WO2021178717A2 - Improved methods and compositions for modulating a genome - Google Patents
Improved methods and compositions for modulating a genome Download PDFInfo
- Publication number
- WO2021178717A2 WO2021178717A2 PCT/US2021/020943 US2021020943W WO2021178717A2 WO 2021178717 A2 WO2021178717 A2 WO 2021178717A2 US 2021020943 W US2021020943 W US 2021020943W WO 2021178717 A2 WO2021178717 A2 WO 2021178717A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- polypeptide
- domain
- dna
- preceding embodiments
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- C12N9/1241—Nucleotidyltransferases (2.7.7)
- C12N9/1276—RNA-directed DNA polymerase (2.7.7.49), i.e. reverse transcriptase or telomerase
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering nucleic acids [NA]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/80—Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
Definitions
- the disclosure also provides systems for altering a genomic DNA sequence of interest, e.g., by inserting, deleting, or substituting one or more nucleotides into/from the sequence of interest.
- compositions or methods can include one or more of the following enumerated embodiments. 1.
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table Z1 or Table X) and (ii) an endonuclease domain, wherein one or both of (i) or (ii) have an amino acid sequence encoded by a nucleic acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a reverse transcriptase domain e.g., as listed
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table Z1 or Table X) and (ii) an endonuclease domain, wherein one or both of (i) or (ii) have an amino acid sequence encoded by a nucleic acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a reverse transcriptase domain e.g., as listed in Table 3B,
- heterologous object sequence encodes a therapeutic polypeptide or that encodes a mammalian (e.g., human) polypeptide, or a fragment or variant thereof.
- the heterologous object sequence encodes a therapeutic non-coding RNA (e.g., a miRNA).
- the heterologous object sequence comprises a regulatory sequence (e.g., a promoter, an enhancer, a binding site for an endogenous regulatory component, e.g., a miRNA binding site), e.g., which alters the expression of an endogenous gene or non-coding RNA. 6.
- a system for modifying DNA comprising : (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence that binds a target site (e.g., a second strand of a site in a target genome), (ii) optionally a sequence that binds the polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ target homology domain; wherein: (i) the polypeptide comprises a heterologous targeting domain (e.g., in the DBD or the endonucleas
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table Z1 or Table X) and (ii) an endonuclease domain, wherein one or both of (i) or (ii) have an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a reverse transcriptase domain e.g., as listed in Table 3B, Table 10, Table 11, Table
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, or Table Z1 or Table X) and (ii) an endonuclease domain, wherein one or both of (i) or (ii) have an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a reverse transcriptase domain e.g., as listed in Table 3B, Table 10, Table 11, or Table Z1 or
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table Z1 or Table X) and (ii) a target DNA binding domain, wherein one or both of (i) or (ii) have an amino acid sequence encoded by a nucleic acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a reverse transcriptase domain e.g., as listed in Table 3
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table Z1 or Table X) and (ii) a target DNA binding domain, wherein one or both of (i) or (ii) have an amino acid sequence encoded by a nucleic acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a reverse transcriptase domain e.g., as listed in Table 3B, Table 10, Table
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain from a protein other than a retrotransposase, e.g., from a retrovirus, e.g., reverse transcriptase domain as listed in Table Z1 or Z2, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (ii) an endonuclease domain and/or a target DNA binding domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a reverse transcriptase domain from a protein other than a retrotransposase, e.g.,
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain from a protein other than a retrotransposase, e.g., from a retrovirus, e.g., reverse transcriptase domain as listed in Table Z1 or Z2, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (ii) an endonuclease domain and/or a target DNA binding domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a reverse transcriptase domain from a protein other than a retrotransposase, e.g., from a retrovirus
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table Z1 or Z2) and (ii) an endonuclease domain and/or a target DNA binding domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence; wherein the sequence of the template RNA that binds the polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a 5’ UTR or a 3’ UTR of a sequence of an element of Table 10 or Table X.
