotide e.g, a guide RNA [gRNA] with various/different lengths, a single-guide RNA [sgRNA], a trans-activating CRISPR [tracrRNA], and/or a CRISPR
  • a payload nucleic acid sequence can have a combination of polypeptide-encoding nucleic acid sequences and non-coding nucleic acid sequences.
  • Methods for identifying antigens include identifying antigens that are likely to be presented on a cell surface (e.g, presented by MHC on a tumor cell, an infected cell, or an immune cell, including professional antigen presenting cells such as dendritic cells), and/or are likely to be immunogenic.
  • one such method may comprise the steps of: obtaining at least one of exome, transcriptome or whole genome nucleotide sequencing and/or expression data from a tumor, an infected cell, or an infectious disease organism, wherein the nucleotide sequencing data and/or expression data is used to obtain data representing peptide sequences of each of a set of antigens (e.g, antigens derived from the tumor or infectious disease organism); inputting the peptide sequence of each antigen into one or more presentation models to generate a set of numerical likelihoods that each of the antigens is presented by one or more MHC alleles on a cell surface, such as a tumor cell or an infected cell of the subject, the set of numerical likelihoods having been identified at least based on received mass spectrometry data; and selecting a subset of the set of antigens based on the set of numerical likelihoods to generate a set of selected antigens.
  • a set of antigens e.g, antigens derived from the tumor or infectious disease organism
  • Truncal peptides meaning those presented by all or most subclones, can be prioritized for inclusion into a vaccine.
  • further peptides can be prioritized by estimating the number and identity of subclones and choosing peptides so as to maximize the number of subclones covered by a vaccine.
  • an integrated multi-dimensional model can be considered that places candidate antigens in a space with at least the following axes and optimizes selection using an integrative approach.
  • HLA genes large number of HLA molecules involved in the presentation of a set of antigens may lower the probability that a tumor, an infectious disease, and/or an infected cell will escape immune attack via downregulation or mutation of HLA molecules
  • HLA classes covering both HLA-I and HLA-II may increase the probability of therapeutic response and decrease the probability of tumor or infectious disease escape
  • antigens can be deprioritized (e.g., excluded) from the vaccination if they are predicted to be presented by HLA alleles lost or inactivated in either all or part of the patient’s tumor or infected cell.
  • HLA allele loss can occur by either somatic mutation, loss of heterozygosity, or homozygous deletion of the locus.
  • Methods for detection of HLA allele somatic mutation are well known in the art, e.g. (Shukla et ah, 2015). Methods for detection of somatic LOH and homozygous deletion (including for HLA locus) are likewise well described.
  • Antigens can also be deprioritized if mass-spectrometry data indicates a predicted antigen is not presented by a predicted HLA allele.
  • Therapeutic and Manufacturing Methods Also provided is a method of stimulating a tumor specific immune response in a subject, vaccinating against a tumor, treating and/or alleviating a symptom of cancer in a subject by administering to the subject one or more antigens such as a plurality of antigens identified using methods disclosed herein.
  • a subject has been diagnosed with cancer or is at risk of developing cancer.
  • a subject can be a human, dog, cat, horse or any animal in which a tumor specific immune response is desired.
  • a tumor can be any solid tumor such as breast, ovarian, prostate, lung, kidney, gastric, colon, testicular, head and neck, pancreas, brain, melanoma, and other tumors of tissue organs and hematological tumors, such as lymphomas and leukemias, including acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, and B cell lymphomas.
  • a subject has been diagnosed with an infection or is at risk of an infection, such as age, geographical/travel, and/or work-related increased risk of or predisposition to an infection, or at risk to a seasonal and/or novel disease infection.
  • An antigen can be administered in an amount sufficient to stimulate a CTL response.
  • An antigen can be administered in an amount sufficient to stimulate a T cell response.
  • An antigen can be administered in an amount sufficient to stimulate a B cell response.
  • An antigen can be administered alone or in combination with other therapeutic agents.
  • Therapeutic agents can include those that target an infectious disease organism, such as an anti-viral or antibiotic agent.
  • a subject can be further administered an anti- immunosuppressive/immunostimulatory agent such as a checkpoint inhibitor.
  • an anti-CTLA antibody or anti-PD-1 or anti-PD-Ll can enhance the immune response to cancerous cells in the patient.
  • CTLA-4 blockade has been shown effective when following a vaccination protocol.
  • an antigen or its variant can be prepared for intravenous (i.v.) injection, sub-cutaneous (s.c.) injection, intradermal (i.d.) injection, intraperitoneal (i.p.) injection, intramuscular (i.m.) injection.
  • Methods of injection include s.c., i.d., i.p., i.m., and i.v.
  • Methods of DNA or RNA injection include i.d., i.m., s.c., i.p. and i.v.
  • Other methods of administration of the vaccine composition are known to those skilled in the art.
  • a vaccine can be compiled so that the selection, number and/or amount of antigens present in the composition is/are tissue, cancer, infectious disease, and/or patient- specific. For instance, the exact selection of peptides can be guided by expression patterns of the parent proteins in a given tissue or guided by mutation or disease status of a patient. The selection can be dependent on the specific type of cancer, the specific infectious disease (e.g . a specific infectious disease isolate/ strain the subject is infected with or at risk for infection by), the status of the disease, the goal of the vaccination (e.g., preventative or targeting an ongoing disease), earlier treatment regimens, the immune status of the patient, and, of course, the HLA-haplotype of the patient.
  • a vaccine can contain individualized components, according to personal needs of the particular patient. Examples include varying the selection of antigens according to the expression of the antigen in the particular patient or adjustments for secondary treatments following a first round or scheme of treatment.
  • a patient can be identified for administration of an antigen vaccine through the use of various diagnostic methods, e.g., patient selection methods described further below.
  • Patient selection can involve identifying mutations in, or expression patterns of, one or more genes.
  • Patient selection can involve identifying the infectious disease of an ongoing infection.
  • Patient selection can involve identifying risk of an infection by an infectious disease.
  • patient selection involves identifying the haplotype of the patient.
  • the various patient selection methods can be performed in parallel, e.g, a sequencing diagnostic can identify both the mutations and the haplotype of a patient.
