WO2021207150A1 - Genetically modified immune cells expressing a chimeric antigen receptor and having reduced proinflammatory cytokine signaling - Google Patents
Genetically modified immune cells expressing a chimeric antigen receptor and having reduced proinflammatory cytokine signaling Download PDFInfo
- Publication number
- WO2021207150A1 WO2021207150A1 PCT/US2021/025906 US2021025906W WO2021207150A1 WO 2021207150 A1 WO2021207150 A1 WO 2021207150A1 US 2021025906 W US2021025906 W US 2021025906W WO 2021207150 A1 WO2021207150 A1 WO 2021207150A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- immune cells
- cells
- population
- car
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/33—Antibodies; T-cell engagers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4214—Receptors for cytokines
- A61K40/4215—Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70578—NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/715—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
- C07K14/7155—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/244—Interleukins [IL]
- C07K16/248—IL-6
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/22—Intracellular domain
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1136—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against growth factors, growth regulators, cytokines, lymphokines or hormones
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2740/00—Reverse transcribing RNA viruses
- C12N2740/00011—Details
- C12N2740/10011—Retroviridae
- C12N2740/15011—Lentivirus, not HIV, e.g. FIV, SIV
- C12N2740/15041—Use of virus, viral particle or viral elements as a vector
- C12N2740/15043—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/10—Plasmid DNA
- C12N2800/106—Plasmid DNA for vertebrates
- C12N2800/107—Plasmid DNA for vertebrates for mammalian
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- Adoptive cell transfer therapy is a type of immunotherapy that involves ex vivo expansion of autologous or allogeneic immune cells and subsequent infusion into a patient.
- the immune cells may be modified ex vivo to specifically target malignant cells. Modifications include engineering of T cells to express chimeric antigen receptors (CARs).
- CARs chimeric antigen receptors
- the promise of adoptive cell transfer therapy, such as CAR T-cell (CAR-T) therapy is often limited by toxicity (e.g., cytokine-associated toxicity).
- adoptive cell transfer immunotherapy may trigger non-physiologic elevation of cytokine levels (cytokine release syndrome), which could lead to death of recipients (see, e.g., Morgan et al., Molecular Therapy 18(4): 843-851, 2010).
- modified immune cells may not expand well in patients.
- CAR-T cells expressing such a CAR construct, and optionally having a knock-out of an endogenous interferon g gene, are expected to show more effective proliferation of T cells upon activation by tumor target cells, and/or reduced cytokine toxicity, thereby enhancing CAR-T therapeutic efficacy, safety, or a combination thereof.
- a chimeric antigen receptor comprising: (a) an extracellular antigen binding domain; (b) a co-stimulatory domain such as a 4-1BB co-stimulatory domain; (c) an IL-2RP cytoplasmic signaling domain; and (d) a CD3 ⁇ signaling domain.
- the 4-1BB co-stimulatory signaling domain comprises the amino acid sequence set forth in KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 1).
- the IL-2RP cytoplasmic signaling domain may comprise the amino acid sequence set forth in
- the CD3 ⁇ signaling domain comprises the amino acid sequence set forth inRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQ EGLYNELQKDKMAEAY SEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPP R (SEQ ID NO: 3).
- any of the CAR disclosed herein may further comprise a transmembrane domain, which is C-terminal to the extracellular antigen binding domain and N-terminal to the 4-1BB co-stimulatory domain.
- a transmembrane domain may be derived from a cell surface receptor, which can be the alpha, beta or zeta chain of a T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, CD271, TNFRSF19 and Killer Cell Immunoglobulin- Like Receptor (KIR), or any combination thereof.
- KIR Killer Cell Immunoglobulin- Like Receptor
- the CAR disclosed herein may further comprise a hinge domain, which may be linked to the C-terminus of the extracellular antigen binding domain and to the N-terminus of the transmembrane domain.
- exemplary hinge domains may be of CD28, CD8, or an IgG, which optionally is IgGl or IgG4.
- the CAR disclosed herein may further comprise a STAT3 binding motif, which can be located at the C-terminal of the CD3z signaling domain.
- the STAT3 binding motif comprises the amino sequence set forth inYX 1 X 2 Q, wherein X 1 and X 2 are each independently an amino acid.
- the STAT3 binding motif comprises the aminoacid sequence set forth in YRHQ (SEQ ID NO: 4).
- the CAR disclosed herein may comprise a C-terminus fragment comprising the CD3 ⁇ signaling domain and the STAT3 binding motif, and wherein the C-terminus fragment comprises the amino acid sequence set forth in
- the extracellular antigen binding domain in the CAR disclosed herein may bind a tumor associated antigen.
- tumor associated antigen examples include, but are not limited to, 5T4, CD2, CD5, CD3, CD 7, CD 19, CD20, CD22, CD30, CD33, CD38, CD70, CD123, CD133, CD171,CEA, CS1, Claudin 18.2, BCMA, BAFF-R, PSMA, PSCA, desmoglein (Dsg3), HER-2, FAP, FSHR, NKG2D, GD2, EGFRVIII, mesothelin, ROR1, MAGE, MUC1, MUC16, GPC3, Lewis Y, and VEGFRII.
- the extracellular antigen binding domain is a single-chain antibody fragment (scFv).
- the extracellular antigen binding domain in the CAR is an scFv that binds CD19 (anti-CD19 scFv).
- anti-CD19 scFv may comprise the amino acid sequence of SEQ ID NO: 6.
- the anti-CD19 scFv may comprise the amino acid sequence of SEQ ID NO:39.
- the anti-CD19 scFv may comprise the amino acid sequence of SEQ ID NO:40.
- the anti-CD19 scFv may comprise the amino acid sequence of SEQ ID NO:41.
- the extracellular antigen binding domain in the CAR is an scFv that binds BCMA (anti-BCMA scFv).
- anti-BCMA scFv may comprise the amino acid sequence set forth in SEQ ID NO: 7.
- Any of the CAR disclosed herein may further comprise a signal peptide located at the N-terminus of the CAR.
- a population of immune cells comprising a first plurality of immune cells that express any of the CARs disclosed herein.
- Such a population of immune cells may further comprise a second plurality of immune cells that expresses an antibody specific to interleukin-6 (IL-6) or IL-6 receptor (IL-6R).
- IL-6 interleukin-6
- IL-6R IL-6 receptor
- the anti-IL6 or anti-IL6R antibody may comprise the same heavy chain complementarity determining domains (CDRs) and the same light chain CDRs as a reference antibody.
- the reference antibody can be one of the following:
- VH heavy chain variable domain
- VL light chain variable domain
- VH heavy chain variable domain
- VL light chain variable domain
- VH heavy chain variable domain
- VL light chain variable domain
- the antibody specific to IL-6 or IL-6R comprises the same VH and the same VL as the reference antibody.
- Any of the antibodies specific to IL-6 or IL-6R may be a scFv.
- the scFv may comprise the amino acid sequence of SEQ ID NO: 8.
- the scFv may comprise the amino acid sequence of SEQ ID NO:9.
- the scFv may comprise the amino acid sequence of SEQ ID NO:26.
- the scFv may comprise the amino acid sequence of SEQ ID NO: 27.
- the population of immune cells disclosed herein may further comprise a third plurality of immune cells that express an IL-1 antagonist.
- the IL-1 antagonist is IL- 1RA.
- At least two of the first plurality of immune cells, the second plurality of immune cells, and the third plurality of immune cells in the immune cell population comprise common members.
- at least 10% of the immune cells therein express the CAR, the antibody specific to IL-6 or IL-6R, and the IL-1 antagonist.
- about 50-70% of the cells express the CAR, the antibody specific to IL-6 or IL-6R, and the IL- 1 antagonist.
- the immune cells may te T-cells, Natural Killer (NK) cells, tumor infiltrating lymphocytes, dendritic cells, macrophages, B cells, neutrophils, eosinophils, basophils, mast cells, myeloid-derived suppressor cells, mesenchymal stem cells, precursors thereof, or a combination thereof.
- the immune cells are T cells.
- at least a portion of the T cells e.g.
- At least 30%, at least 40%, at least 50%, at least 60%, at least 70% or above) do not express one or more of an endogenous T cell receptor, CD52, interferon gamma (IFN- ⁇ ), beta-2 microglobulin (B2M), and granulocyte macrophage-colony stimulating factor (GM-CSF).
- IFN- ⁇ interferon gamma
- B2M beta-2 microglobulin
- GM-CSF granulocyte macrophage-colony stimulating factor
- at least a portion of the T cells e.g., at least 30%, at least 40%, at least 50%, at least 60%, at least 70% or above
- do not express IFN- ⁇ do not express IFN- ⁇ .
- a cell that does not express a protein of interest means that expression of the protein cannot be detected or only background level of expression can be detected by a conventional method (e.g., ELISA or FACS).
- a method for producing a population of modified immune cells comprising: (a) providing a population of immune cells (e.g., those disclosed herein); and (b) introducing into the immune cells a first nucleic acid coding for a CAR such as those disclosed herein.
- Such a method may further comprise (c) introducing into the immune cells a second nucleic acid coding for an antibody specific to interleukin-6 (IL-6) or IL-6 receptor (IL-6R), e.g., those disclosed herein.
- IL-6 interleukin-6
- IL-6R IL-6 receptor
- the first nucleic acid and the second nucleic acid are located in the same vector. In other instances, the first nucleic acid and the second nucleic acid are located in different vectors.
- the method may further comprise introducing into the immune cells a third nucleic acid encoding an IL-1 antagonist, for example, IL-1RA.
- a third nucleic acid encoding an IL-1 antagonist, for example, IL-1RA.
- the first nucleic acid and the third nucleic acid are located in the same vector.
- the second nucleic acid and the third nucleic acid are located in the same vector.
- the first nucleic acid, the second nucleic acid, and the third nucleic acid are located in different vectors.
- the present disclosure is based, at least in part, on the discovery that, unexpectedly, genetically engineered immune cells having reduced IFN ⁇ signaling (e.g., by knocking out endogenous IFNG gene or expressing an IFN ⁇ antagonist) maintained robust T cell cytotoxicity and also significantly reduced cytokine release syndrome (CRS) in patients receiving the CAR-T cell therapy.
- the reduced expression of the endogenous IFNG gene ranges from 5%-70% compared to the same type of immune cells having a wild-type IFNG gene.
- the present disclosure also provides a population of immune cells comprising a first plurality of genetically engineered immune cells that (a) comprise a disrupted endogenous interferon gamma (IFN ⁇ ) gene or IFN ⁇ receptor (IFN ⁇ R) gene; and/or (b) express an IFN ⁇ antagonist.
- the genetically engineered immune cells comprise the disrupted endogenous IFN ⁇ or IFN ⁇ R gene.
- the disrupted endogenous IFN ⁇ or IFN ⁇ R gene is produced by gene editing, for example, gene editing is mediated by a CRISPR/Cas gene editing system.
- the genetically engineered cells express the IFN ⁇ antagonist.
- the genetically engineered cells secretes the IFN ⁇ antagonist.
- the IFN ⁇ antagonist can be anti- IFN ⁇ antibody, a secreted IFN ⁇ receptor, or an anti-IFNyR antibody.
- the IFN ⁇ antagonist can be anti- IFN ⁇ antibody or anti- IFN ⁇ R antibody.
- the antibody is a single chain variable fragment (scFv).
- the IFN ⁇ antagonist is an anti- IFN ⁇ scFv.
- the anti- IFN ⁇ scFv comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 53, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 52.
- the anti- IFN ⁇ scFv comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 56, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 55.
- the anti- IFN ⁇ scFv comprises: a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 59, and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 58.
- the anti- IFN ⁇ scFv comprises the amino acid sequence of SEQ ID NO: 54.
- the anti-IFNy scFv comprises the amino acid sequence of SEQ ID NO: 57.
- the anti- IFN ⁇ scFv comprises the amino acid sequence of SEQ ID NO:60.
- the population of immune cells disclosed herein may express a chimeric antigen receptor (CAR), which may comprise (a) an extracellular antigen binding domain, (b) a co-stimulatory domain (e.g., a 4- IBB or CD28 co- stimulatory domain), (c) a cytoplasmic signaling domain, and optionally (d) a transmembrane and/or hinge domain.
- CAR chimeric antigen receptor
- the extracellular antigen binding domain may comprise a single chain variable fragment (scFv), which may binds a tumor associated antigen, e.g., those disclosed herein.
- the tumor associated antigen is CD19 and the extracellular antigen binding domain comprises a scFv that binds CD 19, for example, any of the anti-CD 19 scFv antibodies disclosed herein.
- the tumor associated antigen is B cell maturation antigen (BCMA) and the extracellular antigen binding domain comprises a scFv that binds BCMA, for example, any of the anti-BCMA scFv antibody disclosed herein.
- BCMA B cell maturation antigen
- the co-stimulatory domain used in the CAR disclosed herein may be from 4- IBB (CD137), 0X40, CD70, CD27, CD28, CD5, ICAM-1, LFA-1 (CDlla/CD18), ICOS (CD278), DAP10, and DAP12, or any combination thereof.
- the cytoplasmic signaling domain may comprise a CD3zeta (CD3 ⁇ ) signaling domain, an interleukin 2 receptor beta subunit (IL-2RP) cytoplasmic signaling domain, or a combination thereof.
- the transmembrane domain may be from a cell surface receptor, which can be the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154,
- a cell surface receptor which can be the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154,
- the CAR may further comprises a hinge or a spacer or a combination of both to connect the functional domains of (a)-(d).
- the CAR may comprise a hinge domain linked to the C- terminus of the extracellular antigen binding domain and to the N-terminus of the transmembrane domain.
- a hinge domain linked to the C- terminus of the extracellular antigen binding domain and to the N-terminus of the transmembrane domain. Examples include a hinge domain from CD28, CD8, or an IgG, which optionally is IgG1 or IgG4.
- the CAR may be any of the CARs disclosed herein that comprise an IL-2RP) cytoplasmic signaling domain.
- a CAR may further comprises a signal peptide located at the N-terminus. Examples include, but are not limited to, a signal peptide derived from albumin, CD8, a growth hormone, IL-2, an antibody light chain, or a Gaussia luciferase.
- the population of immune cells may further comprises a second plurality of immune cells that express an antibody specific to interleukin-6 (IL-6) or IL-6 receptor (IL-6R), and/or a third plurality of immune cells that express an IL-1 antagonist, such as those disclosed herein.
- the first plurality, the second plurality, and/or the third plurality of immune cells comprise common members.
- the population of immune cells comprise genetically engineered cells (e.g., at least 20%, at least 30%, at least 40%, at least 50% or above) having reduced IFN ⁇ signaling, expressing a CAR, expressing an IL-6 antagonist, and expressing an IL-1 antagonist.