- a reverse transcriptase domain e.g., as listed in Table Z1 or Z2
- a template RNA or DNA
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table Z1 or Z2) and (ii) an endonuclease domain and/or a target DNA binding domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence; wherein the sequence of the template RNA that binds the polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to: (i) the nucleotides located 5’ relative to a start codon of a sequence of an element of Table 10 or Table X (e.g., comprising a retrotransposase-binding region), or (ii) the nucle
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table Z1, or Z2 or Table X) and (ii) an endonuclease domain and/or a target DNA binding domain; (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence; and (c) an intein. 18.
- a reverse transcriptase domain e.g., as listed in Table 3B, Table 10, Table 11, Table Z1, or Z2 or Table X
- a template RNA or DNA encoding the template RNA comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence (e.g., a CRISPR spacer) that binds a target site (e.g., a non-edited strand of a site in a target genome), (ii) optionally a sequence that binds the
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (ii) optionally a sequence that binds the polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ homology domain, wherein the RT domain has an amino acid sequence of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; and (b) a template RNA (etRNA) (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (ii) optionally a sequence that binds the polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ homology domain, wherein the system is capable of producing an insertion into the target site of at least 45, 50, 55, 60, 65,
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (ii) optionally a sequence that binds the polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ homology domain, wherein the heterologous object sequence is at least 74, 75, 76, 77, 78, 79, 80, 81,
- the RT domain is heterologous to the DBD; the DBD is heterologous to the endonuclease domain; or the RT domain is heterologous to the endonuclease domain. 25.
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (ii) optionally a sequence that binds the polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ homology domain, wherein the system is capable of producing a deletion into the target site of at least 81, 85, 90, 95, 100, 110, 120, 130
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; and (b) a template (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (ii) optionally a sequence that binds the polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ homology domain, wherein (a)(ii) and/or (a)(iii) comprises a TALE molecule; a zinc finger molecule;
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence (e.g., a CRISPR spacer) that binds a target site (e.g., a non-edited strand of a site in a target genome), (ii) optionally a sequence that binds the polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ homology domain, wherein the endonuclease domain, e.g., RT
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (ii) a sequence that specifically binds the RT domain, (iii) a heterologous object sequence, and (iv) a 3’ homology domain.
- RT reverse transcriptase
- DBD DNA-binding domain
- an endonuclease domain e.g.,
- a system for modifying DNA comprising: (a) a first polypeptide or a nucleic acid encoding the first polypeptide, wherein the first polypeptide comprises (i) a reverse transcriptase (RT) domain and (ii) optionally a DNA-binding domain, (b) a second polypeptide or a nucleic acid encoding the second polypeptide, wherein the second polypeptide comprises (i) a DNA-binding domain (DBD); (ii) an endonuclease domain, e.g., a nickase domain; and (c) a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence that binds the second polypeptide (e.g., that
- a system for modifying DNA comprising: (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, and (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; (b) a first template RNA (or DNA encoding the RNA) comprising (e.g., from 5’ to 3’) (i) a sequence that binds the polypeptide (e.g., that binds (a)(ii) and/or (a)(iii)) and (ii) a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (e.g., wherein the first RNA comprises a gRNA); (c) a second template RNA (or DNA encoding
- the second template RNA comprises (i). 33.
- the system of any of the preceding embodiments, wherein the first and second conjugating domains are capable of hybridizing to one another, e.g., under stringent conditions.
- 35. The system of any of the preceding embodiments, wherein association of the first conjugating domain and the second conjugating domain colocalizes the first template RNA and the second template RNA.
- the template RNA comprises (i). 37.
- a system for modifying DNA comprising: (a) a first polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises a reverse transcriptase (RT) domain, wherein the RT domain has a sequence of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and optionally a DNA-binding domain (DBD) (e.g., a first DBD); and (b) a second polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a DBD (e.g., a second DBD); and (ii) an endonucle
- DBD DNA-binding domain
- nucleic acid encoding the first polypeptide and the nucleic acid encoding the second polypeptide are two separate nucleic acids.