  • the various patient selection methods can be performed sequentially, e.g, one diagnostic test identifies the mutations and separate diagnostic test identifies the haplotype of a patient, and where each test can be the same (e.g, both high-throughput sequencing) or different (e.g, one high-throughput sequencing and the other Sanger sequencing) diagnostic methods.
  • compositions to be used as a vaccine for cancer or an infectious disease antigens with similar normal self-peptides that are expressed in high amounts in normal tissues can be avoided or be present in low amounts in a composition described herein.
  • the tumor or infected cell of a patient expresses high amounts of a certain antigen
  • the respective pharmaceutical composition for treatment of this cancer or infection can be present in high amounts and/or more than one antigen specific for this particularly antigen or pathway of this antigen can be included.
  • compositions comprising an antigen can be administered to an individual already suffering from cancer or an infection.
  • compositions are administered to a patient in an amount sufficient to stimulate an effective CTL response to the tumor antigen or infectious disease organism antigen and to cure or at least partially arrest symptoms and/or complications.
  • An amount adequate to accomplish this is defined as "therapeutically effective dose.” Amounts effective for this use will depend on, e.g., the composition, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician.
  • compositions can generally be employed in serious disease states, that is, life-threatening or potentially life threatening situations, especially when a cancer has metastasized or an infectious disease organism has induced organ damage and/or other immune pathology. In such cases, in view of the minimization of extraneous substances and the relative nontoxic nature of an antigen, it is possible and can be felt desirable by the treating physician to administer substantial excesses of these compositions.
  • administration can begin at the detection or surgical removal of tumors, or begin at the detection or treatment of an infection. This can be followed by boosting doses until at least symptoms are substantially abated and for a period thereafter, or immunity is considered to be provided (e.g., a memory B cell or T cell population, or antigen specific B cells or antibodies are produced).
  • compositions for therapeutic treatment are intended for parenteral, topical, nasal, oral or local administration.
  • a pharmaceutical compositions can be administered parenterally, e.g., intravenously, subcutaneously, intradermally, or intramuscularly.
  • the compositions can be administered at a site of surgical excision to stimulate a local immune response to a tumor.
  • the compositions can be administered to target specific infected tissues and/or cells of a subject.
  • compositions for parenteral administration which comprise a solution of the antigen and vaccine compositions are dissolved or suspended in an acceptable carrier, e.g., an aqueous carrier.
  • aqueous carriers can be used, e.g., water, buffered water, 0.9% saline, 0.3% glycine, hyaluronic acid and the like. These compositions can be sterilized by conventional, well known sterilization techniques, or can be sterile filtered. The resulting aqueous solutions can be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration.
  • compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
  • auxiliary substances such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.
  • Antigens can also be administered via liposomes, which target them to a particular cells tissue, such as lymphoid tissue. Liposomes are also useful in increasing half-life. Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like. In these preparations the antigen to be delivered is incorporated as part of a liposome, alone or in conjunction with a molecule which binds to, e.g., a receptor prevalent among lymphoid cells, such as monoclonal antibodies which bind to the CD45 antigen, or with other therapeutic or immunogenic compositions.
  • a receptor prevalent among lymphoid cells such as monoclonal antibodies which bind to the CD45 antigen, or with other therapeutic or immunogenic compositions.
  • liposomes filled with a desired antigen can be directed to the site of lymphoid cells, where the liposomes then deliver the selected therapeutic/immunogenic compositions.
  • Liposomes can be formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. The selection of lipids is generally guided by consideration of, e.g., liposome size, acid lability and stability of the liposomes in the blood stream. A variety of methods are available for preparing liposomes, as described in, e.g., Szoka et ah, Ann. Rev. Biophys. Bioeng. 9; 467 (1980), U.S. Pat. Nos. 4,235,871, 4,501,728, 4,501,728, 4,837,028, and 5,019,369.
  • a ligand to be incorporated into the liposome can include, e.g., antibodies or fragments thereof specific for cell surface determinants of the desired immune system cells.
  • a liposome suspension can be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the peptide being delivered, and the stage of the disease being treated.
  • nucleic acids encoding a peptide and optionally one or more of the peptides described herein can also be administered to the patient.
  • a number of methods are conveniently used to deliver the nucleic acids to the patient.
  • the nucleic acid can be delivered directly, as "naked DNA". This approach is described, for instance, in Wolff et ak, Science 247: 1465-1468 (1990) as well as U.S. Pat. Nos. 5,580,859 and 5,589,466.
  • the nucleic acids can also be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253. Particles comprised solely of DNA can be administered.
  • DNA can be adhered to particles, such as gold particles.
  • Approaches for delivering nucleic acid sequences can include viral vectors, mRNA vectors, and DNA vectors with or without electroporation.
  • the nucleic acids can also be delivered complexed to cationic compounds, such as cationic lipids. Lipid-mediated gene delivery methods are described, for instance, in 9618372WOAWO 96/18372; 9324640WOAWO 93/24640; Mannino & Gould-Fogerite, BioTechniques 6(7): 682-691 (1988); U.S. Pat. No. 5,279,833 Rose U.S. Pat. No. 5,279,833; 9106309WOAWO 91/06309; and Feigner et al., Proc. Natl. Acad. Sci. USA 84: 7413-7414 (1987).
  • Antigens can also be included in viral vector-based vaccine platforms, such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616 — 629), or lentivirus, including but not limited to second, third or hybrid second/third generation lentivirus and recombinant lentivirus of any generation designed to target specific cell types or receptors (See, e.g, Hu et al., Immunization Delivered by Lentiviral Vectors for Cancer and Infectious Diseases, Immunol Rev.
  • viral vector-based vaccine platforms such as vaccinia, fowlpox, self-replicating alphavirus, marabavirus, adenovirus (See, e.g., Tatsis et al., Adenoviruses, Molecular Therapy (2004) 10, 616 — 629), or lentivirus,
  • this approach can deliver one or more nucleotide sequences that encode one or more antigen peptides.
  • the sequences may be flanked by non-mutated sequences, may be separated by linkers or may be preceded with one or more sequences targeting a subcellular compartment (See, e.g., Gros et al., Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of melanoma patients, Nat Med. (2016) 22 (4):433-8, Stronen et al., Targeting of cancer neoantigens with donor-derived T cell receptor repertoires, Science.