- the population of immune cells comprise genetically engineered cells that exhibit two or more of the just- noted genetic modifications.
- a pharmaceutical composition comprising any of the immune cell populations disclosed herein comprising one or more of the genetic modifications as also disclosed herein, e.g., expressing a CAR, having reduced IFN ⁇ signaling, expressing an IL-6 antagonist, and/or expressing an IL-1 antagonist, and a pharmaceutically acceptable carrier.
- a method for reducing or eliminating undesired cells in a subject comprising administering to a subject in need thereof a therapeutically effective amount of the population of immune cells or the pharmaceutical composition as disclosed herein.
- the subject is a human cancer patient.
- the genetically engineered immune cell expresses a CAR that is specific to a tumor associated antigen.
- Examples include, but are not limited to, 5T4, CD2, CD5, CD3, CD7, CD19, CD20, CD22, CD30, CD33, CD38, CD70, CD123, CD133, CD171,CEA, CS1, Claudin 18.2, BCMA, BAFF- R, PSMA, PSCA, desmoglein (Dsg3), HER-2, FAP, FSHR, NKG2D, GD2, EGFRVIII, mesothelin, ROR1, MAGE, MUC1, MUC16, GPC3, Lewis Y, and VEGFRII.
- the cancer is a solid tumor cancer.
- examples include, but are not limited to, breast cancer, lung cancer, pancreatic cancer, liver cancer, glioblastoma (GBM), prostate cancer, ovarian cancer, mesothelioma, colon cancer, and stomach cancer.
- the cancer is a hematological cancer. Examples include, but are not limited to, leukemia, lymphoma, or multiple myeloma.
- leukemia includes chronic lymphocytic leukemia (CLL), acute lymphocytic leukemia (ALL), acute myeloid leukemia (AML), or chronic myelogenous leukemia (CML).
- Exemplary lymphoma includes mantle cell lymphoma, non-Hodgkin's lymphoma or Hodgkin's lymphoma.
- the genetically engineered immune cells express a CAR that binds CD19 (e.g., those disclosed herein).
- the subject is a human patient having lymphoblastic leukemia, acute lymphoblastic leukemia, chronic lymphoblastic leukemia, mantle cell lymphoma, large B-cell lymphoma, or non-Hodgkin's lymphoma.
- the genetically engineered immune cells e.g., T cells
- express a CAR that binds BCMA e.g. , those disclosed herein.
- the subject is a human patient having multiple myeloma, relapsed multiple myeloma, or refractory multiple myeloma.
- any of the methods disclosed herein may comprise, prior to the cell therapy, performing a lymphodepleting treatment to the subject to condition the subject for the cell therapy.
- the lymphodepleting treatment comprises administering to the subject one or more of fludarabine and cyclophosphamide.
- the human patient received a therapy against the cancer to reduce tumor burden prior to the cell therapy.
- exemplary prior therapy includes a chemotherapy, an immunotherapy, a radiotherapy, or a surgery.
- the subject may have an infectious disease, or an immune disorder.
- any of the genetically engineered immune cells as disclosed herein for use in treating any of the target diseases also disclosed herein e.g., cancer
- use of such genetically engineered immune cells for manufacturing a medicament for treatment of the target disease e.g., cancer
- immune cell populations as described herein for use in treating the target disease as also described herein are also described herein, and uses of such immune cell population in manufacturing a medicament for use in treatment of a target disease.
- FIGs. 1A-1E include diagrams showing anti-tumor efficiency achieved by CAR-T cells expressing an exemplary CAR constructs disclosed herein.
- FIG. 1A is a chart showing the numbers of white blood cells (WBC) and lymphocytes in a human patient at different time points as indicated after the T cell infusion.
- WBC white blood cells
- FIG. IB is a chart showing the chart showing body temperature (°C) of a human patient at different time points as indicated after T-cell infusion.
- FIG. 1C is a chart showing the levels of IFN ⁇ and IL-6 in the human patient at different time points as indicated after T-cell infusion.
- FIG. ID is a chart showing the levels of CRP (C reactive protein) in a human patient at different time points as indicated after T-cell infusion.
- FIG. IE is a chart showing the levels of Ferritin in a human patient at different time points as indicated after T-cell infusion.
- FIG. 2 is a chart summarizing the levels of IFN ⁇ in T-cells where the endogenous IFN- ⁇ was gene edited with different sgRNA candidates targeting FN ⁇ exon 1 and using the CRISPR system. The levels of FN ⁇ were determined by intracellular staining of the T-cells.
- FIG. 3 shows the frequencies of CAR+ T cells post infusion in treated multiple myeloma (MM) patients.
- Patient #1 (circle) was infused with anti-BCMA CAR-T cells that had the intracellular signaling domains of 41BB, IF-2RP receptor and CD3 ⁇ .
- Patient #2 (square) was infused with anti-BCMA CAR-T cells that had the intracellular signaling domains of 41BB and CD3 ⁇ without the IL-2RP receptor co- stimulatory signaling domains.
- FIG. 4 shows the changes of CD19 + cells and CAR + /CD3 + cells in the peripheral blood of three patients, Pt#l, Pt#2, and Pt#3 infused with anti-CD19 CAR-T cells with 41BB, IL-2RP and CD3 ⁇ signaling.
- FIG. 5 shows the peak frequencies of anti-CD 19 CAR-T cells in acute lymphocytic leukemia (ALL) and lymphoma patients and anti-BCMA CAR-T cells in multiple myeloma (MM) patient.
- ALL acute lymphocytic leukemia
- MM multiple myeloma
- FIG. 6A shows the efficiency of various anti-IFN ⁇ scFv antibodies on inhibiting IFN ⁇ signaling: 1, Amg-LH; 2, Fon-LH; 3, Ema-LH; 4, Amg-HL; 5, Fon-HL; and 6, Ema-HL (LH meaning the orientation of light chain variable region to heavy chain variable region and HL meaning orientation of heavy chain variable region to light chain variable region).
- Amg AMG 811 (U.S. Pat. Appl. No: US20130142809)
- Fon fontulizumab
- Ema emapalumab
- FIG. 6B shows the efficiency of different signal peptides on Amg derived scFv for inhibiting IFN ⁇ signaling.
- FIG. 7 shows the changes of IFN ⁇ in the peripheral blood of a patient suffering from acute lymphocytic leukemia (ALL) and was treated with anti-CD 19 CAR-T cells with 41BB- IL2Rb-CD3z signaling, CRISPR edited IFN ⁇ knockout (KO) and co-expressing IL6 and IL1 blockers.
- ALL acute lymphocytic leukemia
- KO CRISPR edited IFN ⁇ knockout
- FIG. 8A shows the changes of IFN ⁇ in the peripheral blood of a patient diagnosed with refractory and relapsed multiple myeloma (MM) and was treated with anti-BCMA CAR-T cells with 41BB-IL2Rb-CD3z signaling, CRISPR edited IFN ⁇ KO and co-expressing IL6 and IL1 blockers.
- FIG. 8B shows the changes of IgG levels in the peripheral blood of the same patient over time after treatment.
- FIG. 9 shows the changes of IFN ⁇ in peripheral blood of a patient diagnosed with refractory and relapsed lymphoma and was treated with anti-CD 19 CAR-T cells with 41BB- IL2Rb-CD3z signaling, and co-expressing IFN ⁇ blocking scFv derived from emapalumab and IL6 blocking scFv derived from sirukumab.
- FIG. 10A shows the changes of IFN ⁇ in peripheral blood of patient #1 diagnosed with refractory and relapsed MM and were treated with anti-BCMA CAR-T cells with 41BB- IL2Rb-CD3z signaling, and co-expressing IFNy blocking scFv derived from emapalumab and IL6 blocking scFv derived from sirukumab.
- FIG. 10A shows the changes of IFN ⁇ in peripheral blood of patient #1 diagnosed with refractory and relapsed MM and were treated with anti-BCMA CAR-T cells with 41BB- IL2Rb-CD3z signaling, and co-expressing IFNy blocking scFv derived from emapalumab and IL6 blocking scFv derived from sirukumab.
- FIG. 10A shows the changes of IFN ⁇ in peripheral blood of patient #1 diagnosed with refractory and relapsed MM and were treated with anti-BCMA CAR-T cells with 41BB
- 10B shows the changes of IFNy and the changes of IgG levels in the peripheral blood of patient #2 same patient with refractory and relapsed MM and were treated with anti- BCMA CAR-T cells with 41BB-IL2R ⁇ -CD3 ⁇ signaling, and co-expressing IFN ⁇ blocking scFv derived from emapalumab and IL6 blocking scFv derived from sirukumab.
- Adoptive cell transfer immunotherapy relies on immune cell activation and cytokine secretion to eliminate disease cells.
- CAR-T do not always expand well in patients.
- the present disclosure aims to overcome this limitation, in part, via the development of immune cells having reduced inflammatory properties.
- the present disclosure is based, at least in part, on the development of CARs that include an IL2RP signaling domain. This CAR construct is expected to achieve superior therapeutic effects via inducing more effective proliferation of T cells upon activation by tumor target cells.
- CARs comprising an IL2R ⁇ signaling domain
- modified immune cells expressing such CARs, and therapeutic applications thereof (including CAR-T therapy).
- the modified immune cells expressing (1) the CAR comprising an IL2R ⁇ signaling domain, (2) the antagonistic antibody specific to IL-6 or IL-6R, and/or (3) the IL-1 antagonist or antagonistic antibody specific to IL-1 ⁇ c or IL-1 ⁇ significantly reduced the cytokine release syndrome (CRS) in patients treated with these cells. No additional anti-IL-6 medication was needed to prevent or suppress CRS in these patients.
- the presence of the IL2R ⁇ signaling domain in the CAR promoted sustain persistence of the CAR-T cells in vivo in the treated patients, compared to CAR-T cells having CARs that did not have the IL2R ⁇ signaling domain.
- IEN ⁇ is one of the most essential cytokines involved in T cell cytotoxicity and IFN ⁇ secretion is therefore a primary parameter reflecting the potency of a CAR-T therapy.
- IFN ⁇ is one of the most elevated cytokines during CRS. Due to IFN ⁇ 's important role in CART killing tumor target cells, blocking IFN ⁇ signaling would have been expected to significantly impair CAR-T therapeutic efficacy.
- CAR-T cells having reduced production of IFN ⁇ e.g., by knocking out the endogenous IFN ⁇ gene or expressing an anti-IFN ⁇ scFv (e.g., a secreted scFv) could achieve robust clinical responses, despite the low level of IFN ⁇ observed in patients.
- an anti-IFN ⁇ scFv e.g., a secreted scFv
- genetically engineered immune cells that have (1) a disrupted genomic IFN ⁇ gene or IFNyR gene so that the expression of the endogenous IFN ⁇ or IFN ⁇ R is reduced; (2) expresses an IFN ⁇ antagonist, or a combination of both.
- the cell may further comprise a CAR that specifically targets and binds a tumor associated antigen.
- the genetically engineered immune cell described herein may also inhibit IL-6 or IL-1 or both IL-6 and IL-1 signaling in vivo via the expression of IL-6 and IL-1 antagonists.
- endogenous refers to naturally originating from within an organism.
- the term “antagonist” encompass all the identified terms, titles, and functional states and characteristics whereby the target protein itself, a biological activity of the target protein, or the consequences of the biological activity, are substantially nullified, decreased, or neutralized in any meaningful degree, e.g., by at least 20%, 50%, 70%, 85%, 90%, or above.
- a chimeric antigen receptor (CAR) disclosed herein is an artificial (non-naturally occurring) receptor having a binding specificity to a target antigen of interest (e.g. , a tumor cell antigen) and capable of triggering immune responses in immune cells expression such upon binding to the target antigen.
- a CAR often comprises an extracellular antigen binding domain fused to at least an intracellular signaling domain.
- the CAR disclosed herein comprise an IL2R ⁇ signaling domain, which may be in combination with other intracellular signaling domains such as one or more co-stimulatory signaling domain and/or a cytoplasmic signaling domain comprising an immunoreceptor tyrosine -based activation motif (IT AM), such as a
- CD3 ⁇ signaling domain (also referred to as CD3z).
- the CAR may also have a transmembrane domain, a hinge domain, and/or a STAT3 binding site.
- the transmembrane domain is located between extracellular antigen binding domain and the intracellular signaling domain.
- the hinge domain may be located between the extracellular antigen binding domain and the transmembrane domain, between the transmembrane domain and the intracellular signaling domain, and also within the intracellular signaling domain when the intracellular signaling domain comprises a combination of one or more co- stimulatory signaling domain and/or a cytoplasmic signaling domain.
- a CAR having an intracellular domain comprising a IL2R ⁇ signaling domain, an ITAM-containing cytoplasmic signaling domain, such as a CD3 ⁇ signaling domain, and an additional co-stimulatory domain such as that from
- the presence of the IL2R ⁇ signaling domain significantly improved persistence in vivo of the CAR-T cells expressing the CAR.
- the IL2R ⁇ signaling domain also induced sustainable B cell aplasia in vivo in treated patients.
- IL2RP is the b chain of the interleukin-2 receptor (IL-2R).
- An IL-2R ⁇ signaling domain refers to the fragment in an IL2R ⁇ polypeptide (e.g., of a suitable species such as human) that is capable of triggering the signaling pathway mediated by the IL-2/IL-2R interaction.
- IL- 2polypep tides and the signaling domains therein are known in the art.
- an exemplary human IL2R ⁇ polypeptide is provided in GENBANK accession number NP_000869.1 (the contents of which are incorporated herein by reference).
- IL2R ⁇ polypeptides from other species can be obtained from publically available gene databases such as GENBANK.
- the IL2R ⁇ signaling domain used in the CAR constructs disclosed herein comprise an amino acid sequence at least 80% (e.g., at least 85%, 90%, 95%, 98% or above) identical to the amino acid sequence of
- Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res. 25(17):3389-3402, 1997.
- the default parameters of the respective programs e.g., XBLAST and NBLAST.
- the IL2RP signaling domain used in the CAR constructs may contain one or more mutations (e.g., amino acid residue substitutions) relative to a wild- type counterpart, for example, SEQ. ID. NO: 2.
- the IL2R ⁇ signaling domain may contain up to 15 (e.g., up to 12, 10, 8, 6, 5, 4, 3, 2, or 1) amino acid residue substitutions relative to the wild-type counterpart (e.g., SEQ. ID. NO: 2).
- the one or more amino acid residue substitutions are conservative amino acid residue substitutions.
- a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made.
- Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g. Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989, or Current Protocols in Molecular Biology, F.M. Ausubel, et al, eds., John Wiley & Sons, Inc., New York.
- Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) A -> Q,
- the IL2R ⁇ signaling domain used in the CAR constructs disclosed herein comprises (e.g., consisting of) the amino acid sequence of SEQ ID NO: 2.
- the extracellular antigen binding domain used in the CAR constructs disclosed herein is specific to an antigen of interest (e.g., a pathologic antigen such as a cancer antigen).
- an antigen of interest e.g., a pathologic antigen such as a cancer antigen
- it can be a single-chain antibody fragment (scFv), which typically comprises a heavy chain variable domain (VH) and a light chain variable domain (VL) connected by a peptide linker.
- VH heavy chain variable domain
- VL light chain variable domain
- Peptide linkers used in scFv constructs are well known in the art.
- the extracellular antigen binding domain used herein targets a tumor antigen, such as CD19 or BCMA.
- the extracellular antigen binding domain binds CD 19.
- a scFv may comprise the amino acid sequence of SEQ. ID. NO: 6.
- the anti-CD19 scFv may be a variant derived from SEQ. ID. NO: 6, for example, having the same heavy chain and light chain complementary determining regions (CDRs) as those in SEQ. ID. NO: 6.
- the variant may have the same VH and VL as in SEQ. ID. NO: 6 and a different peptide linker.
- the variant may have a different V H -> V L orientation as in SEQ. ID. NO: 6.
- the extracellular antigen binding domain binds B-cell maturation antigen (BCMA).
- BCMA B-cell maturation antigen
- an anti-BCMA scFv may comprise the amino acid sequence of SEQ. ID. NO: 7.
- the anti-BCMA scFv may be a variant derived from SEQ.
- the variant may have the same VH and VL as in SEQ. ID. NO: 7 and a different peptide linker. In other instances, the variant may have a different V H -> V L orientation as in SEQ. ID. NO: 7.
- Two antibodies having the same CDR or same V H /V L means that the two antibodies have the same amino acid sequence of that CDR as determined by the same method.
- any of the CAR constructs disclosed herein may further comprise one or more co- stimulatory domains, a cytoplasmic signaling domain comprising an IT AM such as CD3 ⁇ signaling domain, or a combination thereof.
- the CAR may further comprise a STAT3 binding site, which may be located C-terminal to the CD3 ⁇ signaling domain.
- the CAR disclosed herein may comprise a co- stimulatory domain from co-stimulatory receptor 4-1BB (aka CD137), for example, from human 4-1BB.
- co-stimulatory receptor 4-1BB aka CD137
- Non- limiting sources for co-stimulatory domains include 0X40, CD70, CD27, CD28, CD5, ICAM- 1, LFA-1 (CD 11 a/CD 18), ICOS (CD278), DAP10, and DAP12.
- the CAR may have a co- stimulatory domain derived from 4- IBB, 0X40, CD70, CD27, CD28, CD5, ICAM-1, LFA- 1 (CD11a/CD18), ICOS (CD278), DAP10, and DAP12 or any combination thereof.
- the 4-1BB co-stimulatory signaling domain comprises (e.g., consists of) the amino acid sequence: KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ. ID. NO: 1).
- the CAR may comprise a CD3 ⁇ signaling domain, which may comprise (e.g., consist of) the amino acid sequence: RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQE GLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ. ID. NO: 3).
- the CAR construct disclosed herein contains a STAT3 binding motif linked to the CD3 ⁇ signaling domain (to its C-terminal).
- the STAT3 binding motif may have the amino acid sequence YX 1 X 2 Q, where X 1 and X 2 are each independently an amino acid.
- the YX 1 X 2 Q motif may be YRHQ (SEQ. ID. NO: 4).
- the fragment in the CAR construct containing the CD3 ⁇ signaling domain and the STAT3 binding motif may comprise (e.g., consist of) the amino acid sequence: RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQE GLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAYRHQALPPR (SEQ. ID. NO: 5).
- the CAR construct disclosed herein may further comprise a transmembrane domain, a hinge domain, or both, which may be located between the extracellular antigen binding domain and the intracellular signaling domains. Any transmembrane domains and/or hinge domains commonly used in CAR constructs can be used here.
- the transmembrane domain may be obtained from a suitable cell-surface receptor, such as the transmembrane domain of a cell surface receptor of the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, CD271, TNFRSF19 and Killer Cell Immunoglobulin-Like Receptor (KIR).
- the hinge domain may be of CD28, CD8, or an IgG, such as IgG1 or IgG4.
- the CAR constructs disclosed herein may comprise an extracellular antigen binding domain, a 4- IBB co- stimulatory domain, an IL-2R ⁇ cytoplasmic signaling domain, and a CD3 ⁇ signaling domain.
- the foregoing domains may be arranged, respectively, from the N-terminus to the C-terminus of the CAR.
- the CAR may further comprise a transmembrane domain, which may be located C-terminal to the extracellular antigen binding domain and N-terminal to the 4- 1BB co-stimulatory domain.
- the CAR may also comprise a hinge domain, which may be linked to the C-terminus of the extracellular antigen binding domain and the N-terminus of the transmembrane domain.
- the CAR may comprise a signal peptide at the N-terminus of the CAR.
- CAR constructs are disclosed below.
- Contemplated CAR constructs can be made using any methods known in the art, e.g., molecular cloning methods.
- Anti-BCMA scFv Anti-BCMA scFv
- IYIWAPLAGTCGVLLLSLVITLYC (SEQ. ID. NO: 11) CD8 hinge domain and CD8 transmembrane:
- IL-2R ⁇ domain (truncated form of IL-2R ⁇ cytoplasmic domain: NCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSPGGLAPEISP LEVLERDKVTQLLPLNTDAYLSLQELQGQDPTHLV (SEQ. ID. NO: 2)
- CD8 signal peptide
- GGGGSEVKLQES GPGLV APSQSLS VTCTVSGVSLPD Y GV S WIRQPPRKGLEWLGVIW
- IGMKGERRRGKGHDGLYQGLSTATKDTYDAYRHQALPPR SEQ. ID. NO: 12
- the present disclosure provides genetically modified immune cells expressing any of the CAR constructs disclosed herein, optionally in combination with other genetic edits.
- modified immune cells comprise the CAR construct, which is specific to an antigen of interest (e.g., a cancer antigen), thereby eliminating the target disease cells via, e.g., the effector activity of the immune cells.
- an antigen of interest e.g., a cancer antigen
- the present disclosure provides genetically modified immune cells expressing an antigen specific TCR.
- the TCR is specific to an antigen of interest (e.g., a cancer antigen), thereby eliminating the target disease cells via, e.g. , the effector activity of the immune cells.
- the modified immune cells disclosed herein may also comprise one or more IL-6 antagonistic antibodies disclosed herein.
- the modified immune cells may further comprise one or more IL-1 antagonists, e.g., IL-1RA or others known in the art or disclosed herein.
- the modified immune cells may further comprise one or more IFN ⁇ antagonists, e.g., an antagonistic IFN ⁇ antibody or others known in the art or disclosed herein.
- CARs, TCRs, IL-6 antagonistic antibodies, IFN ⁇ antagonists, or IL-1 antagonists may be knock-in modifications in the modified cells.
- the modified immune cells may further comprise one or more knock-out modifications of endogenous genes (e.g., GM-CSF, TCR, IFN ⁇ , or B2M). Preferably, the knock-out of the endogenous IFN ⁇ gene.
- IL-6R includes both membrane bound and soluble forms of IL-6R (sIL-6R). When bound to IL-6, soluble IL-6R (sIL-6R) acts as an agonist and can also promote gp130 dimerization and signaling.
- Trans-signaling can occur whereby sIL-6R secretion by a particular cell type induces cells that only express gp130 to respond to IL-6 (see, e.g., Tagaei al., Annu Rev Immunol., 15:797-819, 1997; and Rose-John et al, Biochem J., 300 (Pt 2):281-90, 1994).
- sIL-6R comprises the extracellular domain of human IL-6R (see e.g., Peters et al. , J Exp Med. , 183(4): 1399-406, 1996).
- the modified immune cells disclosed herein express an IL-6 antagonist, which may be an antibody that binds to IL-6 or to an IL-6 receptor (IL-6R).
- IL-6 antagonist which may be an antibody that binds to IL-6 or to an IL-6 receptor (IL-6R).
- IL-6R IL-6 receptor
- Such antibodies can interfere with binding of IL-6/IL-6R on immune cells, thereby suppressing cell signaling mediated by IL-6.
- a typical antibody molecule comprises a heavy chain variable region (VH) and a light chain variable region (VL), which are usually involved in antigen binding.
- VH and VL regions can be further subdivided into regions of hypervariability, also known as “complementarity determining regions” (“CDR”), interspersed with regions that are more conserved, which are known as “framework regions” (“FR”).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1,, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the extent of the framework region and CDRs can be precisely identified using methodology known in the art, for example, by the Rabat definition, the Chothia definition, the AbM definition, and/or the contact definition, all of which are well known in the art. See, e.g., Rabat, E.A., et al. (1991)
- An antibody (interchangeably used in plural form) as used herein is an immunoglobulin molecule capable of specific binding to a target protein, e.g., IL-6 or IL-6R, through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
- a target protein e.g., IL-6 or IL-6R
- antibody encompasses not only intact (e.g., full-length) antibodies and heavy chain antibodies (e.g., an Alpaca heavy chain IgG antibody), but also antigen-binding fragments thereof (such as Fab, Fab', F(ab')2, Fv), single chain (scFv), single-domain antibody (sdAb; VHH), also known as a nanobody, mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies, linear antibodies, single chain antibodies, multispecific antibodies (e.g., bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies.
- immunoglobulin molecule that comprises an antigen recognition site of the required specificity, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies.
- An antibody includes an antibody of any class, such as IgD, IgE, IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
- immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgGl, IgG2, IgG3,
- the heavy-chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
- the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
- the antibodies described herein that “bind” a target protein or a receptor thereof may specifically bind to the target protein or receptor.
- An antibody that “specifically binds” (used interchangeably herein) to a target or an epitope is a term well understood in the art, and methods to determine such specific binding are also well known in the art.
- a molecule is said to exhibit “specific binding” if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular target antigen than it does with alternative targets.
- An antibody “specifically binds” to a target cytokine if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances.
- an antibody that specifically (or preferentially) binds to an IL-6 or an IL-6R epitope is an antibody that binds this IL-6 epitope or IL-6R epitope with greater affinity, avidity, more readily, and/or with greater duration than it binds to other IL-6 epitopes, non-IL-6 epitopes, other IL-6R epitopes or non-IL-6R epitopes. It is also understood by reading this definition that, for example, an antibody that specifically binds to a first target antigen may or may not specifically or preferentially bind to a second target antigen. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding. Generally, but not necessarily, reference to binding means preferential binding.
- an antagonistic antibody of a target protein as described herein has a suitable binding affinity for the target protein (e.g., human IL-6 or human IL-6R) or antigenic epitopes thereof.
- binding affinity refers to the apparent association constant or KA.
- the KA is the reciprocal of the dissociation constant (KD).
- the antagonistic antibody described herein may have a binding affinity (KD) of at least 10 -5 , 10 -6 , 10 -7 , 10 -8 , 10- 9 , 10 -10 M, or lower for the target antigen or antigenic epitope.
- An increased binding affinity corresponds to a decreased KD.
- Higher affinity binding of an antibody for a first antigen relative to a second antigen can be indicated by a higher KA (or a smaller numerical value KD) for binding the first antigen than the KA (or numerical value KD) for binding the second antigen.
- the antibody has specificity for the first antigen (e.g. , a first protein in a first conformation or mimic thereof) relative to the second antigen (e.g., the same first protein in a second conformation or mimic thereof; or a second protein).
- the antagonistic antibodies described herein have a higher binding affinity (a higher KA or smaller KD) to the target protein in mature form as compared to the binding affinity to the target protein in precursor form or another protein, e.g., an inflammatory protein in the same family as the target protein.
- Differences in binding affinity can be at least 1.5, 2, 3, 4, 5, 10, 15, 20, 37.5, 50, 70, 80, 91, 100, 500, 1000, 10,000 or 10 5 fold.
- Binding affinity (or binding specificity) can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance, or spectroscopy (e.g., using a fluorescence assay).
- Exemplary conditions for evaluating binding affinity are in HBS-P buffer (10 mM HEPES pH7.4, 150 mM NaCl,
- [Bound] [Free]/(Kd+[Free]) It is not always necessary to make an exact determination of KA, though, since sometimes it is sufficient to obtain a quantitative measurement of affinity, e.g., determined using a method such as ELISA or FACS analysis, is proportional to KA, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g. , by activity in a functional assay, e.g., an in vitro or in vivo assay.
- a functional assay e.g., an in vitro or in vivo assay.
- the IL-6 antagonistic antibody as described herein can bind and inhibit the IL-6 signaling by at least 50% (e.g., 60%, 70%, 80%, 90%, 95% or greater).
- the inhibitory activity of an IL-6 antagonistic antibody described herein can be determined by routine methods known in the art.
- the antibodies described herein can be murine, rat, human, or any other origin (including chimeric or humanized antibodies). Such antibodies are non-naturally occurring, e.g., would not be produced in an animal without human act (e.g., immunizing such an animal with a desired antigen or fragment thereof).
- any of the antibodies described herein can be either monoclonal or polyclonal.
- a “monoclonal antibody” refers to a homogenous antibody population and a “polyclonal antibody” refers to a heterogeneous antibody population. These two terms do not limit the source of an antibody or the manner in which it is made.
- humanized antibodies refer to forms of non-human (e.g., murine) antibodies that are specific chimeric immunoglobulins, immunoglobulin chains, or antigen-binding fragments thereof that contain minimal sequence derived from non-human immunoglobulin.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity.
- CDR complementary determining region
- Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- the humanized antibody may comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences, but are included to further refine and optimize antibody performance.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- the humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin.
- Antibodies may have Fc regions modified as described in WO 99/58572.
- Other forms of humanized antibodies have one or more CDRs (one, two, three, four, five, and/or six), which are altered with respect to the original antibody, which are also termed one or more CDRs “derived from” one or more CDRs from the original antibody.
- Humanized antibodies may also involve affinity maturation.