- nucleic acid encoding the first polypeptide and the nucleic acid encoding the second polypeptide are part of the same nucleic acid molecule, e.g., are present on the same vector.
- 42. The system of any of the preceding embodiments, having one or more (e.g., 1, 2, 3, 4, 5, 6, or all) of the following characteristics: i. the heterologous object sequence encodes a protein, e.g.
- the heterologous object sequence comprises a tissue specific promoter or enhancer; iii. the heterologous object sequence encodes a polypeptide of greater than 50, 100, 150, 200, 250, 300, 400, 500, or 1,000 amino acids, and optionally up to 7,500 amino acids; iv. the heterologous object sequence encodes a fragment of a mammalian gene but does not encode the full mammalian gene, e.g., encodes one or more exons but does not encode a full-length protein; v.
- an enzyme e.g., a lysosomal enzyme
- a blood factor e.g., Factor I, II, V, VII, X, XI, XII or XIII
- the heterologous object sequence encodes one or more introns; vi. the heterologous object sequence is other than a GFP, e.g., is other than a fluorescent protein or is other than a reporter protein; or vii. the heterologous object sequence comprises only non-coding sequences, e.g., regulatory elements. 43. The system of any of the preceding embodiments, wherein the polypeptide further comprises a target DNA binding domain, e.g., having an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 44.
- a target DNA binding domain e.g., having an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%,
- the polypeptide further comprises a target DNA binding domain, e.g., having an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom.
- the polypeptide further comprises a target DNA binding domain, e.g., having an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 46.
- the polypeptide further comprises a target DNA binding domain, e.g., having an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 47. The system of any of the preceding embodiments, wherein the polypeptide has an activity at 37°C that is no less than 70%, 75%, 80%, 85%, 90%, or 95% of its activity at 25°C under otherwise similar conditions. 48.
- polypeptide is derived from a homeothermic organism, e.g., a bird or a mammal. 49.
- the polypeptide is derived from one or more of: a CRE retrotransposase, an NeSL retrotransposase, an R4 retrotransposase, an R2 retrotransposase, a Hero retrotransposase, an L1 retrotransposase, an RTE retrotransposase, an I retrotransposase, a Jockey retrotransposase, a CR1 retrotransposase, a Rex1 retrotransposase, an RandI/Dualen retrotransposase, a Penelope or Penelope-like retrotransposase, a Tx1 retrotransposase, an RTEX retrotransposase, a Crack retrotransposase, a
- polypeptide comprises an endonuclease domain from a transposable element, e.g., a restriction-like endonuclease (RLE), an apurininc/apyrimidinic endonuclease-like endonuclease (APE), a GIY-YIG endonuclease.
- RLE restriction-like endonuclease
- APE apurininc/apyrimidinic endonuclease-like endonuclease
- GIY-YIG endonuclease GIY-YIG endonuclease
- the endonuclease makes a double stranded break.
- the template RNA comprises a sequence of Table 3A or 3B or 10 (e.g., one or both of a 5’ untranslated region of column 6 of Table 3A or 3B and a 3’ untranslated region of column 7 of Table 3A or 3B), or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 56.
- the template RNA comprises a sequence of Table 3A or 3B or 11 (e.g., one or both of a 5’ untranslated region of column 6 of Table 3A or 3B and a 3’ untranslated region of column 7 of Table 3A or 3B), or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom.
- the system has one or more (e.g., 1, 2, 3, or all) of the following characteristics: i.
- the nucleic acid encoding the polypeptide and the template RNA or a nucleic acid encoding the template RNA are separate nucleic acids; ii. the template RNA does not encode an active reverse transcriptase, e.g., comprises an inactivated mutant reverse transcriptase, e.g., as described in Examples 1-2, or does not comprise a reverse transcriptase sequence; iii. the template RNA does not encode an active endonuclease, e.g., comprises an inactivated endonuclease or does not comprise an endonuclease; or iv. the template RNA comprises one or more chemical modifications. 58.