  • infected cells Upon introduction into a host, infected cells express the antigens, and thereby stimulate a host immune (e.g., CTL) response against the peptide(s).
  • Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848.
  • Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al. (Nature 351 :456-460 (1991)).
  • a means of administering nucleic acids uses minigene constructs encoding one or multiple epitopes.
  • the amino acid sequences of the epitopes are reverse translated.
  • a human codon usage table is used to guide the codon choice for each amino acid.
  • minigene design To optimize expression and/or immunogenicity, additional elements can be incorporated into the minigene design.
  • amino acid sequence that could be reverse translated and included in the minigene sequence include: helper T lymphocyte, epitopes, a leader (signal) sequence, and an endoplasmic reticulum retention signal.
  • MHC presentation of CTL epitopes can be improved by including synthetic (e.g. poly-alanine) or naturally-occurring flanking sequences adjacent to the CTL epitopes.
  • the minigene sequence is converted to DNA by assembling oligonucleotides that encode the plus and minus strands of the minigene.
  • Overlapping oligonucleotides (30-100 bases long) are synthesized, phosphorylated, purified and annealed under appropriate conditions using well known techniques. The ends of the oligonucleotides are joined using T4 DNA ligase. This synthetic minigene, encoding the CTL epitope polypeptide, can then cloned into a desired expression vector.
  • Purified plasmid DNA can be prepared for injection using a variety of formulations. The simplest of these is reconstitution of lyophilized DNA in sterile phosphate- buffer saline (PBS). A variety of methods have been described, and new techniques can become available. As noted above, nucleic acids are conveniently formulated with cationic lipids. In addition, glycolipids, fusogenic liposomes, peptides and compounds referred to collectively as protective, interactive, non-condensing (PINC) could also be complexed to purified plasmid DNA to influence variables such as stability, intramuscular dispersion, or trafficking to specific organs or cell types.
  • PINC protective, interactive, non-condensing
  • Also disclosed is a method of manufacturing a vaccine comprising performing the steps of a method disclosed herein; and producing a vaccine comprising a plurality of antigens or a subset of the plurality of antigens.
  • Antigens disclosed herein can be manufactured using methods known in the art.
  • a method of producing an antigen or a vector (e.g., a vector including at least one sequence encoding one or more antigens) disclosed herein can include culturing a host cell under conditions suitable for expressing the antigen or vector wherein the host cell comprises at least one polynucleotide encoding the antigen or vector, and purifying the antigen or vector.
  • Standard purification methods include chromatographic techniques, electrophoretic, immunological, precipitation, dialysis, filtration, concentration, and chromatofocusing techniques.
  • Host cells can include a Chinese Hamster Ovary (CHO) cell, NSO cell, yeast, or a HEK293 cell.
  • Host cells can be transformed with one or more polynucleotides comprising at least one nucleic acid sequence that encodes an antigen or vector disclosed herein, optionally wherein the isolated polynucleotide further comprises a promoter sequence operably linked to the at least one nucleic acid sequence that encodes the antigen or vector.
  • the isolated polynucleotide can be cDNA.
  • a vaccination protocol can be used to dose a subject with one or more antigens.
  • a priming vaccine and a boosting vaccine can be used to dose the subject.
  • a priming vaccine can be based on SAM vaccine compositions described herein with a SAM having an endogenous 5’ sequence of the self-replicating virus from which the SAM vector is derived (e.g. , endogenous 5’ VEEV nucleotides AU also referred to as “AU- SAM”).
  • a boosting vaccine (including two or more boosting administrations) can be based on SAM vaccine compositions described herein with a SAM having an endogenous 5’ sequence of the self-replicating virus from which the SAM vector is derived (e.g, endogenous 5’ VEEV nucleotides AU also referred to as “AU-SAM”).
  • SAM having an endogenous 5’ sequence of the self-replicating virus from which the SAM vector is derived
  • AU-SAM endogenous 5’ VEEV nucleotides AU also referred to as “AU-SAM”.
  • a vaccination protocol can include both a priming vaccine and a boosting vaccine each based on SAM vaccine compositions described herein with a SAM having an endogenous 5’ sequence of the self-replicating virus from which the SAM vector is derived (e.g, endogenous 5’ VEEV nucleotides AU also referred to as “AU-SAM”).
  • a priming vaccine and a boosting vaccine each based on SAM vaccine compositions described herein with a SAM having an endogenous 5’ sequence of the self-replicating virus from which the SAM vector is derived (e.g, endogenous 5’ VEEV nucleotides AU also referred to as “AU-SAM”).
  • a priming vaccine including for use in combination with a SAM having an endogenous 5’ sequence, can also be based on C68 (e.g., the sequences shown in SEQ ID NO: 1 or 2) or SAM (e.g., the sequences shown in SEQ ID NO:3 or 4).
  • a boosting vaccine including for use in combination with a SAM having an endogenous 5’ sequence, can also be based on C68 (e.g., the sequences shown in SEQ ID NO:l or 2) or SAM (e.g., the sequences shown in SEQ ID NO:3 or 4).
  • Each vector in a prime/boost strategy typically includes a cassette that includes antigens.
  • Cassettes can include about 1-50 antigens, separated by spacers such as the natural sequence that normally surrounds each antigen or other non-natural spacer sequences such as AAY.
  • Cassettes can also include MHCII antigens such a tetanus toxoid antigen and PADRE antigen, which can be considered universal class II antigens.
  • Cassettes can also include a targeting sequence such as a ubiquitin targeting sequence.
  • each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) an immune modulator.
  • Each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) a checkpoint inhibitor (CPI).
  • CPI checkpoint inhibitor
  • CPI’s can include those that inhibit CTLA4, PD1, and/or PDL1 such as antibodies or antigen-binding portions thereof. Such antibodies can include tremelimumab or durvalumab.
  • Each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) a cytokine, such as IL-2, IL-7, IL-12 (including IL-12 p35, p40, p70, and/or p70-fusion constructs), IL-15, or IL-21.
  • a cytokine such as IL-2, IL-7, IL-12 (including IL-12 p35, p40, p70, and/or p70-fusion constructs), IL-15, or IL-21.
  • Each vaccine dose can be administered to the subject in conjunction with (e.g., concurrently, before, or after) a modified cytokine (e.g., pegIL-2).
  • a modified cytokine e.g., pegIL-2
  • a priming vaccine can be injected (e.g., intramuscularly) in a subject. Bilateral injections per dose can be used.
  • ChAdV68 e.g., total dose lxlO 12 viral particles
  • one or more injections of SAM vectors at low vaccine dose selected from the range 0.001 to 1 ug RNA, in particular 0.1 or 1 ug can be used
  • one or more injections of SAM vectors at high vaccine dose selected from the range 1 to 100 ug RNA, in particular 10 or 100 ug can be used.
  • a vaccine boost (boosting vaccine) can be injected (e.g., intramuscularly) after prime vaccination.