- VH heavy chain variable domains
- VL light chain variable domains
- Antibody 1 (binding to IL-6R):
- VTVSS (SEQ. ID. NO: 14)
- Antibody 2 (binding to IL-6):
- GTTVTVSS (SEQ. ID. NO: 16)
- Antibody 3 ( binding to IL-6):
- TSVTVSS (SEQ. ID. NO: 18)
- Antibody 4 ( binding to IL-6R):
- VTVSS (SEQ. ID. NO: 20)
- DIOMTOSPSSLSASVGDRVTITCRASODISSYLNWYOOKPGKAPKLLIYYTSRLHSGV PSRFSGSGSGTDFTFTISSLOPEDIATYYCOOGNTLPYTFGOGTKVEIK SEQ. ID.
- Antibody 5 ( binding to IL-6):
- GQGTLVTVSS (SEQ. ID. NO: 24)
- the IL-6 antagonistic antibodies described herein bind to the same epitope in an IL-6 antigen (e.g., human IL-6) or in an IL-6R (e.g., human IL-6R) as one of the reference antibodies provided herein (e.g., Antibody 1 or Antibody 2) or compete against the reference antibody from binding to the IL-6 or IL-6R antigen.
- Reference antibodies provided herein include Antibodies 1-6, the structural features and binding activity of each of which are provided herein.
- An antibody that binds the same epitope as a reference antibody described herein may bind to exactly the same epitope or a substantially overlapping epitope (e.g., containing less than 3 non-overlapping amino acid residue, less than 2 non-overlapping amino acid residues, or only 1 non-overlapping amino acid residue) as the reference antibody.
- Whether two antibodies compete against each other from binding to the cognate antigen can be determined by a competition assay, which is well known in the art.
- Such antibodies can be identified as known to those skilled in the art, e.g.,, those having substantially similar structural features (e.g., complementary determining regions), and/or those identified by assays known in the art.
- competition assays can be performed using one of the reference antibodies to determine whether a candidate antibody binds to the same epitope as the reference antibody or competes against its binding to the IL-6 or IL-6R antigen.
- the IL-6 antagonistic antibodies disclosed herein may comprise the same heavy chain CDRs and/or the same light chain CDRs as a reference antibody as disclosed herein (e.g., Antibody 1 or Antibody 2).
- the heavy chain and/or light chain CDRs are the regions/residues that are responsible for antigen binding; such regions/residues can be identified from amino acid sequences of the heavy chain/light chain sequences of the reference antibody (shown above) by methods known in the art. See, e.g., antibody rules described at the Bioinformatics and Computational Biology group website at University College London; Almagro, J. Mol. Recognit. 17:132-143 (2004); Chothia et al., J. Mol. Biol.
- a CDR may refer to the CDR defined by any method known in the art. Two antibodies having the same CDR means that the two antibodies have the same amino acid sequence of that CDR as determined by the same method.
- a functional variant may contain one or more amino acid residue variations in the VH and/or VL, or in one or more of the HC CDRs and/or one or more of the LC CDRs as relative to the reference antibody, while retaining substantially similar binding and biological activities (e.g., substantially similar binding affinity, binding specificity, inhibitory activity, or a combination thereof) as the reference antibody.
- the IL-6 antagonistic antibody disclosed herein comprises a HC CDR1, a HC CDR2, and a HC CDR3, which collectively contains no more than 10 amino acid variations (e.g., no more than 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid variation) as compared with the HC CDR1, HC CDR2, and HC CDR3 of a reference antibody such as Antibody 1 or Antibody 2. “Collectively” means that the total number of amino acid variations in all of the three HC CDRs is within the defined range.
- the anti-IL-6 or anti- IL-6R antibody may comprise a LC CDR1, a LC CDR2, and a LC CDR3, which collectively contains no more than 10 amino acid variations (e.g., no more than 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid variation) as compared with the LC CDR1, LC CDR2, and LC CDR3 of the reference antibody.
- the IL-6 antagonistic antibody disclosed herein may comprise a HC CDR1, a HC CDR2, and a HC CDR3, at least one of which contains no more than 5 amino acid variations (e.g., no more than 4, 3, 2, or 1 amino acid variation) as the counterpart HC CDR of a reference antibody such as Antibody 1 or Antibody 2.
- the antibody comprises a HC CDR3, which contains no more than 5 amino acid variations (e.g., no more than 4, 3, 2, or 1 amino acid variation) as the HC CDR3 of a reference antibody such as Antibody 1 or Antibody 2.
- an IL-6 antagonistic antibody may comprise a LC CDR1, a LC CDR2, and a LC CDR3, at least one of which contains no more than 5 amino acid variations (e.g., no more than 4, 3, 2, or 1 amino acid variation) as the counterpart LC CDR of the reference antibody.
- the antibody comprises a LC CDR3, which contains no more than 5 amino acid variations (e.g., no more than 4, 3, 2, or 1 amino acid variation) as the LC CDR3 of the reference antibody.
- amino acid residue variations can be conservative amino acid residue substitutions. See disclosures herein.
- the IL-6 antagonistic antibody disclosed herein may comprise heavy chain CDRs that collectively are at least 80% (e.g., 85%, 90%, 95%, or 98%) identical to the heavy chain CDRs of a reference antibody such as Antibody 1 or Antibody 2.
- the antibody may comprise light chain CDRs that collectively are at least 80% (e.g., 85%, 90%, 95%, or 98%) identical to the light chain CDRs of the reference antibody.
- the IL-6 antagonistic antibody may comprise a heavy chain variable region that is at least 80% (e.g., 85%, 90%, 95%, or 98%) identical to the heavy chain variable region of a reference antibody such as Antibody 1 or Antibody 2 and/or a light chain variable region that is at least 80% (e.g., 85%, 90%, 95%, or 98%) identical to the light chain variable region of the reference antibody.
- a germlined variant contains one or more mutations in the framework regions as relative to its parent antibody towards the corresponding germline sequence.
- the heavy or light chain variable region sequence of the parent antibody or a portion thereof e.g., a framework sequence
- an antibody germline sequence database e.g., the antibody rules described at the Bioinformatics and Computational Biology group website at University College London; thevbase2 website, or the IMGT®, the international ImMunoGeneTics information system® website
- One or more amino acid substitutions can then be introduced into the parent antibody based on the germline sequence to produce a germlined variant.
- the antagonistic antibodies described herein are human antibodies or humanized antibodies.
- the antagonistic antibodies are scFv. Exemplary scFv antibodies are provided below.
- Interleukin- 1 is a cytokine known in the art and includes two isoforms, IL-1 a and IL- 1b. IL-1 plays important roles in up- and down-regulation of acute inflammation, as well as other biological pathways.
- the IL-1 antagonist expressed in the modified immune cells disclosed herein can be an interleukin- 1 receptor antagonist (IL-1RA).
- IL-1RA is a naturally- occurring polypeptide, which can be secreted by various types of cells, such as immune cells, epithelial cells, and adipocytes. It binds to cell surface IL-1R receptor and thereby preventing the cell signaling triggered by IL-1/IL-1R interaction.
- a human IL-1RA is encoded by the IL1RN gene. Below is an exemplary amino acid sequence of a human IL-1RA:
- the N-terminal fragment in boldface and italicized refers to the signal peptide in the native IL-1RA.
- the IL-1RA for use in the instant application may comprise the amino acid sequence corresponding to the mature polypeptide of the human IL-1RA noted above (excluding the signal peptide)
- this signal peptide can be replaced with a different signal sequence, for example, MATGSRTSLLLAFGLLCLPWLQEGSA (SEQ. ID. NO: 29).
- the resultant IL- 1RA would have the whole sequence:
- IL-1 antagonists include, but are not limited to, anti-IL-lcc or anti-IL-Ib antibodies (see Fredericks ZL, et al., 2004, Protein Eng Des Sel. 17(1):95-106); U.S. Patent No. 7,531,166 and 8,383,778, the contents are incorporated herein by reference in their entireties.
- the present disclosure provides genetically modified immune cells that have reduced production of IFNy.
- Such genetically modified immune cells would produce no or less IFNy relative to their wild-type counterpart cells that are not modified.
- the amount of IFNy in culture or in vivo in a patient may be determined by any method know in the art, e.g. , by an ELISA assay of the cell culture media or the blood IFN ⁇ level of a patient treated with such modified cells.
- By less IFN ⁇ means at least 10% lower compared to their wild-type counterpart cells that are not modified to reduce IFN ⁇ expression.
- less IFN ⁇ means at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 95% lower compared to their wild-type counterpart cells that are not modified to reduce IFN ⁇ expression.
- the genetically modified immune cells that have reduced expression of IFN ⁇ may have the endogenous IFN ⁇ gene knocked out, e.g., by genetic editing.
- the genetically modified immune cells having reduced IFN ⁇ expression may comprise a CAR comprising an extracellular antigen binding domain; a co-stimulatory domain; a cytoplasmic signaling domain, or a combination thereof; and optionally a transmembrane domain.
- the genetically modified immune cells may further comprise an IL-6 antagonist.
- the CAR of genetically modified immune cells that have reduced production of IFN ⁇ may comprise an IL-2RP cytoplasmic signaling domain. Additionally or alternatively, the genetically modified immune cells that have reduced production of IFN ⁇ may comprise an IL- 1 antagonist.
- the present disclosure provides genetically modified immune cells that have reduced expression of IFN ⁇ R.
- the IFN ⁇ R Preferably, the IFN ⁇ R1.
- Such genetically modified immune cells would expression no, little or less IFNyR as relative to their wild-type counterpart.
- the amount of IFN ⁇ R may be determined by any method know in the art, e.g. , by an ELISA assay. By less IFN ⁇ R means at least 10% lower compared to their wild-type counterpart cells that are not modified to reduce IFN ⁇ R expression.
- the genetically modified immune cells that have reduced expression of IFN ⁇ R may have the endogenous IFN ⁇ R gene knocked out, e.g., by genetic editing.
- the genetically modified immune cells having reduced IFN ⁇ R expression may comprise a CAR comprising an extracellular antigen binding domain; a co-stimulatory domain; a cytoplasmic signaling domain, or a combination thereof; and optionally a transmembrane domain.
- the genetically modified immune cells may further comprise an IL-6 antagonist.
- the CAR may comprise an IL-2RP cytoplasmic signaling domain.
- the genetically modified immune cells that can bring about interferon gamma blockade in vivo.
- the interferon gamma blockade in vivo is effectuated via genomic gene editing of the IFNy or IFN ⁇ R gene or by expressing and secreting an IFNy antagonist.
- the genetically modified immune cells can bring about interferon gamma blockade in vivo may comprise a CAR comprising an extracellular antigen binding domain; a co-stimulatory domain; a cytoplasmic signaling domain, or a combination thereof; and optionally a transmembrane domain.
- the genetically modified immune cells may further comprise an IL-6 antagonist.
- the CAR may comprise an IL-2RP cytoplasmic signaling domain.
- Genomic gene editing of the IFN ⁇ or IFN ⁇ R aims to knockout either the IFN ⁇ or the IFN ⁇ R genes or both of them. By doing so, it is envisioned that any CRS initiated by IFN ⁇ signaling in vivo would be limited when there is less IFN ⁇ ligand or IFN ⁇ R available.
- the genetically modified immune cells comprising a disrupted endogenous IFN ⁇ or the IFN ⁇ R genes or both of them.
- the genetically modified immune cells comprising a disrupted endogenous IFN ⁇ or the IFN ⁇ R genes or both of them may comprise a CAR comprising an extracellular antigen binding domain; a co-stimulatory domain; a cytoplasmic signaling domain, or a combination thereof; and optionally a transmembrane domain.
- the genetically modified immune cells may further comprise an IL-6 antagonist.
- the genetically modified immune cells may further comprise an IFN ⁇ antagonist.
- the CAR in these modified cells may comprise an IL-2RP cytoplasmic signaling domain.
- Any methods known in the art for down-regulating the expression of an endogenous gene in a host cell can be used to reduce the expression level of IFN ⁇ or IFN ⁇ R as described herein.
- the genomic information for the human IFNy and IFNyRl are found in GENB ANK Gene ID: 3458 and Gene ID: 3459 respectively.
- Any gene editing method may involve use of an endonuclease that is capable of cleaving the target region in the endogenous allele.
- Non- homologous end joining in the absence of a template nucleic acid may repair double-strand breaks in the genome and introduce mutations (e.g., insertions, deletions and/or frameshifts) into a target site.
- a knocking-out event can be coupled with a knocking-in event - an exogenous nucleic acid coding for a desired molecule (e.g., the IL-1RA described herein) can be inserted into a genomic locus of IFN ⁇ or IFN ⁇ R gene via gene editing, thereby disrupting the gene expression as a result of the insertion.
- a desired molecule e.g., the IL-1RA described herein
- any of the knock-out modification may be achieved using antisense oligonucleotides (e.g., interfering RNAs such as shRNA or siRNA) or ribozymes via methods known in the art.
- An antisense oligonucleotide specific to a target cytokine/protein refers to an oligonucleotide that is complementary or partially complementary to a target region of an endogenous gene of the cytokine or an mRNA encoding such.
- antisense oligonucleotides can be delivered into target cells via conventional methods.
- expression vectors such as lentiviral vectors or equivalent thereof can be used to express such an antisense oligonucleotides.
- knocking-out the endogenous IFN ⁇ or IFN ⁇ R gene can be achieved using the gene editing methods such as the CRISPR technology, for example, using a CRISPR/Cas9 system.
- the single guide RNAs (sgRNA) that target the protospacer adjacent motif (PAM) sequence in the human IFN ⁇ gene may be used with the CRISPR/Cas9 system.
- the sgRNAs molecules contains both the custom-designed short crRNA sequence fused to the scaffold tracrRNA sequence.
- the DNA sequences used for in vitro transcription of IFN ⁇ sgRNA are provided herein.
- the bold sequences are the targeted PAM sequences in the first exon of the human IFN ⁇ gene.
- sgRNA 4 GCATCGTTTTGGGTTCTCTGTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCT AGTCCGTTATCAACTTGAAAAAGTGGCACCGAGTCGGTGCTTTT (SEQ. ID. NO: 34) sgRNA 5
- IFNyR 1 Human Gene Knockout Kit CRISPR Cat# KN202761 from OriGENE may be used. Methods of using such kits are known in the art.
- the cell comprises the IFN ⁇ antagonist.
- a genetically modified immune cell comprising an IFN ⁇ antagonist may comprise a CAR comprising an extracellular antigen binding domain; a co- stimulatory domain; a cytoplasmic signaling domain, or a combination thereof; and optionally a transmembrane domain.
- the genetically modified immune cells may further comprise an IL-6 antagonist.
- the genetically modified immune cells may have a disrupted endogenous IFN ⁇ or the IFN ⁇ R genes or both of them.
- the CAR in these modified cells may comprise an IL-2R ⁇ cytoplasmic signaling domain.