- the template RNA (or DNA encoding the template RNA) comprises (i) a 5’ UTR sequence that binds the polypeptide, (ii) a 3’ UTR sequence that binds the polypeptide, (iii) a heterologous object sequence, and (iv) a promoter operably linked to the heterologous object sequence, wherein the promoter is disposed between the 5’ untranslated sequence that binds the polypeptide and the heterologous sequence, or wherein the promoter is disposed between the 3’ untranslated sequence that binds the polypeptide and the heterologous sequence. 59.
- the template RNA (or DNA encoding the template RNA) comprises (i) a 5’ UTR sequence that binds the polypeptide, (ii) a 3’ UTR sequence that binds the polypeptide, and (iii) a heterologous object sequence, and wherein the heterologous object sequence comprises an open reading frame (or the reverse complement thereof) in a 5’ to 3’ orientation on the template RNA; or wherein the heterologous object sequence comprises an open reading frame (or the reverse complement thereof) in a 3’ to 5’ orientation on the template RNA. 60.
- the 5’ UTR sequence of the template RNA (or DNA encoding the template RNA) has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a 5’ UTR sequence of a sequence of an element of Table 3B, Table 10, or Table X. 61.
- the 5’ UTR sequence of the template RNA (or DNA encoding the template RNA) has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to nucleotides located 5’ relative to a start codon of a sequence of an element of Table 3B, Table 10, or Table X (e.g., comprising a retrotransposase-binding region). 62.
- the 3’ UTR sequence of the template RNA has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a 3’ UTR sequence of a sequence of an element of Table 3B, Table 10, or Table X. 65.
- the 3’ UTR sequence of the template RNA (or DNA encoding the template RNA) has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a 3’ UTR sequence of Table 10 or column 7 of Table 3A or 3B. 67.
- the 3’ UTR sequence of the template RNA (or DNA encoding the template RNA) has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the nucleotides located 3’ relative to a stop codon of a sequence of an element of Table 3B, Table 10, or Table X (e.g., comprising a retrotransposase-binding region). 68.
- a homology domain e.g., as described herein, e.g., a homology domain having at least 5, 10, 20, 50, or 100 bases of at least 80% (e.g., at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 100%) identity to a target DNA strand, wherein optionally the homology domain comprises a sequence according to a 3’ homology arm of Table 11, or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 69.
- a homology domain e.g., as described herein, e.g., a homology domain having at least 10, 20, 50, or 100 bases of at least 80% (e.g., at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 100%) identity to a target DNA strand, wherein optionally the homology domain comprises a sequence according to a 5’ homology arm of Table 11, or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 70.
- polypeptide comprises (i) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to a reverse transcriptase domain of an apurinic/apyrimidinic endonuclease (APE)-type non-LTR retrotransposon and (ii) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to an endonuclease domain of an APE-type non-LTR retrotransposon.
- APE apurinic/apyrimidinic endonuclease
- the polypeptide comprises (i) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to a reverse transcriptase domain of a Penelope-like element (PLE)-type retrotransposon and (ii) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to an endonuclease domain of a PLE-type retrotransposon, e.g., wherein the PLE-type retrotransposon comprises a GIY-YIG endonuclease. 74.
- PLE Penelope-like element
- the PLE-type retrotransposon does not comprise a functional endonuclease domain.
- the PLE-type retrotransposase comprises a Penelope-like element that naturally lacks an endonuclease domain (e.g., an Athena element, e.g., as described in Gladyshev and Arkhipova PNAS 104, 9352-9357 (2007)).
- a Penelope-like element that naturally lacks an endonuclease domain (e.g., an Athena element, e.g., as described in Gladyshev and Arkhipova PNAS 104, 9352-9357 (2007)).