  • a boosting vaccine can be administered about every 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 weeks, e.g., every 4 weeks and/or 8 weeks after the prime. Bilateral injections per dose can be used.
  • ChAdV68 e.g., total dose lxlO 12 viral particles
  • one or more injections of SAM vectors at low vaccine dose selected from the range 0.001 to 1 ug RNA, in particular 0.1 or 1 ug can be used
  • one or more injections of SAM vectors at high vaccine dose selected from the range 1 to 100 ug RNA, in particular 10 or 100 ug can be used.
  • Anti-CTLA-4 (e.g., tremelimumab) can also be administered to the subject.
  • anti-CTLA4 can be administered subcutaneously near the site of the intramuscular vaccine injection (ChAdV68 prime or SAM low doses) to ensure drainage into the same lymph node.
  • Tremelimumab is a selective human IgG2 mAb inhibitor of CTLA-4.
  • Target Anti-CTLA-4 (tremelimumab) subcutaneous dose is typically 70-75 mg (in particular 75 mg) with a dose range of, e.g., 1-100 mg or 5-420 mg.
  • an anti-PD-Ll antibody can be used such as durvalumab (MEDI 4736).
  • Durvalumab is a selective, high affinity human IgGl mAb that blocks PD-L1 binding to PD-1 and CD80.
  • Durvalumab is generally administered at 20 mg/kg i.v. every 4 weeks.
  • Immune monitoring can be performed before, during, and/or after vaccine administration. Such monitoring can inform safety and efficacy, among other parameters.
  • PBMCs are commonly used. PBMCs can be isolated before prime vaccination, and after prime vaccination (e.g. 4 weeks and 8 weeks). PBMCs can be harvested just prior to boost vaccinations and after each boost vaccination (e.g. 4 weeks and 8 weeks).
  • Immune responses can be assessed as part of an immune monitoring protocol. For example, the ability of a vaccine composition described herein to stimulate an immune response can be monitored and/or assessed.
  • “stimulate an immune response” refers to any increase in a immune response, such as initiating an immune response (e.g., a priming vaccine stimulating the initiation of an immune response in a naive subject) or enhancement of an immune response (e.g, a boosting vaccine stimulating the enhancement of an immune response in a subject having a pre existing immune response to an antigen, such as a pre-existing immune response initiated by a priming vaccine).
  • T cell responses can be measured using one or more methods known in the art such as ELISpot, intracellular cytokine staining, cytokine secretion and cell surface capture, T cell proliferation, MHC multimer staining, or by cytotoxicity assay.
  • T cell responses to epitopes encoded in vaccines can be monitored from PBMCs by measuring induction of cytokines, such as IFN-gamma, using an ELISpot assay.
  • Specific CD4 or CD8 T cell responses to epitopes encoded in vaccines can be monitored from PBMCs by measuring induction of cytokines captured intracellularly or extracellularly, such as IFN-gamma, using flow cytometry.
  • Specific CD4 or CD8 T cell responses to epitopes encoded in the vaccines can be monitored from PBMCs by measuring T cell populations expressing T cell receptors specific for epitope/MHC class I complexes using MHC multimer staining.
  • Specific CD4 or CD8 T cell responses to epitopes encoded in the vaccines can be monitored from PBMCs by measuring the ex vivo expansion of T cell populations following 3H-thymidine, bromodeoxyuridine and carboxyfluoresceine-diacetate- succinimidylester (CFSE) incorporation.
  • the antigen recognition capacity and lytic activity of PBMC-derived T cells that are specific for epitopes encoded in vaccines can be assessed functionally by chromium release assay or alternative colorimetric cytotoxicity assays.
  • B cell responses can be measured using one or more methods known in the art such as assays used to determine B cell differentiation (e.g, differentiation into plasma cells), B cell or plasma cell proliferation, B cell or plasma cell activation (e.g ., upregulation of costimulatory markers such as CD80 or CD86), antibody class switching, and/or antibody production (e.g., an ELISA).
  • Antibodies can also be assessed for function, such as assessed for neutralizing ability.
  • the compounds provided herein may be isolated and purified by known standard procedures. Such procedures include (but are not limited to) trituration, column chromatography, HPLC, or supercritical fluid chromatography (SFC). The following schemes are presented with details as to the preparation of representative oxysterols that have been listed herein.
  • the compounds provided herein may be prepared from known or commercially available starting materials and reagents by one skilled in the art of organic synthesis.
  • Exemplary chiral columns available for use in the separation/purification of the enantiomers/diastereomers provided herein include, but are not limited to, CHIRALPAK® AD- 10, CHIRALCEL® OB, CHIRALCEL® OB-H, CHIRALCEL® OD, CHIRALCEL® OD-H, CHIRALCEL® OF, CHIRALCEL® OG, CHIRALCEL® OJ and CHIRALCEL®
  • PE petroleum ether
  • EtOAc ethyl acetate
  • THF tetrahydrofuran
  • PCC pyridinium chlorochromate
  • TLC thin layer chromatography
  • PCC pyridinium chlorochromate
  • t-BuOK potassium tert-butoxide
  • 9-BBN 9-borabicyclo[3.3.1]nonane
  • Pd(7- BU3P)2 bis(tri-tert-butylphosphine)palladium(0)
  • AcCl acetyl chloride
  • z-PrMgCl Isopropylmagnesium chloride
  • TBSC1 tert-Butyl(chloro)dimethylsilane
  • (z-PrO)4Ti titanium tetraisopropoxide
  • BHT 2,6-di-t-butyl-4-methylphenoxide
  • Me methyl
  • z-Pr iso-propy
  • 2’-fluoro nucleotide 6 can be prepared via the synthetic steps outlined in General Scheme I, or the like.
  • 2’- methoxy ethyl -nucleotide 10 can be prepared via the synthetic steps outlined in General Scheme II, or the like.
  • Nucleotide 5 can be reacted with imidazole and 1,1 bis(bis(di- isopropyl)chlorosilyl)methane to form deprotected nucleotide 8. Exposure of 8 to NaHMDS and MeOCEhCEhBr will give protected T - methoxyethyl-nucleotide 8. Deprotection of nucleotide 9 using TBAF can afford 2’- methoxyethyl-nucleotide 10.
  • T trifluoromethyl nucleotide 16 can be prepared via the synthetic steps outlined in General Scheme III, or the like. For example, synthesis of this nucleotide can be replicated using the steps outlined in Jeannot, F., et. al. “Synthesis and antiviral evaluation of 2’-deoxy-2’-C-trifluoromethyl-P-D- ribonucleoside analogues bearing the five naturally occurring nucleic bases” Org. Biomol. Chem., 2003, 7, 2096-2102.
  • compound phosphonamidite 19 can be reacted with protected nucleotide 20 under suitable conditions to afford dinucleotide 21.
  • Deprotection of 4,4'- dimethoxytrityl dinucleotide 21 can be achieved through exposure to a protic acid, yielding dinucleotide 22.
  • Treatment of hydroxy dinucleotide 22 with 2-cyanoethyl N,N,N',N'- tetraisopropylphosphorodiamidite can give 2-cyanoethyl phosphosphorodiamidite 23.
  • 2-cyanoethyl phosphosphorodiamidite 23 Oxidation under suitable conditions (e.g., I2, H2O) of 2-cyanoethyl phosphosphorodiamidite 23 can give 2-cyanoethyl phosphate 24.
  • 2-cyanoethyl phosphate 24 can be deprotected under suitable conditions.
  • the resultant dinucleotide can be coupled to m7 G diphosphate 25 to accomplish synthesis of a compound of Formula (1-1).
  • m7 G diphosphate 25 can be prepared using methods known in the art. For example, see Kore, A. R., el. al. “An Industrial Process for Selective Synthesis of 7-methyl Guanosine 5’ -Diphosphate: Versatile Synthon of Synthesis of mRNA Cap Analogues” Nucleosides, Nucleotides, and Nucleic Acids 25:337-340, 2006, DOF10.1080/15257770500544552.