- the IFN ⁇ antagonist blocks the formation of the ternary IFN ⁇ /I IFN ⁇ R 1 / IFN ⁇ R2.
- IFN ⁇ R1 is required for ligand binding and signaling.
- the IFNy antagonist can be an antagonistic anti- IFN ⁇ antibody or antigen-binding fragment thereof; a secreted IFN ⁇ receptor or a ligand binding fragment of the receptor; and an antagonistic anti- IFN ⁇ R an ⁇ tibody or antigen-binding fragment thereof, whereby the IFN ⁇ antagonist blocks IFN ⁇ / IFN ⁇ R interaction and downstream signaling.
- the IFN ⁇ antagonist is secreted.
- the antagonistic anti- IFN ⁇ antibody or antigen-binding fragment thereof binds the IFN ⁇ ligand that is released in vivo and thus the IFN ⁇ ligand is not available to interact with its native receptor, IFN ⁇ R1, expressed on cell surfaces.
- the secreted IFN ⁇ receptor or a ligand-binding fragment functions as decoy receptor and captures the IFN ⁇ ligand that is released in vivo and thus the IFN ⁇ ligand is also not available to interact with its native receptor, IFN ⁇ R1 that is expressed on cell surfaces.
- the secreted IFN ⁇ R or a ligand-binding fragment is the extracellular portion of a native human IFN ⁇ receptor.
- the antagonistic anti- IFN ⁇ R antibody or antigen-binding fragment thereof binds to the IFNy r IeFcNep ⁇ tor expressed on cells and prevents the interaction of the IFN ⁇ ligand with the receptor and the consequential ligand-induced assembly of the complete receptor complex that contains two IFN ⁇ R1 and two IFN ⁇ R2 subunits.
- the complete receptor complex is necessary for the IFN ⁇ signaling pathway.
- the antagonistic anti- IFN ⁇ antibody or antigen-binding fragment thereof is a scFv of the antibody such as an anti- IFN ⁇ scFv.
- ScFv consist of a variable heavy (VH) and a variable light (VL) antibody chains linked with a peptide linker.
- VH variable heavy
- VL variable light
- Non-limiting examples of VHS and VLS from anti- IFN ⁇ antibodies for constructing an anti- IFN ⁇ scFv are as follows:
- Non-limiting examples of an anti-IENg scFv are as follows, with the flexible glycine-serine peptide linker shown in bold:
- DIQMTQSPSTLS AS VGDRVTITCKASENVDTYV S WY QQKPGKAPKLLIY GASNRYTGV PSRFSGSGSGTDFTLTISSLQPDDFATYYCGQSYNYPFTFGQGTKVEVKRGGGGSGGG GSGGGGSQVQLVQSGAELKKPGSSVKVSCKASGYIFTSSWINWVKQAPGQGLEWIGR IDPSDGEVHYNQDFKDKATLTVDKSTNTAYMELSSLRSEDTAVYYCARGFLPWFADW GQGTLVTVSS(SEQ. ID.
- NFMLTQPHS V S ES PGKT VTISCTRS S GSI ASN Y V QW Y QQRPGS SPTT VI YEDN QRPS G V PDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDGSNRWMFGGGTKLTVLGGGGSG GGGSGGGGSEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEW VSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDGSSGW Y VPHWFDPW GQGTL VT V S S (SEQ. ID. NO: 57)
- the anti- IFN ⁇ scFv comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 53 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 52; or comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 56 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 55; or comprises a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 59 and a light chain variable region comprising the amino acid sequence of SEQ ID NO: 58.
- the anti-IFNy scFv comprises the amino acid sequence of SEQ. ID. NO: 54; 57, or 60.
- Soluble IFN ⁇ R fragment are known in the art, for example, the extracellular portion of a native human IFN ⁇ receptor is described in U.S. Patent No: 5,578,707 and 7,449,176.
- the high-affinity IFN ⁇ receptor complex is made up of two type I membrane proteins, IFN ⁇ R1 ( IFN ⁇ R alpha) and IFN ⁇ R2 ( IFN ⁇ R beta). Both proteins are members of the type II cytokine receptor family and share approximately 52% overall sequence identity.
- IFN ⁇ Rl is the ligand binding subunit that is necessary and sufficient for IFNy binding and receptor internalization.
- IFN ⁇ R2 is required for IFN ⁇ signaling but does not bind IFN ⁇ by itself.
- Human IFN ⁇ R1 cDNA encodes a 499 amino acid (aa) residue protein with a 17 aa signal peptide, a 228 aa extracellular domain, a 23 aa transmembrane domain, and a 221 aa intracellular domain. Soluble IFNyR fragments that antagonizes the IFNy signaling may comprises the 228 aa extracellular domain.
- Antagonistic anti-IFNyR antibodies or antigen-binding fragments thereof described in U.S. Patent No: 4,897,264 and 7,449,176. The contents of these patents are incorporated herein by reference in their entireties.
- the IFNy antagonist may further comprising a signal peptide located at the N-terminus of the IFNy antagonist, optionally the signal peptide is selected from albumin, CD8, a growth hormone, IL-2, an antibody light chain; and Gaussia luciferase, or modified version thereof.
- a signal peptide located at the N-terminus of the IFNy antagonist, optionally the signal peptide is selected from albumin, CD8, a growth hormone, IL-2, an antibody light chain; and Gaussia luciferase, or modified version thereof.
- CD8 signal peptide M ALPVT ALLLPLALLLHA ARP (SEQ. ID. NO: 44); antibody light chain signal peptide, MKYLLPT A A AGLLLL A AQPAM A (SEQ. ID. NO: 45); Gaussia luciferase signal peptide, MGVKVLFALICIAVAEA (SEQ ID NO: 46); human albumin signal peptide, MKWVTFISLLFLFSSAYS (SEQ. ID. NO: 47); modified human albumin signal peptide, MKWVTFISLLFLFSSSSRA (SEQ. ID. NO: 48); modified IL2 signal peptide, MRRMQLLLLIALSLALVTNS (SEQ. ID. NO: 49); growth hormone signal peptide, MATGSRTSLLLAFGLLCLPWLQEGSA (SEQ. ID. NO: 29); and native IL-IRA signal peptide, MALETIC (SEQ. ID. NO: 50).
- the modified immune cells disclosed herein may further comprise knock-out of one or more inflammatory proteins (e.g., inflammatory cytokines or soluble receptors thereof, inflammatory growth factors, or cytotoxic molecules), knock-in of one or more antagonists of the inflammatory proteins or immune suppressive cytokines, or a combination thereof.
- one or more inflammatory proteins e.g., inflammatory cytokines or soluble receptors thereof, inflammatory growth factors, or cytotoxic molecules
- knock-in of one or more antagonists of the inflammatory proteins or immune suppressive cytokines e.g., inflammatory cytokines or soluble receptors thereof, inflammatory growth factors, or cytotoxic molecules
- Exemplary inflammatory cytokines or a soluble receptor thereof include interleukin 1 alpha (IL1 ⁇ ), interleukin 1 beta 11 L1 ⁇ ) , interleukin 2 (IL-2), interleukin 5 (IL-5), interleukin 6 (IL-6), interleukin 7 (IL-7), interleukin 8 (IL-8), interleukin 9 (IL-9), interleukin (IL-12), interleukin 15 (IL-15), interleukin 17 (IL-17), interleukin 18 (IL-18), interleukin 21 (IL-21), interleukin 23 (IL-23), sIL-1RI, sIL-2R ⁇ , soluble IL-6 receptor (sIL-6R), interferon a (IFN ⁇ ), interferon ⁇ (IFN ⁇ ), Macrophage inflammatory proteins (e.g., MIP ⁇ and MIP ⁇ ), Macrophage colony-stimulating factor 1 (CSF1), leukemia inhibitory factor (LIF), granulocyte colony- stimulating factor
- target inflammatory proteins include, but are not limited to, inflammatory cytokines or soluble receptors thereof (e.g., IL2, IL1 ⁇ , IL 1 ⁇ , IL-5, IL-6, IL-7, IL-8, IL-9, IL- 12, IL-15, IL-17, IL-18, IL-21, IL-23, sIL-1RI, sIL-2R ⁇ , sIL-6R, IFN ⁇ , IFN ⁇ IFN ⁇ , MIP ⁇ , MIP ⁇ , CSF1, FIF, G-CSF, GM-CSF, CXCF10, CCF5, eotaxin, TNF, MCP1, MIG, RAGE, CRP, angiopoietin-2, and VWF), inflammatory growth factors (e.g., TGF ⁇ , VEGF, EGF, HGF, and FGF) and cytotoxic molecules (e.g., perforin, granzyme, and ferritin).
- modified immune cells comprising the CAR, modified immune cells comprising the IF-6 antagonistic antibody (e.g., scFv1 or scFv2), modified immune cells comprising the IF-1 antagonist, modified immune cells comprising the disrupted IFNy gene, the modified immune cells comprising the IFNy antagonist or a combination thereof as described herein.
- IF-6 antagonist, the IFNy antagonist and the IF-1 antagonist may be a knock-in modification of immune cells.
- At least one population of immune cells comprises the CAR. In another embodiment, at least one population of immune cells comprises an antigen specific TCR. Methods of making such TCRs are described in U.S. Pat. No. 10,117,918 and in U.S.
- the genetically modified immune cells may comprise knock-in modifications of the IF-6 antagonist (e.g., an anti-IF-6 antagonistic antibody such as scFv1 or scFv2), the IFNy antagonist (e.g., an anti-IFN ⁇ antagonistic antibody such as AmG811) and/or an IF-1 antagonist such as IF- IRA.
- Immune cells described herein may not express one or more of TCR, CD52, IFNy, B2M, and GM-CSF. The lack of expression in the immune cells may be due to disruption of the respective endogenous gene or genes (e.g., a knock-out).
- CD52 which is an important marker for producing UCART.
- exemplary of combinations of modifications in the immune cells include B2M knockout and an IF-1 antagonist; GM-CSF knockout and an IF-1 antagonist; CD52 knockout and an IF-1 antagonist; TCR knockout and an IF-1 antagonist; GM-CSF knockout and an IF-6 antagonist; B2M knockout and an IF-6 antagonist; CD52 knockout and an IF-6 antagonist; and TCR knockout and an IF-6 antagonist.
- the modified immune cells disclosed herein comprise knock-in modifications to express the CAR, the antagonistic IF-6 antibody, the IF-1 antagonist, the IFNy antagonist or a combination thereof.
- Knock-in modifications may comprise delivering to host cells (e.g., immune cells as described herein) one or more exogenous nucleic acids coding for the CAR, the IF-6 antagonist antibodies, the IF-1 antagonist or the IFNy antagonist as disclosed herein, or a combination thereof.
- the exogenous nucleic acids are in operative linkage to suitable promoters such that the encoded proteins (e.g., cytokine antagonists and/or immune suppressive cytokines) can be expressed in the host cells.
- the exogenous nucleic acids coding for the CAR, the IL-6 antagonistic antibodies, the IFN ⁇ antagonist and the IL-1 antagonist, or a combination thereof may integrate into the genome of the host cells. In other instances, the exogenous nucleic acids may remain extrachromosomal (not integrated into the genome).
- the modified immune cells comprising one or more knock-in modifications may comprise one or more exogenous nucleic acids (e.g., exogenous expression cassettes) for expressing immune suppressive cytokines and/or antagonists of one or more target inflammatory proteins as described herein.
- exogenous nucleic acids e.g., exogenous expression cassettes
- antigen encompass all the previously identified terms, titles, and functional states and characteristics whereby the target protein itself, a biological activity of the target protein, or the consequences of the biological activity, are substantially nullified, decreased, or neutralized in any meaningful degree, e.g., by at least 20%, 50%, 70%, 85%, 90%, or above.
- a population of modified immune cells may comprise one or more populations of the immune cells comprising the CAR, the IL-6 antagonist, and the IL- 1 antagonist.
- the one or more populations may be overlapping.
- at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, or 80% of the immune cells, or a range between two of the foregoing amounts express the CAR or an antigen specific TCR, the IL-6 antagonist, and the IL-1 antagonist.
- at least 10% of the immune cells may express the IL-6 antagonist, and the IL-1 antagonist.
- about 50-70% of the immune cells may express the CAR, the IL-6 antagonist, and the IL-1 antagonist.
- At least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, or 80% of the immune cells, or a range between two of the foregoing amounts express the CAR or an antigen specific TCR, the IL-6 antagonist, and the IFN ⁇ antagonist.
- at least 10% of the immune cells may express the IL-6 antagonist, and the IFN ⁇ antagonist.
- about 50-70% of the immune cells may express the CAR or an antigen specific TCR, the IL-6 antagonist, and the IFN ⁇ antagonist.
- a population of modified immune cells that comprises the CAR or an antigen specific TCR and can bring about interferon blockade in vivo.
- the modified immune cells have the IFN ⁇ antagonist or having the disrupted IFN ⁇ gene, or the combination of both.
- a population of modified immune cells that comprises one or more populations of the immune cells comprising the CAR or an antigen specific TCR and the IFN ⁇ antagonist or the disrupted IFN ⁇ gene, or the combination of both.
- the present disclosure provides a population of genetically engineered immune cells (e.g., T cells), in which about 5-50% of the immune cells express a CAR or an antigen specific TCR (e.g. , any CAR constructs disclosed herein) and the IL-1 antagonist, and at least 50% (e.g., 70%) of the immune cells have a disrupted endogenous IFN ⁇ and/or GM-CSF gene.
- a CAR or an antigen specific TCR e.g. , any CAR constructs disclosed herein
- the IL-1 antagonist e.g., any CAR constructs disclosed herein
- at least 50% (e.g., 70%) of the immune cells have a disrupted endogenous IFN ⁇ and/or GM-CSF gene.
- about 5-50% of the immune cells may express an anti-IL6 antagonistic antibody and/or an anti-IFN ⁇ antagonistic antibody, such as those disclosed herein.
- these populations of engineered immune cells may include about 5-50% cells of the immune cells
- the immune cell population as described herein can be further modified to express an exogenous cytokine, a chimeric synNotch receptor, a chimeric immunoreceptor, a chimeric costimulatory receptor, a chimeric killer-cell immunoglobulin-like receptor (KIR), and/or an exogenous T cell receptor.
- an exogenous cytokine a chimeric synNotch receptor, a chimeric immunoreceptor, a chimeric costimulatory receptor, a chimeric killer-cell immunoglobulin-like receptor (KIR), and/or an exogenous T cell receptor.
- KIR killer-cell immunoglobulin-like receptor
- an immune cell can be derived from, for example without limitation, a stem cell.