- polypeptide comprises (i) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to a reverse transcriptase domain of a restriction enzyme-like endonuclease (RLE)-type non-LTR retrotransposon, (ii) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to an endonuclease domain of a RLE-type non-LTR retrotransposon, and (iii) a target DNA binding domain heterologous to (i) and/or (ii) (e.g., a heterologous zinc-finger DNA binding domain).
- RLE restriction enzyme-like endonuclease
- polypeptide comprises (i) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to a reverse transcriptase domain of a restriction enzyme-like endonuclease (RLE)-type non-LTR retrotransposon, and (ii) a heterologous endonuclease domain and/or a heterologous DNA binding domain.
- RLE restriction enzyme-like endonuclease
- polypeptide comprises (i) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to a reverse transcriptase domain of an apurinic/apyrimidinic endonuclease (APE)-type non-LTR retrotransposon, (ii) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to an endonuclease domain of an APE-type non-LTR retrotransposon, and (iii) a target DNA binding domain heterologous to (i) and/or (ii) (e.g., a heterologous zinc-finger DNA binding domain).
- APE apurinic/apyrimidinic endonuclease
- polypeptide comprises (i) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to a reverse transcriptase domain of an apurinic/apyrimidinic endonuclease (APE)-type non-LTR retrotransposon, and (ii) a heterologous endonuclease domain and/or a heterologous DNA binding domain.
- APE apurinic/apyrimidinic endonuclease
- polypeptide comprises (i) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to a reverse transcriptase domain of a Penelope-like element (PLE)-type retrotransposon, (ii) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to an endonuclease domain of a PLE-type retrotransposon, and (iii) a target DNA binding domain heterologous to (i) and/or (ii) (e.g., a heterologous zinc-finger DNA binding domain).
- PLE Penelope-like element
- polypeptide comprises (i) a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to a reverse transcriptase domain of a Penelope-like element (PLE)-type retrotransposon, and (ii) a heterologous endonuclease domain and/or a heterologous DNA binding domain.
- PLE Penelope-like element
- the template RNA comprises (iii) a promoter operably linked to the heterologous object sequence.
- the polypeptide further comprises (iii) a DNA-binding domain.
- the DNA binding domain has endonuclease activity.
- the endonuclease domain or endonuclease activity forms a double stranded break in DNA.
- the endonuclease domain or endonuclease activity nicks DNA.
- polypeptide comprises a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to a sequence in column 7 of Table 3A or 3B.
- polypeptide comprises a sequence at least 80% identical (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identical) to the sequence of an element listed in Table 10, Table 11, or Table X. 90.
- nucleic acid encoding the polypeptide and the template RNA or the nucleic acid encoding the template RNA are covalently linked, e.g., are part of a fusion nucleic acid.
- fusion nucleic acid comprises RNA.
- fusion nucleic acid comprises DNA.
- (b) comprises template RNA.
- the template RNA further comprises a nuclear localization signal.
- RNA of (a) comprises RNA encoding the polypeptide.
- RNA of (a) and the RNA of (b) are separate RNA molecules.
- 97. The system of any of the preceding embodiments, wherein the RNA of (a) and the RNA of (b) are present at a ratio of between 100:1 and 10:1, 10:1 and 5:1, 5:1 and 2:1, 2:1 and 1:1, 1:1 and 1:2, 1:2 and 1:5, 1:5 and 1:10, or 1:10 and 1:100.
- 98 The system of any of the preceding embodiments, wherein the RNA of (a) does not comprise a nuclear localization signal.
- the polypeptide further comprises a nuclear localization signal and/or a nucleolar localization signal.
- (a) comprises an RNA that encodes: (i) the polypeptide and (ii) a nuclear localization signal and/or a nucleolar localization signal.
- the RNA comprises a pseudoknot sequence, e.g., 5’ of the heterologous object sequence.