  • an RNA alphavirus backbone for the antigen expression system was generated from a self-replicating Venezuelan Equine Encephalitis virus (“VEEV”; Kinney, 1986, Virology 152: 400-413) by deleting the structural proteins of VEEV located 3’ of the 26S subgenomic promoter, except the last 50 amino acids of El (VEEV sequences 7544 to 11,175 deleted; numbering based on Kinney et al 1986;
  • VEEV Venezuelan Equine Encephalitis virus
  • SEQ ID NO:6 To generate the self-amplifying mRNA (“SAM”) vector, the deleted sequences were replaced by antigen sequences.
  • a representative SAM vector containing 20 model antigens is “VEE-MAG25mer” (SEQ ID NO:4).
  • a modified T7 RNA polymerase promoter (TAATACGACTCACTATA), which lacks the canonical 3’ dinucleotide GG, was added to the 5’ end of the SAM vector to generate the in vitro transcription template DNA (SEQ ID NO:57; 7544 to 11,175 deleted without an inserted antigen cassette).
  • An additional template production vector was produced adding a PCR forward primer sequence and 3’ restriction sites (SEQ ID NO:58; 7544 to 11,175 deleted without an inserted antigen cassette).
  • RNA produced using the template above contains an m 7 G cap directly linked to the endogenous 5’ VEEV nucleotide sequence, i.e., no additional intervening nucleotides are present between the m 7 G cap and the endogenous 5’ VEEV nucleotide sequence, such as the dinucleotide GG typically present when a canonical T7 RNA polymerase is used.
  • RNA production of SAM vectors with backbones beginning with endogenous nucleotides AUG and using a canonical or modified (“minimal”) T7 promoter is illustrated in FIG. 1.
  • AU-SAM vectors without additional intervening nucleotides located between the m 7 G cap and the endogenous 5’ AU nucleotides are referred to herein as “AU-SAM” vectors.
  • a schematic of a representative AU-SAM vector is shown in FIG. 2.
  • Capped AU-SAM RNA containing a cassette encoding representative antigens, was produced co-transcriptionally using the following steps: A DNA template was produced cloning an antigen cassette of interest into the in vitro transcription template DNA (SEQ ID NO:57)
  • a model antigen cassette (“MAG25mer”; nucleotide SEQ ID NO:34 and peptide SEQ ID NO:35) was inserted into the deleted region of the VEEV backbone.
  • Capped AU- SAM RNA was produced using either a trinucleotide m 7 G-ppp-A-U cap analogue or dinucleotide m 7 G-ppp-A cap analogue, as described above. As shown in FIG. 3, the reaction containing the trinucleotide m 7 G-ppp-A-U cap produced greater than 20-fold more RNA than the dinucleotide m 7 G-ppp-A cap analogue.
  • Capped AU-SAM RNA is also produced in an IVT reaction using the trinucleotide m 7 G-ppp-A-U cap analogues described herein, such as the below, at amounts greater than use of a dinucleotide m 7 G-ppp-A cap analogue.
  • SAM was either AU-SAM (produced as described above), or GG-SAM produced using a DNA template containing a canonical T7 promoter (SEQ ID NO: 8), where the RNA produced features a GG dinucleotide between the m 7 G cap and the endogenous 5’ VEEV nucleotide sequence.
  • SAM canonical T7 promoter
  • T cell responses to a AH1-A5 antigen class I epitope (SPSYAYHQF) encoded in the vaccines were monitored in splenocytes by measuring induction of cytokines, such as IFN-gamma.
  • cytokines such as IFN-gamma.
  • Freshly isolated lymphocytes at a density of 2-5xl0 6 cells/mL were incubated with lOuM of the indicated peptides for 2 hours. After two hours, brefeldin A was added to a concentration of 5ug/ml and cells were incubated with stimulant for an additional 4 hours.
  • This study was designed to evaluate and compare immunization in mice using SAM vectors containing either an m 7 G cap directly linked to the endogenous 5’ VEEV nucleotide sequence (AU-SAM) or a GG dinucleotide between the m 7 G cap and the endogenous 5’ VEEV nucleotide sequence (GG-SAM).
  • the MAG25mer model antigen cassette inserted into the self-amplifying backbone featured the AH1-A5 antigen class I epitope SPSYAYHQF as a model non-self antigen.
  • mice were immunized, as described above, and splenocytes were collected on day 12 after the initial immunization and assessed for antigen-specific immune response.
  • vaccination with AU-SAM generated an ⁇ 2-fold increase in percentage of IFNy+ CD8 cells relative to GG-SAM, indicating vaccination with AU-SAM leads to an increased antigen-specific immune response relative to SAM vectors having a non-endogenous nucleotides on the 5’ terminus of the RNA.
  • AU-SAM Homologous boosts of AU-SAM were administered intramuscularly at weeks 4, 8, and 20 after prime vaccination. All 4 doses were 1 mg total per animal. For the first 3 doses (weeks 0, 4, 8), 2 mL of SAM was administered (1 mL per leg). For the 4 th dose (week 20), the injected volume was reduced to 1 mL (0.5 mL per leg).
  • PBMCs were isolated by density gradient centrifugation using lymphocyte separation medium (LSM) and Leucosep separator tubes. PBMCs were stained with propidium iodide and viable cells counted using the Cytoflex LX (Beckman Coulter). Samples were then resuspended at 4 x 10 6 cells/mL in RPMI complete (10% FBS).
  • IFNy ELISPOT assays were performed using pre-coated 96-well plates (MAbtech, Monkey IFNy ELISPOT PLUS, ALP (Kit Lot #36, Plate Lot #19)) following manufacturer’s protocol. For each sample and stimuli, 2.5 x 10 4 and 1 x 10 5 PBMCs per well were plated in triplicate with 10 ug/mL peptide stimuli (GenScript) and incubated overnight in complete RPMI. A human HBV S-antigen peptide not contained in the cassette (WLSLLVPFV, Genscript) was used as a negative control for each sample.
  • the antigen-specific immune response was assessed for each of the six Mamu- A*01 antigens. As shown in FIG. 6, antigen-specific immune responses in PBMCs through week 6 of the study were observed at all time-points assessed following immunization. An initial increase in SFCs per 10 6 PBMCs was observed for Mamu-A*01 antigens following the priming dose (weeks 2 and 3), followed by a contraction (week 4). Notably, an increase in SFCs per 10 6 PBMCs above the initial priming peak response was observed as early as 1 week following the boosting dose (weeks 5 and 6).
  • the antigen-specific immune response was assessed as the summed response to the six Mamu-A*01 antigens. As shown in FIG. 7, antigen-specific immune responses in PBMCs through week 22 of the study were observed at all time-points assessed following immunization. An initial increase in SFCs per 10 6 PBMCs was observed for the summed response to the six Mamu-A*01 antigens following the priming dose (weeks 2 and 3), followed by a contraction (week 4). An increase in SFCs per 10 6 PBMCs above the initial priming peak response was observed as early as 1 week following a first boosting dose administered at week 4 (weeks 5 and 6), followed by a contraction (week 8).
  • articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context.
  • the present disclosure includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process.
  • the present disclosure includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
  • the present disclosure encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim.
  • any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim.
  • elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group.