- the stem cells can be adult stem cells, non-human embryonic stem cells, more particularly non-human stem cells, cord blood stem cells, progenitor cells, bone marrow stem cells, induced pluripotent stem cells, totipotent stem cells or hematopoietic stem cells.
- Representative human cells are CD34+ cells.
- the immune cells disclosed herein may be T-cells, NK cells, tumor infiltrating lymphocytes, dendritic cells, macrophages, B cells, neutrophils, eosinophils, basophils, mast cells, myeloid-derived suppressor cells, mesenchymal stem cells, precursors thereof, or combinations thereof.
- the T-cells may be selected from the group consisting of inflammatory T-lymphocytes, cytotoxic T-lymphocytes, regulatory T- lymphocytes or helper T-lymphocytes.
- the T-cells can be derived from the group consisting of CD4+ T-lymphocytes and CD8+ T-lymphocytes.
- CAR-T cells including IL-6 antagonists and IL-1 antagonists, can be found in WO2019/178259 and PCT/US2020/012329, the relevant disclosures of each of which are incorporated by reference for the purpose and subject matter disclosed herein.
- a genetically engineered immune cell comprising: (a) a disrupted endogenous IFN ⁇ gene or IFNyR gene; or (b) an IFN ⁇ antagonist, or a combination of both, whereby the cell inhibits interferon gamma signaling in vivo.
- the engineered cell in addition to IFN ⁇ signaling blockade, may further comprise a CAR or an antigen specific TCR.
- the CAR may comprise an extracellular antigen binding domain, a co-stimulatory signaling, a cytoplasmic domain that may be a cytoplasmic signaling domain, or a combination thereof.
- the CAR may comprise an IL-2RP cytoplasmic signaling domain with a co- stimulatory signaling.
- the CAR may comprise a 4- 1BB co-stimulatory domain; an IL-2RP cytoplasmic signaling domain, a CD3 ⁇ signaling domain, and optionally a transmembrane domain, a hinge domain, and/or a STAT3 binding site.
- the genetically engineered immune cell may comprise the CAR, an IFNy antagonist, and an IL-6 antagonist.
- the genetically engineered immune cell may further comprise an IL-1 antagonist.
- the genetically engineered immune cell may comprise the CAR, a disrupted endogenous IFN ⁇ gene or IFN ⁇ R gene, an IFNy antagonist, and an IL-6 antagonist.
- the genetically engineered immune cell may further comprise an IL- 1 antagonist.
- the genetically engineered immune cell may comprise the CAR, a disrupted endogenous IFN ⁇ gene or IFN ⁇ R gene, and an IL-6 antagonist.
- the genetically engineered immune cell may further comprise an IL-1 antagonist.
- knock-in and knock-out modifications may be introduced into suitable immune cells by routine methods and/or approaches described herein. Typically, such methods would involve delivery of genetic material into the suitable immune cells to either down- regulate expression of a target endogenous inflammatory protein, express a cytokine antagonist of interest or express an immune suppressive cytokine of interest.
- a coding sequence of the one or more the CARs, IL-6 antagonists, IFN ⁇ antagonists, and IL-1 antagonists may be cloned into a suitable expression vector (e. g., including but not limited to lentiviral vectors, retroviral vectors, adenovivral vectors, adeno-associated vectors, PiggyBac transposon vector and Sleeping Beauty transposon vector) and introduced into host immune cells using conventional recombinant technology.
- modified immune cells of the present disclosure may comprise one or more exogenous nucleic acids encoding at least one CAR, IL-6 antagonist, the IFN ⁇ antagonist or IL-1 antagonist.
- the coding sequence of such molecules is integrated into the genome of the cell. In some instances, the coding sequence of such molecules is not integrated into the genome of the cell.
- An exogenous nucleic acid comprising a coding sequence of interest may further comprise a suitable promoter, which can be in operable linkage to the coding sequence.
- a promoter refers to a nucleotide sequence (site) on a nucleic acid to which RNA polymerase can bind to initiate the transcription of the coding DNA (e.g., for a cytokine antagonist) into mRNA, which will then be translated into the corresponding protein (e.g., expression of a gene).
- a promoter is considered to be “operably linked” to a coding sequence when it is in a correct functional location and orientation relative to the coding sequence to control (“drive”) transcriptional initiation and expression of that coding sequence (to produce the corresponding protein molecules).
- the promoter described herein can be constitutive, which initiates transcription independent other regulatory factors. In some instances, the promoter described herein can be inducible, which is dependent on regulatory factors for transcription. Exemplary promoters include, but are not limited to ubiquitin, RSV, CMV, EF1 ⁇ and PGK1. In one example, one or more nucleic acids encoding one or more antagonists of one or more inflammatory cytokines as those described herein, operably linked to one or more suitable promoters can be introduced into immune cells via conventional methods to drive expression of one or more antagonists.
- exogenous nucleic acids described herein may further contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene for selection of stable or transient transfectants in mammalian cells; enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription; transcription termination and RNA processing signals from SV40 for mRNA stability; SV40 polyoma origins of replication and Co1E1 for proper episomal replication; versatile multiple cloning sites; and T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA.
- a selectable marker gene such as the neomycin gene for selection of stable or transient transfectants in mammalian cells
- enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription
- transcription termination and RNA processing signals from SV40 for mRNA stability transcription termination and RNA processing signals from SV40 for mRNA stability
- one or more CARs, IL-6 antagonists, the IFN ⁇ antagonists or IL-1 antagonists can be constructed in one expression cassette in a multi-cistronic manner such that the various molecules are expressed as separate polypeptides.
- an internal ribosome entry site can be inserted between two coding sequences to achieve this goal.
- a nucleotide sequence coding for a self-cleaving peptide e.g., T2A or P2A
- Exemplary designs of such multi-cistronic expression cassettes are provided in Examples below.
- a gene editing method may involve use of an endonuclease that is capable of cleaving the target region in the endogenous allele.
- Non- homologous end joining in the absence of a template nucleic acid may repair double-strand breaks in the genome and introduce mutations (e.g., insertions, deletions and/or frameshifts) into a target site.
- Gene editing methods are generally classified based on the type of endonuclease that is involved in generating double stranded breaks in the target nucleic acid.
- C R I S PR Clustered Regularly Interspaced Short Palindromic Repeats
- endo nuclease systems transcription activator-like effector-based nuclease (TALEN), zinc finger nucleases (ZFN), endonucleases (e.g., ARC homing endonucleases), meganucleases (e.g., mega-TALs), or a combination thereof.
- C R I S PR Clustered Regularly Interspaced Short Palindromic Repeats
- ZFN zinc finger nucleases
- endonucleases e.g., ARC homing endonucleases
- meganucleases e.g., mega-TALs
- a knocking-out event can be coupled with a knocking-in event - an exogenous nucleic acid coding for a desired molecule such as those described herein can be inserted into a locus of a target endogenous gene of interest via gene editing.
- knocking-out an endogenous gene can be achieved using the CRISPR technology.
- exemplary target endogenous genes include one or more of a TCR, CD52, IFN-g, B2M, and GM-CSF.
- any of the knock-out modification may be achieved using antisense oligonucleotides (e.g., interfering RNAs such as shRNA or siRNA) or ribozymes via methods known in the art.
- An antisense oligonucleotide specific to a target cytokine/protein refers to an oligonucleotide that is complementary or partially complementary to a target region of an endogenous gene of the cytokine or an mRNA encoding such.
- antisense oligonucleotides can be delivered into target cells via conventional methods.
- expression vectors such as lentiviral vectors or equivalent thereof can be used to express such an antisense oligonucleotides.
- a population of immune cells comprising any of the modified immune cells described herein, or a combination thereof, may be prepared by introducing into a population of host immune cells one or more of the knock-in modifications, one or more of the knock-out modifications, or a combination thereof.
- the knock-in and knock-out modifications can be introduced into the host cells in any order.
- one or more modifications are introduced into the host cells in a sequential manner without isolation and/or enrichment of modified cells after a preceding modification event and prior to the next modification event.
- the resultant immune cell population may be heterogeneous, comprising cells harboring different modifications or different combination of modifications.
- Such an immune cell population may also comprise unmodified immune cells.
- the level of each modification event occurring in the immune cell population can be controlled by the amount of genetic materials that induce such modification as relative to the total number of the host immune cells. See also above discussions.
- modified immune cells may be isolated and enriched after a first modification event before performing a second modification event. This approach would result in the production of a substantially homogenous immune cell population harboring all of the knock-in and/or knock-out modifications introduced into the cells.
- the knock-in modification(s) and the knock-out modification(s) are introduced into host immune cells separately.
- a knock-out modification is performed via gene editing to knock out an endogenous gene for a target cytokine and a knock- in modification is performed by delivering into the host immune cells a separate exogenous expression cassette for producing one or more cytokine antagonists.
- the knock-in and knock-out event can be occurred simultaneously, for example, the knock-in cassette can be inserted into the locus of a target gene to be knocked-out.
- any of the immune cell populations comprising the modified immune cells as described herein may be used in an adoptive immune cell therapy (e.g., CAR-T) for treating a target disease, such as leukemia or lymphoma.
- a target disease such as leukemia or lymphoma.
- the knock-in and knock-out modifications introduced into the immune cells particularly the knock-in of the CAR, the knock-in of the IL-6 antagonistic antibody, the IENg antagonist, the IL-1 antagonist, or a combination thereof, the therapeutic uses of such would be expected to improve proliferation of the therapeutic cells and/or reduce cytokine toxicity in the patient being treated, while achieving the same or better therapeutic effects.
- an effective amount of the immune cell population comprising any of the modified immune cells as described herein, may be administered to a subject who needs treatment via a suitable route (e.g., intravenous infusion).
- a suitable route e.g., intravenous infusion
- One or more of the immune cell populations may be mixed with a pharmaceutically acceptable carrier to form a pharmaceutical composition prior to administration, which is also within the scope of the present disclosure.
- the immune cells may be autologous to the subject, e.g. , the immune cells are obtained from the subject in need of the treatment, modified to reduce expression of one or more target cytokines/proteins, for example, those described herein, to express one or more cytokine antagonists described herein, to express a CAR construct and/or exogenous TCR, or a combination thereof.
- the resultant modified immune cells can then be administered to the same subject.
- Administration of autologous cells to a subject may result in reduced rejection of the immune cells as compared to administration of non- autologous cells.
- the immune cells can be allogeneic cells, e.g., the cells are obtained from a first subject, modified as described herein and administered to a second subject that is different from the first subject but of the same species.
- allogeneic immune cells may be derived from a human donor and administered to a human recipient who is different from the donor.
- the subject to be treated may be a mammal (e.g., human, mouse, pig, cow, rat, dog, guinea pig, rabbit, hamster, cat, goat, sheep or monkey).
- the subject may be suffering from cancer, have an infectious disease or an immune disorder.
- Exemplary cancers include but are not limited to hematologic malignancies (e.g., B-cell acute lymphoblastic leukemia, chronic lymphocytic leukemia and multiple myeloma).
- infectious diseases include but are not to human immunodeficiency virus (HIV) infection, Epstein-Barr virus (EBV) infection, human papillomavirus (HPV) infection, dengue virus infection, malaria, sepsis and Escherichia coli infection.
- HIV human immunodeficiency virus
- EBV Epstein-Barr virus
- HPV human papillomavirus
- Exemplary immune disorders include but are not limited to, autoimmune diseases, such as rheumatoid arthritis, type I diabetes, systemic lupus erythematosus, inflammatory bowel disease, multiple sclerosis, Guillain-Barre syndrome, chronic inflammatory demyelinating polyneuropathy, psoriasis, Graves' disease, Hashimoto's thyroiditis, myasthenia gravis, and vasculitis.
- autoimmune diseases such as rheumatoid arthritis, type I diabetes, systemic lupus erythematosus, inflammatory bowel disease, multiple sclerosis, Guillain-Barre syndrome, chronic inflammatory demyelinating polyneuropathy, psoriasis, Graves' disease, Hashimoto's thyroiditis, myasthenia gravis, and vasculitis.
- the subject to be treated in the methods disclosed herein may be a human cancer patient.
- the cancer may be lymphoblastic leukemia, acute lymphoblastic leukemia, chronic lymphoblastic leukemia, mantle cell lymphoma, large B-cell lymphoma, or non-Hodgkin's lymphoma.
- the immune cells may express a CAR that binds CD19.
- the cancer may be multiple myeloma, relapsed multiple myeloma, or refractory multiple myeloma.
- the immune cells may express a CAR that binds BCMA.
- the human patient may have breast cancer, gastric cancer, neuroblastoma, or osteosarcoma.
- Non-limiting B-cell related cancers include multiple myeloma, malignant plasma cell neoplasm, Hodgkin's lymphoma, nodular lymphocyte predominant Hodgkin's lymphoma, Kahler's disease and Myelomatosis, plasma cell leukemia, plasmacytoma, B-cell prolymphocytic leukemia, hairy cell leukemia, B-cell non-Hodgkin's lymphoma (NHL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), acute lymphocytic leukemia (ALL), chronic myeloid leukemia (CML), follicular lymphoma, Burkitt's lymphoma, marginal zone lymphoma, mantle cell lymphoma, large cell lymphoma, precursor B -lymphoblastic lymphoma, myeloid leukemia,
- an effective amount refers to the amount of each active agent required to confer therapeutic effect on the subject, either alone or in combination with one or more active agents. Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, individual patient parameters including age, physical condition, size, gender and weight, the duration of treatment, route of administration, excipient usage, co-usage (if any) with other active agents and like factors within the knowledge and expertise of the health practitioner.
- the quantity to be administered depends on the subject to be treated, including, for example, the capacity of the individual's immune system to produce a cell-mediated immune response. Precise mounts of active ingredient required to be administered depend on the judgment of the practitioner. However, suitable dosage ranges are readily determinable by one skilled in the art.
- treating refers to the application or administration of a composition including one or more active agents to a subject, who has a target disease, a symptom of the target disease, or a predisposition toward the target disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the disease, the symptoms of the disease, or the predisposition toward the disease.
- An effective amount of the immune cells may be administered to a human patient in need of the treatment via a suitable route, e.g., intravenous infusion.
- a suitable route e.g., intravenous infusion.
- about 1x10 6 to about 1x10 8 CAR+ T cells may be given to a human patient (e.g. , a leukemia patient, a lymphoma patient, or a multiple myeloma patient).
- a human patient may receive multiple doses of the immune cells.
- the patient may receive two doses of the immune cells on two consecutive days.
- the first dose is the same as the second dose. In other instances, the first dose is lower than the second dose, or vice versa.