- the RNA comprises a stem- loop sequence or a helix, 5’ of the pseudoknot sequence.
- RNA comprises one or more (e.g., 2, 3, or more) stem-loop sequences or helices 3’ of the pseudoknot sequence, e.g.3’ of the pseudoknot sequence and 5’ of the heterologous object sequence.
- the template RNA comprising the pseudoknot has catalytic activity, e.g., RNA-cleaving activity, e.g, cis-RNA-cleaving activity.
- RNA comprises at least one stem-loop sequence or helix, e.g., 3’ of the heterologous object sequence, e.g.1, 2, 3, 4, 5 or more stem-loop sequences, hairpins or helices sequences.
- the reverse transcriptase domain has an amino acid sequence of a reverse transcriptase domain of an element listed in Figure 10, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 107.
- the endonuclease domain has an amino acid sequence of an endonuclease domain of an element listed in Figure 10, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 108.
- reverse transcriptase domain has an amino acid sequence of a reverse transcriptase domain of R2NS-1_CSi, R4-1_PH, RTE-1_MD, L2-18_ACar, L2-2_DRe, Dong-1_MMa, CR1_AC_1, Vingi-1_Acar, SR2, R4- 1_AC, DongAa, CR1-1_PH, RTE-2_LMi, CR1-10_AMi, RTE-2_OL, L1-1_Cho, BovB, Line1- 2_ZM, RTE-1_Aip, CR1-3_IS, CR1-54_AAe, Tad1-65B_BG, TART-1_DWi, or RTE_Ele2 as provided herein, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- endonuclease domain has an amino acid sequence of an endonuclease domain of R2NS-1_CSi, R4-1_PH, RTE-1_MD, L2- 18_ACar, L2-2_DRe, Dong-1_MMa, CR1_AC_1, Vingi-1_Acar, SR2, R4-1_AC, DongAa, CR1-1_PH, RTE-2_LMi, CR1-10_AMi, RTE-2_OL, L1-1_Cho, BovB, Line1-2_ZM, RTE- 1_Aip, CR1-3_IS, CR1-54_AAe, Tad1-65B_BG, TART-1_DWi, or RTE_Ele2 as provided herein, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- polypeptide has an amino acid sequence of R2NS-1_CSi, R4-1_PH, RTE-1_MD, L2-18_ACar, L2-2_DRe, Dong-1_MMa, CR1_AC_1, Vingi-1_Acar, SR2, R4-1_AC, DongAa, CR1-1_PH, RTE-2_LMi, CR1-10_AMi, RTE-2_OL, L1-1_Cho, BovB, Line1-2_ZM, RTE-1_Aip, CR1-3_IS, CR1-54_AAe, Tad1- 65B_BG, TART-1_DWi, or RTE_Ele2 as provided herein, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- nucleic encoding the polypeptide comprises a coding sequence that is codon-optimized for expression in human cells.
- template RNA comprises a coding sequence that is codon-optimized for expression in human cells.
- system comprises one or more circular RNA molecules (circRNAs).
- circRNAs circular RNA molecules
- circRNA is delivered to a host cell.
- the circRNA is capable of being linearized, e.g., in a host cell, e.g., in the nucleus of the host cell.
- the circRNA comprises a cleavage site.
- the circRNA further comprises a second cleavage site. 122.
- cleavage site can be cleaved by a ribozyme, e.g., a ribozyme comprised in the circRNA (e.g., by autocleavage).
- a ribozyme e.g., a ribozyme comprised in the circRNA (e.g., by autocleavage).
- the circRNA comprises a ribozyme sequence.
- the ribozyme sequence is capable of autocleavage, e.g., in a host cell, e.g., in the nucleus of the host cell.
- the ribozyme is an inducible ribozyme.
- ribozyme is a protein- responsive ribozyme, e.g., a ribozyme responsive to a nuclear protein, e.g., a genome-interacting protein, e.g., an epigenetic modifier, e.g., EZH2. 127.