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Biomedical Technology (AREA)
  • General Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Virology (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Mycology (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Saccharide Compounds (AREA)
  • Medicinal Preparation (AREA)
PCT/US2021/028486 2020-04-21 2021-04-21 Capping compounds, compositions and methods of use thereof Ceased WO2021216776A2 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
CA3173803A CA3173803A1 (en) 2020-04-21 2021-04-21 Capping compounds, compositions and methods of use thereof
IL296855A IL296855A (en) 2020-04-21 2021-04-21 Capping compounds, compositions and methods of use thereof
KR1020227040442A KR20230015914A (ko) 2020-04-21 2021-04-21 캡핑 화합물, 조성물 및 이의 사용 방법
CN202180044091.7A CN115768437A (zh) 2020-04-21 2021-04-21 加帽化合物、组合物及其使用方法
EP21792935.5A EP4138854A4 (en) 2020-04-21 2021-04-21 STYLING COMPOUNDS, COMPOSITIONS AND METHODS OF USE THEREOF
JP2022563870A JP2023523414A (ja) 2020-04-21 2021-04-21 キャッピング化合物、組成物、及びその使用方法
AU2021260932A AU2021260932A1 (en) 2020-04-21 2021-04-21 Capping compounds, compositions and methods of use thereof
US18/048,407 US20230303614A1 (en) 2020-04-21 2022-10-20 Capping compounds, compositions and methods of use thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US202063013456P 2020-04-21 2020-04-21
US63/013,456 2020-04-21
US202063020473P 2020-05-05 2020-05-05
US63/020,473 2020-05-05