- the subject may be administered IL-2 concurrently with the cell therapy. More specifically, an effective amount of IL-2 may be given to the subject via a suitable route before, during, or after the cell therapy. In some embodiments, IL-2 is given to the subject after administration of the immune cells.
- the subject being treated by the cell therapy disclosed herein may be free from treatment involving an IL-6 antagonist (aside from an IL-6 antagonist produced by the immune cells used in the cell therapy) after immune cell infusion.
- the immune cell populations comprising the modified immune cells as described herein may be utilized in conjunction with other types of therapy for cancer, such as chemotherapy, surgery, radiation, gene therapy, and so forth.
- Such therapies can be administered simultaneously or sequentially (in any order) with the immunotherapy described herein.
- suitable therapeutically effective dosages for each agent may be lowered due to the additive action or synergy.
- the subject being treated may also receive immunosuppressive steroids such as methylprednisolone and dexamethasone in conjunction with infusion of the immune cells disclosed herein.
- immunosuppressive steroids such as methylprednisolone and dexamethasone
- the subject is subject to a suitable anti-cancer therapy (e.g., those disclosed herein) to reduce tumor burden prior to the CAR-T therapy disclosed herein.
- the subject e.g., a human cancer patient
- a chemotherapy e.g. , comprising a single chemotherapeutic agent or a combination of two or more chemotherapeutic agents
- the chemotherapy may reduce the total white blood cell count in the subject to lower than 10 8 /L, e.g. , lower than 10 7 /L.
- Tumor burden of a patient after the initial anti-cancer therapy, and/or after the CAR-T cell therapy disclosed herein may be monitored via routine methods. If a patient showed a high growth rate of cancer cells after the initial anti-cancer therapy and/or after the CAR-T therapy, the patient may be subject to a new round of chemotherapy to reduce tumor burden followed by any of the CAR-T therapy as disclosed herein.
- Non-limiting examples of other anti-cancer therapeutic agents useful for combination with the modified immune cells described herein include, but are not limited to, immune checkpoint inhibitors (e.g., PDL1, PD1, and CTLA4 inhibitors), anti-angiogenic agents (e.g., TNP-470, platelet factor 4, thrombospondin- 1, tissue inhibitors of metalloproteases, prolactin, angiostatin, endostatin, bFGF soluble receptor, transforming growth factor beta, interferon alpha, interferon gamma, soluble KDR and FLT-1 receptors, and placental proliferin-related protein); a VEGF antagonist (e.g., anti-VEGF antibodies, VEGF variants, soluble VEGF receptor fragments); chemotherapeutic compounds.
- immune checkpoint inhibitors e.g., PDL1, PD1, and CTLA4 inhibitors
- anti-angiogenic agents e.g., TNP-470, platelet factor 4, thrombospondin
- chemotherapeutic compounds include pyrimidine analogs (e.g., 5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine); purine analogs (e.g.,fludarabine); folate antagonists (e.g., mercaptopurine and thioguanine); antiproliferative or antimitotic agents, for example, vinca alkaloids; microtubule disruptors such as taxane (e.g., paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, and epidipodophyllo toxins; DNA damaging agents (e.g., actinomycin, amsacrine, anthracy dines, bleomycin, busulfan, camptothecin, carboplatin, chlorambucil, cisplatin, cyclophosphamide, cytoxan, dactino
- radiation or radiation and chemotherapy is used in combination with the cell populations comprising modified immune cells described herein. Additional useful agents and therapies can be found in Physician's Desk Reference, 59.sup.th edition, (2005), Thomson P D R, Montvale N.J.; Gennaro et al., Eds. Remington's The Science and Practice of Pharmacy 20.sup.th edition, (2000), Lippincott Williams and Wilkins,
- a kit for therapeutic use as described herein may include one or more containers comprising an immune cell population, which may be formulated to form a pharmaceutical composition.
- the immune cell population comprises any of the modified immune cells described herein or a combination thereof.
- the population of immune cells, such as T lymphocytes, NK cells, and others described herein may further express a CAR construct and/or an exogenous TCR, and or an antigen specific TCR, as described herein.
- the kit can additionally comprise instructions for use of the immune cell population in any of the methods described herein.
- the included instructions may comprise a description of administration of the immune cell population or a pharmaceutical composition comprising such to a subject to achieve the intended activity in a subject.
- the kit may further comprise a description of selecting a subject suitable for treatment based on identifying whether the subject is in need of the treatment.
- the instructions comprise a description of administering the immune cell population or the pharmaceutical composition comprising such to a subject who is in need of the treatment.
- the instructions relating to the use of the immune cell population or the pharmaceutical composition comprising such as described herein generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
- the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses.
- Instructions supplied in the kits of the disclosure are typically written instructions on a label or package insert.
- the label or package insert indicates that the pharmaceutical compositions are used for treating, delaying the onset, and/or alleviating a disease or disorder in a subject.
- kits provided herein are in suitable packaging.
- suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging, and the like.
- packages for use in combination with a specific device such as an inhaler, nasal administration device, or an infusion device.
- a kit may have a sterile access port (for example, the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- the container may also have a sterile access port.
- At least one active agent in the pharmaceutical composition is a population of immune cells (e.g. , T lymphocytes or NK cells) that comprise any of the modified immune cells or a combination thereof.
- Kits optionally may provide additional components such as buffers and interpretive information.
- the kit comprises a container and a label or package insert(s) on or associated with the container.
- the disclosure provides articles of manufacture comprising contents of the kits described above.
- kits for use in making the modified immune cells as described herein may include one or more containers each containing reagents for use in introducing the knock-in and/or knock-out modifications into immune cells.
- the kit may contain one or more components of a gene editing system for making one or more knock-out modifications as those described herein.
- the kit may comprise one or more exogenous nucleic acids for expressing cytokine antagonists as also described herein and reagents for delivering the exogenous nucleic acids into host immune cells.
- Such a kit may further include instructions for making the desired modifications to host immune cells.
- CAR-T cells expressing a CAR construct described herein is effective for treating cancer in a patient with a heavy tumor burden, while also resulting in relatively low IFN-g production during CAR-T therapy.
- a human patient diagnosed with mantle cell lymphoma was treated with anti-CD 19/IL-6/IL-1 CAR-T cells as follows. Structural features of the anti-CD19 CAR, IL-6 antagonist, and IL-1 antagonist are as provided herein.
- the human patient was treated with chemotherapy to lower tumor burden, followed by fludarabine/cyclophosphamide pretreatment to deplete endogenous lymphocytes to place the patient in condition for CAR-T cell transplantation.
- the patient received 0.2X10 8 (DO) anti-CD 19/IL-6/IL-1 CAR-T cells as disclosed herein (with wild type GM-CSF and TCR genes).
- DO 0.2X10 8
- the patient was injected with recombinant IL-2 during the therapy.
- an enormous number of lymphocytes (13.02x10 9 /L) at DO in peripheral blood decreased to normal levels (0.44x10 9 /L) at D19 (FIG. 1A) and complete response was achieved.
- the patient only experienced mild fever (FIG. 1B) and only grade 1 cytokine release syndrome (CRS) without hypotension, hypoxia or neurotoxicity.
- FIGS. 1D and IE show levels of CRP and Ferritin after the T-cell infusion. In sum, these results revealed a relatively low level of IFNy production while CAR-T cells eradicated an enormous number of tumor cells, suggesting that IFN ⁇ might be dispensable during CAR-T therapy, and that knock out of IFN ⁇ may be an appealing way to minimize cytokine toxicity associated with CAR-T therapy.
- T-cells from a normal donor were stimulated and activated by anti-CD3/anti-CD28 dynabeads (Thermo). Three days later, T-cells were electroporated with a ribonucleoprotein (RNP) complex of Cas9 protein (thermo) and single guide RNA (sgRNA) candidates targeting the protospacer adjacent motif (PAM) sequence in the first exon of the human IFN-g gene.
- RNP ribonucleoprotein
- sgRNA single guide RNA
- PAM protospacer adjacent motif
- DNA sequences used for in vitro transcription of IFN- ⁇ sgRNA were as follows: DNA Sequence for in vitro transcription of IFN ⁇ sgRNA sgRNA 1
- T-cells were analyzed by intracellular staining of IFN- g, and the results indicated that sgRNA 4 was most effective in reducing IFN-g production
- FIG. 2 (FIG. 2).
- Example 3 Improved persistence of CAR-T in vivo
- This example describes improved persistence of CAR-T with intracellular IL-2RP signaling in patients after CAR-T cell transplantation.
- Patients diagnosed for refractory or relapsed Multiple Myeloma (MM) were subject to treatment with anti-BCMA CAR-T cells.
- Two types of anti-BCMA CAR-T cells were used.
- Patient #1 was infused with anti-BCMA CAR-T cells that had the intracellular signaling domains of 4 IBB, IL-2R ⁇ and CD3 ⁇ .
- Patient #2 was infused with anti-BCMA CAR-T cells that had the intracellular signaling domains of 41BB and CD3 ⁇ without the IL-2R ⁇ co-stimulatory signaling domains.
- the human patients were treated with fludarabine/cyclophosphamide pretreatment to deplete endogenous lymphocytes so as to place the patient in condition for CAR-T cell transplantation.
- the result showed that the frequency of CAR+ T cells was maintained around 40% at Day 31 post infusion in patient #1, as compared to around 37% at Day16 post infusion in patient #2, which indicates that addition of IL2R ⁇ signaling would improve long term persistence of CAR+ T cells in patients. See FIG. 3.
- Example 4 Sustained clinical response to cell-based therapy in vivo
- This example describes sustained clinical response by anti-CD 19 CAR-T cells with intracellular signaling comprising domains from 41BB, IL-2R ⁇ , CD3 ⁇ in patients.
- Patients diagnosed with refractory and relapsed acute lymphocytic leukemia (ALL) were treated with anti-CD19 CAR-T cells with 41BB, IL-2R ⁇ and CD3 ⁇ signaling.
- ALL acute lymphocytic leukemia
- the three patients achieved complete response as determined by very low numbers or undetectable of CD 19+ B -cells in circulation after the CAR-T treatment compared to prior to treatment.
- IL-2R ⁇ signaling powered CART cells showed long term persistence of CAR+ T cells and induced sustainable B cell aplasia in the treated patients. See FIG. 4.
- Example 5 Expansion of CAR-T cells with intracellular signaling of 41BB, IL- 2R ⁇ , and CD3 ⁇ in patients.
- This example describes in vivo expansion of CAR-T cells having the intracellular signaling domains comprising of 41BB, IL-2R ⁇ , CD3 ⁇ .
- Patient diagnosed for refractory or relapsed ALL Acute Lymphoblastic Leukemia
- lymphoma or MM Multiple Myeloma
- the human patient was treated with fludarabine/cyclophosphamide pretreatment to deplete endogenous lymphocytes so as to place the patient in condition for CAR-T cell transplantation.
- FIG. 5 showed the median peak frequency of anti-BCMA CAR-T cells in T cell population was about 60%, and the median peak frequency of anti-CD19 CAR-T cells in T cell population was about 10%. This result indicated that the combination of 41BB, IL-2R ⁇ , and CD3 ⁇ signaling induces significant expansion of both anti-CD 19 and anti-BCMA CAR-T cells in patients.
- Example 6 Effects of interferon gamma (IFNy) antagonistic antibodies expressed in 293T cells in inhibiting IFNy Signaling in the cells.
- IFNy interferon gamma
- HEK293T cells were transfected with a 3rd generation self-inactivating (SIN) lentiviral transfer vectors encoding single-chain variable fragment (scFv) antibody derived from reference antibodies Amg (AMG811), Fon (fontulizumab) and Ema (emapalumab) disclosed herein, which target IFNy, by LIPOFECTAMINE 2000 (Thermo Scientific).
- a growth hormone (GH) leading sequence single peptide sequence for the expression of proteins destined to be secreted move through the secretory pathway) is located before the anti-IFN ⁇ scFv construct.
- the supernatants of transfected cells containing the secreted scFv antibodies expressed by the transfected HEK293T cells, were collected, diluted, and added to HEK-Blue IFN ⁇ reporter cells (INVIVOGEN) in the presence of 2 ng/ml human IFN ⁇ .
- HEK-Blue IFN ⁇ reporter cells were used because they are capable of producing Secreted Embryonic Alkaline Phosphatase (SEAP) upon human IENg stimulation. After overnight incubation, the supernatant of HEK-Blue IFN ⁇ cells was collected and incubated with Quant-Blue substrate solution. SEAP production was quantified by measuring optical absorbance of converted substrate Quant Blue (INVIVOGEN) at 650nm wave length through a spectrophotometer.
- VL and VH of Amg, Fon, and Ema used in constructing the various anti-IFN ⁇ scFv-CARs are as follows (SEQ ID Nos: 52-60): VL of fontulizumab (SEQ. ID. NO: 52):
- VL of emapalumab (SEQ. ID. NO: 55):
- V H of emapalumab (SEQ. ID. NO: 56):
- V L of AMG811 (SEQ. ID. NO: 58):
- V H of AMG811 (SEQ. ID. NO: 59):
- Anti-IFN ⁇ scFv from AMG811 (SEQ. ID. NO: 60) EIVETQSPGTESESPGERATESCRASQSVSSSYEAWYQQKPGQAPREEIYGASSRATGIP DRFSGSGSGTDFTETISREEPEDFAVYYCQRSGGSSFTFGPGTKVDIKGGGGSGGGGS GGGGSEVQEVQSGAEVKKPGESEKISCKGSGYNFTSYWIGWVRQMPGKGEEEMGIIY PGDSDTRYSPSFQGQVTISADKSISTAYEQWSSEKASDTAMYYCGSGSYFYFDEWGRG TEVTVSS
- scFv antibodies 1 and 4 are able to inhibit IENg signaling in the reporter cells.
- the scFv antibodies derived from antibody Amg811 (Amg) exhibited higher efficiency in inhibiting IFN ⁇ signaling as compared to the scFv antibodies derived from reference antibodies fontulizumab (Fon) and emapalumab (Ema).
- scFv antibodies derived from reference Amg showed close to 80% inhibition of IFN ⁇ signaling at dilution 0.5, whereas those derived from reference antibodies Fon and Ema showed very low inhibition efficiency at the same dilution. This result indicated that scFvs from antibody Amg are more effective in blocking IFN ⁇ signaling in the auto-secretion style of lentivector system.
- FIG. 6A showed that CAR vector encoding anti-IFN ⁇ scFv from emapalumab was not as effective as the anti-IFN ⁇ scFv from Amg811 in inhibiting IFN ⁇ signaling.
- the clinical data of patients treated with CART co-expressing anti-IFN ⁇ scFv from emapalumab showed that very low level of IFN ⁇ was observed during CART ⁇ herapy. See further examples below, FIGS. 9 andlO.
- One possible reason might be that CART synthesized anti-IFN ⁇ scFv from emapalumab was not secreted efficiently and trapped inside the cells.
- Fig. 6B 1, a signal peptide from albumin (SEQ. ID. NO: 47); 2, a signal peptide from CD8 (SEQ. ID. NO: 44); 3, a signal peptide from a growth hormone (SEQ. ID. NO: 29); 4, a modified signal peptide from albumin (SEQ. ID.
- Example 7 Inhibition of IFNy signaling prevents severe cytokine release syndrome (CRS) in patients treated with CAR-T Therapy for cancer.
- CRS cytokine release syndrome
- ALL Acute lymphocytic leukemia (ALL) patient treated with IFN ⁇ knockout (KO) CAR-T cells
- a patient diagnosed with refractory and relapsed ALL was treated with anti-CD 19 CAR-T cells with 4 IBB- IE-2B ⁇ - CD3 ⁇ signaling, CRISPR edited IFN ⁇ KO and co-expressing both IL-6 antagonist and IL-1 antagonist.
- this patient achieved complete response and has low levels of peak IFNy (FIG. 7), showing that anti-CD 19 CAR-T cells with IFN ⁇ KO are capable of inducing complete response in clinical efficacy.
- B cell aplasia was observed at day 14 after CART infusion, and no tumor cells were detected in bone marrow examination result, suggesting complete response was achieved after treatment.
- Lymphoma patient treated with antagonistic anti -IFN ⁇ scFv expressing CAR-T cells A patient diagnosed with refractory and relapsed lymphoma was treated with anti- CD 19 CAR-T cells with 4 IBB- IB-2R ⁇ - CD3 ⁇ signaling, and co-expressing IFN ⁇ blocking scFv derived from emapalumab and IL6 blocking scFv derived from sirukumab. After treatment, this patient achieved complete response, and the very low level of peak IFN ⁇ was detected (FIG. 9), showing that anti-CD 19 CAR-T cells with co-expression of Ema scFv are capable of inducing complete response in clinical efficacy. During the treatment, only grade 0 CRS was observed. PET-CT scanning result during follow up indicated that the tumor spot disappeared at day 106 after treatment.
- MM patient treated with antagonistic anti- IFN ⁇ scFv expressing CAR-T cells Two patients diagnosed with refractory and relapsed MM were treated with anti-BCMA CAR-T cells with 4 IBB- IB-2R ⁇ - CD3 ⁇ signaling, and co-expressing IFN ⁇ blocking scFv derived from emapalumab and IL6 blocking scFv derived from sirukumab. After treatment, the patients achieved very good partial response, and the very low levels of peak IFN ⁇ were detected (FIGS. 10A and 10B) indicating that anti-BCMA CAR-T cells with co-expression of Ema scFv are capable of inducing very good partial response in clinical efficacy.
- inventive embodiments are presented by way of example only and that, within the scope of the appended claims and equivalents thereto, inventive embodiments may be practiced otherwise than as specifically described and claimed.
- inventive embodiments of the present disclosure are directed to each individual feature, system, article, material, kit, and/or method described herein.
- a reference to “A and/or B”, when used in conjunction with open-ended language such as “comprising” can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
- the phrase “at least one,” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements.
- This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase “at least one” refers, whether related or unrelated to those elements specifically identified.
- “at least one of A and B” can refer, in one embodiment, to at least one, optionally including more than one,
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Zoology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Biomedical Technology (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Hematology (AREA)
- General Engineering & Computer Science (AREA)
- Microbiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Oncology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- Plant Pathology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Developmental Biology & Embryology (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2021251113A AU2021251113A1 (en) | 2020-04-06 | 2021-04-06 | Genetically modified immune cells expressing a chimeric antigen receptor and having reduced proinflammatory cytokine signaling |
| US17/995,577 US20230149465A1 (en) | 2020-04-06 | 2021-04-06 | Genetically modified immune cells expressing a chimeric antigen receptor and having reduced proinflammatory cytokine signaling |
| IL297034A IL297034A (en) | 2020-04-06 | 2021-04-06 | Genetically modified immune cells expressing a chimeric antigen receptor and having reduced proinflammatory cytokine signaling |
| EP21784804.3A EP4132973A4 (en) | 2020-04-06 | 2021-04-06 | GENETICALLY ENGINEERED IMMUNE CELLS EXPRESSING A CHIMERIC ANTIGEN RECEPTOR AND HAVING REDUCED PRO-INFLAMMATORY CYTOKINE SIGNALING |
| CN202180026149.5A CN115698062A (zh) | 2020-04-06 | 2021-04-06 | 表达嵌合抗原受体并具有降低的促炎细胞因子信号传导的经基因修饰的免疫细胞 |
| CA3173490A CA3173490A1 (en) | 2020-04-06 | 2021-04-06 | Genetically modified immune cells expressing a chimeric antigen receptor and having reduced proinflammatory cytokine signaling |
| KR1020227038818A KR20230019419A (ko) | 2020-04-06 | 2021-04-06 | 키메라 항원 수용체를 발현하고 감소된 전염증성 사이토카인 신호전달을 갖는 유전적으로 변형된 면역 세포 |
| JP2023504152A JP2023521519A (ja) | 2020-04-06 | 2021-04-06 | キメラ抗原受容体を発現し低減した炎症性サイトカインシグナル伝達を有する遺伝子改変された免疫細胞 |
| ZA2022/10919A ZA202210919B (en) | 2020-04-06 | 2022-10-04 | Genetically modified immune cells expressing a chimeric antigen receptor and having reduced proinflammatory cytokine signaling |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202063005684P | 2020-04-06 | 2020-04-06 | |
| US63/005,684 | 2020-04-06 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021207150A1 true WO2021207150A1 (en) | 2021-10-14 |
Family
ID=78022619
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/025906 Ceased WO2021207150A1 (en) | 2020-04-06 | 2021-04-06 | Genetically modified immune cells expressing a chimeric antigen receptor and having reduced proinflammatory cytokine signaling |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US20230149465A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4132973A4 (cg-RX-API-DMAC7.html) |
| JP (1) | JP2023521519A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20230019419A (cg-RX-API-DMAC7.html) |
| CN (1) | CN115698062A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2021251113A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3173490A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL297034A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2021207150A1 (cg-RX-API-DMAC7.html) |
| ZA (1) | ZA202210919B (cg-RX-API-DMAC7.html) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114350665A (zh) * | 2022-01-19 | 2022-04-15 | 上海优替济生生物医药有限公司 | IFN-γ抑制剂及其用途 |
| WO2023158646A1 (en) * | 2022-02-16 | 2023-08-24 | Rusyn Elena | Autologous stem cell vaccine and methods |
| EP4269432A1 (en) * | 2022-04-26 | 2023-11-01 | Universite de Rouen Normandie | Production of therapeutic antibodies by the microalgae phaeodactylum tricornutum |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20250074841A (ko) * | 2023-11-20 | 2025-05-28 | (재) 스크립스코리아항체연구원 | 키메라 항원 수용체를 발현하는 면역 세포 및 트렙타비딘 스캐폴드 항체 유사 단백질을 포함하는 항암용 조성물, 및 이의 용도 |
| CN117965633A (zh) * | 2024-04-01 | 2024-05-03 | 北京双赢科创生物科技有限公司 | 一种IFNγ受体敲除的CAR-T细胞的制备方法与应用 |
Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6514752B1 (en) * | 1989-07-25 | 2003-02-04 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| US20140004127A1 (en) * | 2002-10-16 | 2014-01-02 | Medarex, Inc. | Human Anti-IFN-gamma Neutralizing Antibodies as Selective IFN-gamma Pathway Inhibitors |
| WO2019152781A1 (en) * | 2018-02-02 | 2019-08-08 | The Trustees Of The University Of Pennsylvania | Modified monocytes/macrophages/dendritic cells expressing chimeric antigen receptors and uses in diseases and disorders associated with protein aggregates |
| WO2019242339A1 (zh) * | 2018-06-20 | 2019-12-26 | 上海隆耀生物科技有限公司 | 一种包含第三信号受体的嵌合抗原受体及其应用 |
| WO2020044055A1 (en) * | 2018-08-31 | 2020-03-05 | King's College London | Engineered regulatory t cell |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| HK1044159A1 (zh) * | 1998-12-01 | 2002-10-11 | 蛋白质设计实验室股份有限公司 | 抗γ-干扰素的人化抗体 |
| US11091543B2 (en) * | 2015-05-07 | 2021-08-17 | Swedish Orphan Biovitrum Ag | Methods, compositions and dosing regimens for treating or preventing interferon-gamma related indications |
| MX2019004766A (es) * | 2016-10-24 | 2019-09-27 | Novimmune Sa | Metodos, composiciones y regimenes de dosificacion para tratar o prevenir indicaciones relacionadas con interferon-gamma. |
| US20200048618A1 (en) * | 2017-04-18 | 2020-02-13 | Autolus Limited | Cell |
| US12539308B2 (en) * | 2018-01-08 | 2026-02-03 | The Trustees Of The University Of Pennsylvania | Immune-enhancing RNAs for combination with chimeric antigen receptor therapy |
| EP3802578A4 (en) * | 2018-06-01 | 2022-03-23 | Washington University | SUPPRESSION OF CYTOKINE RELEASE SYNDROME IN CHIMERIC ANTIGEN RECEPTOR CELL THERAPY |
-
2021
- 2021-04-06 WO PCT/US2021/025906 patent/WO2021207150A1/en not_active Ceased
- 2021-04-06 KR KR1020227038818A patent/KR20230019419A/ko active Pending
- 2021-04-06 EP EP21784804.3A patent/EP4132973A4/en not_active Withdrawn
- 2021-04-06 US US17/995,577 patent/US20230149465A1/en active Pending
- 2021-04-06 JP JP2023504152A patent/JP2023521519A/ja active Pending
- 2021-04-06 CN CN202180026149.5A patent/CN115698062A/zh active Pending
- 2021-04-06 AU AU2021251113A patent/AU2021251113A1/en not_active Abandoned
- 2021-04-06 IL IL297034A patent/IL297034A/en unknown
- 2021-04-06 CA CA3173490A patent/CA3173490A1/en active Pending
-
2022
- 2022-10-04 ZA ZA2022/10919A patent/ZA202210919B/en unknown
Patent Citations (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6514752B1 (en) * | 1989-07-25 | 2003-02-04 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| US20140004127A1 (en) * | 2002-10-16 | 2014-01-02 | Medarex, Inc. | Human Anti-IFN-gamma Neutralizing Antibodies as Selective IFN-gamma Pathway Inhibitors |
| WO2019152781A1 (en) * | 2018-02-02 | 2019-08-08 | The Trustees Of The University Of Pennsylvania | Modified monocytes/macrophages/dendritic cells expressing chimeric antigen receptors and uses in diseases and disorders associated with protein aggregates |
| WO2019242339A1 (zh) * | 2018-06-20 | 2019-12-26 | 上海隆耀生物科技有限公司 | 一种包含第三信号受体的嵌合抗原受体及其应用 |
| WO2020044055A1 (en) * | 2018-08-31 | 2020-03-05 | King's College London | Engineered regulatory t cell |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP4132973A4 * |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN114350665A (zh) * | 2022-01-19 | 2022-04-15 | 上海优替济生生物医药有限公司 | IFN-γ抑制剂及其用途 |
| WO2023158646A1 (en) * | 2022-02-16 | 2023-08-24 | Rusyn Elena | Autologous stem cell vaccine and methods |
| EP4269432A1 (en) * | 2022-04-26 | 2023-11-01 | Universite de Rouen Normandie | Production of therapeutic antibodies by the microalgae phaeodactylum tricornutum |
| WO2023208883A1 (en) * | 2022-04-26 | 2023-11-02 | Universite De Rouen Normandie | Production of therapeutic antibodies by the microalgae phaeodactylum tricornutum |
Also Published As
| Publication number | Publication date |
|---|---|
| EP4132973A4 (en) | 2024-06-12 |
| IL297034A (en) | 2022-12-01 |
| US20230149465A1 (en) | 2023-05-18 |
| EP4132973A1 (en) | 2023-02-15 |
| JP2023521519A (ja) | 2023-05-24 |
| AU2021251113A1 (en) | 2022-10-27 |
| CA3173490A1 (en) | 2021-10-14 |
| KR20230019419A (ko) | 2023-02-08 |
| ZA202210919B (en) | 2024-02-28 |
| CN115698062A (zh) | 2023-02-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2020203137B2 (en) | Bispecific chimeric antigen receptors and therapeutic uses thereof | |
| US20230149465A1 (en) | Genetically modified immune cells expressing a chimeric antigen receptor and having reduced proinflammatory cytokine signaling | |
| US20240245772A1 (en) | Bi-specific chimeric antigen receptors and genetically engineered immune cells expressing such | |
| JP2023540761A (ja) | Il-2変異体およびその用途 | |
| EP4442701A1 (en) | Combination of molecular switch regulation type chimeric antigen receptor cell and antibody, and use thereof | |
| US20220096548A1 (en) | Modified immune cells co-expressing chimeric antigen receptor and il-6 antagonist for reducing toxicity and uses thereof in adoptive cell therapy | |
| US20260091062A1 (en) | Recombinant Fc domain - IL2 variant polypeptides and combination therapy with membrane-anchored antigen binding polypeptides | |
| WO2017177217A2 (en) | Chimeric receptors and uses thereof in immune therapy | |
| US20250195651A1 (en) | Use of antigen presenting cells to enhance car-t cell therapy | |
| HK40086612A (zh) | 表达嵌合抗原受体并具有降低的促炎细胞因子信号传导的经基因修饰的免疫细胞 | |
| HK40065054A (en) | Modified immune cells co-expressing chimeric antigen receptor and il-6 antagonist for reducing toxicity and uses thereof in adoptive cell therapy | |
| WO2025233304A1 (en) | Recombinant fc domain – il7 variant polypeptides and combination therapy with membrane-anchored antigen binding polypeptides | |
| HK40109914A (zh) | 抗egfrviii抗体、多肽、表达前述多肽的细胞、包含前述细胞的医药组合物、前述细胞的制造方法、及包含编码前述多肽的碱基序列的多核苷酸或载体 | |
| HK40108858A (zh) | 抗cll1抗体及其构建体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21784804 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3173490 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2023504152 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2021251113 Country of ref document: AU Date of ref document: 20210406 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021784804 Country of ref document: EP Effective date: 20221107 |
|
| WWW | Wipo information: withdrawn in national office |
Ref document number: 2021784804 Country of ref document: EP |