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US18/048,407 Continuation US20230303614A1 (en) 2020-04-21 2022-10-20 Capping compounds, compositions and methods of use thereof

Publications (2)

Publication Number Publication Date
WO2021216776A2 true WO2021216776A2 (en) 2021-10-28
WO2021216776A3 WO2021216776A3 (en) 2022-01-06

Family

ID=78269927

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2021/028486 Ceased WO2021216776A2 (en) 2020-04-21 2021-04-21 Capping compounds, compositions and methods of use thereof

Country Status (9)

Country Link
US (1) US20230303614A1 (https=)
EP (1) EP4138854A4 (https=)
JP (1) JP2023523414A (https=)
KR (1) KR20230015914A (https=)
CN (1) CN115768437A (https=)
AU (1) AU2021260932A1 (https=)
CA (1) CA3173803A1 (https=)
IL (1) IL296855A (https=)
WO (1) WO2021216776A2 (https=)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023025073A1 (zh) * 2021-08-27 2023-03-02 上海兆维科技发展有限公司 一种加帽类似物及其应用
WO2023147352A1 (en) * 2022-01-27 2023-08-03 Trilink Biotechnologies, Llc Trinucleotide cap analogs and methods of use thereof
WO2023081935A3 (en) * 2021-11-08 2023-08-31 Gritstone Bio, Inc. Self-amplifying rna compositions and methods of use thereof
WO2023159930A1 (zh) * 2022-02-28 2023-08-31 广州市恒诺康医药科技有限公司 用于rna加帽的化合物及其应用
WO2023220693A1 (en) * 2022-05-12 2023-11-16 SunVax mRNA Therapeutics Inc. Synthetic self-amplifying mrna molecules with secretion antigen and immunomodulator
WO2024075022A3 (en) * 2022-10-04 2024-07-25 BioNTech SE Rna constructs and uses thereof
US12060385B2 (en) 2022-02-28 2024-08-13 Guangzhou Henovcom Bioscience Co., Ltd. Compounds for RNA capping and uses thereof
EP4234567A4 (en) * 2020-10-20 2024-09-11 ST Pharm Co., Ltd. OLIGONUCLEOTIDE FOR 5-CAP RNA SYNTHESIS
WO2025037891A1 (ko) * 2023-08-14 2025-02-20 에스티팜 주식회사 5'-캡핑된 rna 합성용 올리고뉴클레오티드

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN120082547B (zh) * 2025-05-06 2025-10-03 北京悦康科创医药科技股份有限公司 用于自复制mRNA的加帽类似物及其应用

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017053297A1 (en) 2015-09-21 2017-03-30 Trilink Biotechnologies, Inc. Compositions and methods for synthesizing 5'-capped rnas
WO2017208191A1 (en) 2016-06-02 2017-12-07 Glaxosmithkline Biologicals Sa Zika viral antigen constructs
WO2018075827A1 (en) 2016-10-19 2018-04-26 Arcturus Therapeutics, Inc. Trinucleotide mrna cap analogs

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH0813274B2 (ja) * 1990-08-13 1996-02-14 アイシス・ファーマシューティカルス・インコーポレーテッド 遺伝子発現を検出及び変調する糖修飾されたオリゴヌクレオチド
PE20191345A1 (es) * 2016-11-23 2019-09-30 Gritstone Oncology Inc Administracion viral de neoantigenos
MX2019013259A (es) * 2017-05-08 2020-01-13 Gritstone Oncology Inc Vectores de neoantigeno de alfavirus.
ES2983060T3 (es) * 2017-08-18 2024-10-21 Modernatx Inc Variantes de ARN polimerasa

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017053297A1 (en) 2015-09-21 2017-03-30 Trilink Biotechnologies, Inc. Compositions and methods for synthesizing 5'-capped rnas
WO2017208191A1 (en) 2016-06-02 2017-12-07 Glaxosmithkline Biologicals Sa Zika viral antigen constructs
WO2018075827A1 (en) 2016-10-19 2018-04-26 Arcturus Therapeutics, Inc. Trinucleotide mrna cap analogs

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
ANDREW J. GEALL, AYUSH VERMA, GILLIS R. OTTEN, CHRISTINE A. SHAW, ARMIN HEKELE, KAUSTUV BANERJEE, YEN CU, CLAYTON W. BEARD, LUIS A: "Nonviral delivery of self-amplifying RNA vaccines.", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 109, no. 36, 4 September 2012 (2012-09-04), pages 14604 - 14609, XP002683929, ISSN: 0027-8424, DOI: 10.1073/PNAS.1209367109
ANONYMOUS: "VACCINIA CAPPING SYSTEM", NEW ENGLAND BIOLABS, 9 July 2024 (2024-07-09), pages 1 - 7, XP093210551, Retrieved from the Internet <URL:https://www.neb.com/en/products/m2080-vaccinia-capping-system>
MCCAFFREY ANTON P.: "RNA Epitranscriptome: Role of the 5' Cap : Producing superior mRNA therapeutics through optimized capping", GENETIC ENGINEERING & BIOTECHNOLOGY NEWS, vol. 39, no. 5, 1 May 2019 (2019-05-01), US , pages 59, 61, XP055936986, ISSN: 1935-472X, DOI: 10.1089/gen.39.05.17

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4234567A4 (en) * 2020-10-20 2024-09-11 ST Pharm Co., Ltd. OLIGONUCLEOTIDE FOR 5-CAP RNA SYNTHESIS
WO2023025073A1 (zh) * 2021-08-27 2023-03-02 上海兆维科技发展有限公司 一种加帽类似物及其应用
WO2023081935A3 (en) * 2021-11-08 2023-08-31 Gritstone Bio, Inc. Self-amplifying rna compositions and methods of use thereof
EP4430200A4 (en) * 2021-11-08 2026-02-11 Seattle Project Corp SELF-AMPLIDING RNA COMPOSITIONS AND THEIR METHODS OF USE
WO2023147352A1 (en) * 2022-01-27 2023-08-03 Trilink Biotechnologies, Llc Trinucleotide cap analogs and methods of use thereof
WO2023159930A1 (zh) * 2022-02-28 2023-08-31 广州市恒诺康医药科技有限公司 用于rna加帽的化合物及其应用
US12060385B2 (en) 2022-02-28 2024-08-13 Guangzhou Henovcom Bioscience Co., Ltd. Compounds for RNA capping and uses thereof
WO2023220693A1 (en) * 2022-05-12 2023-11-16 SunVax mRNA Therapeutics Inc. Synthetic self-amplifying mrna molecules with secretion antigen and immunomodulator
US12084703B2 (en) 2022-05-12 2024-09-10 SunVax mRNA Therapeutics Inc. Synthetic self-amplifying mRNA molecules with secretion antigen and immunomodulator
US12416032B2 (en) 2022-05-12 2025-09-16 SunVax mRNA Therapeutics Inc. Synthetic self-amplifying MRNA molecules with secretion antigen and immunomodulator
WO2024075022A3 (en) * 2022-10-04 2024-07-25 BioNTech SE Rna constructs and uses thereof
WO2025037891A1 (ko) * 2023-08-14 2025-02-20 에스티팜 주식회사 5'-캡핑된 rna 합성용 올리고뉴클레오티드

Also Published As

Publication number Publication date
IL296855A (en) 2022-11-01
WO2021216776A3 (en) 2022-01-06
EP4138854A2 (en) 2023-03-01
AU2021260932A1 (en) 2022-12-01
CA3173803A1 (en) 2021-10-28
KR20230015914A (ko) 2023-01-31
CN115768437A (zh) 2023-03-07
US20230303614A1 (en) 2023-09-28
JP2023523414A (ja) 2023-06-05
EP4138854A4 (en) 2024-12-25

Similar Documents

Publication Publication Date Title
US20230303614A1 (en) Capping compounds, compositions and methods of use thereof
US11771747B2 (en) Multiepitope vaccine cassettes
US20250108105A1 (en) Self-amplifying rna compositions and methods of use thereof
US20240050550A1 (en) Infectious disease antigens and vaccines
US20240167057A1 (en) Modified alphavirus vectors
US20230310563A1 (en) Antigen-encoding cassettes
US20240093235A1 (en) Homologous adenoviral vaccination

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21792935

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3173803

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022563870

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021792935

Country of ref document: EP

Effective date: 20221121

ENP Entry into the national phase

Ref document number: 2021260932

Country of ref document: AU

Date of ref document: 20210421

Kind code of ref document: A

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21792935

Country of ref document: EP

Kind code of ref document: A2