- ribozyme is a nucleic acid- responsive ribozyme. 128.
- a target nucleic acid molecule e.g., an RNA molecule, e.g., an mRNA, miRNA, ncRNA, lncRNA, tRNA, snRNA, or mtRNA.
- a target nucleic acid molecule e.g., an RNA molecule, e.g., an mRNA, miRNA, ncRNA, lncRNA, tRNA, snRNA, or mtRNA.
- the target protein localized to the cytoplasm or localized to the nucleus (e.g., an epigenetic modifier or a transcription factor).
- the ribozyme comprises the ribozyme sequence of a B2 or ALU retrotransposon, or a nucleic acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
- the ribozyme comprises the sequence of a tobacco ringspot virus hammerhead ribozyme, or a nucleic acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
- the ribozyme comprises the sequence of a hepatitis delta virus (HDV) ribozyme, or a nucleic acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
- HDV hepatitis delta virus
- ribozyme is activated by a moiety expressed in a target cell or target tissue. 135.
- ribozyme is activated by a moiety expressed in a target subcellular compartment (e.g., a nucleus, nucleolus, cytoplasm, or mitochondria).
- a target subcellular compartment e.g., a nucleus, nucleolus, cytoplasm, or mitochondria.
- the ribozyme is comprised in a circular RNA or a linear RNA.
- a system comprising a first circular RNA encoding the polypeptide of a Gene Writing system; and a second circular RNA comprising the template RNA of a Gene Writing system. 138.
- the template RNA e.g., the 5’ UTR
- the template RNA comprises a ribozyme which cleaves the template RNA (e.g., in the 5’ UTR).
- the template RNA comprises a ribozyme that is heterologous to (a)(i) (the a reverse transcriptase domain), (a)(ii) (the endonuclease domain), (b)(i) (a sequence of the template RNA that binds the polypeptide), or a combination thereof.
- heterologous ribozyme is capable of cleaving RNA comprising the ribozyme, e.g., 5’ of the ribozyme, 3’ of the ribozyme, or within the ribozyme.
- a lipid nanoparticle (LNP) comprising the system, polypeptide (or RNA encoding the same), nucleic acid molecule, or DNA encoding the system or polypeptide, of any of the preceding embodiments.
- LNP lipid nanoparticle
- a system comprising a first lipid nanoparticle comprising the polypeptide (or DNA or RNA encoding the same) of a Gene Writing system (e.g., as described herein); and a second lipid nanoparticle comprising a nucleic acid molecule of a Gene Writing System (e.g., as described herein).
- the system or polypeptide, of any of the preceding embodiments, wherein the system, nucleic acid molecule, polypeptide, and/or DNA encoding the same, is formulated as a lipid nanoparticle (LNP).
- LNP lipid nanoparticle
- the LNP of any of the preceding embodiments wherein the cationic lipid having a following structure: 146.
- the LNP of any of the preceding embodiments further comprising one or more neutral lipid, e.g., DSPC, DPPC, DMPC, DOPC, POPC, DOPE, SM, a steroid, e.g., cholesterol, and/or one or more polymer conjugated lipid, e.g., a pegylated lipid, e.g., PEG-DAG, PEG-PE, PEG-S- DAG, PEG-cer or a PEG dialkyoxypropylcarbamate. 147.
- lipid nanoparticle LNP
- lipid nanoparticle or a formulation comprising a plurality of the lipid nanoparticles
- reactive impurities e.g., aldehydes
- a preselected level of reactive impurities e.g., aldehydes
- lipid nanoparticle or a formulation comprising a plurality of the lipid nanoparticles
- the lipid nanoparticle lacks aldehydes, or comprises less than a preselected level of aldehydes.
- the lipid nanoparticle is comprised in a formulation comprising a plurality of the lipid nanoparticles.
- lipid nanoparticle formulation is produced using one or more lipid reagents comprising less than 5%, 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, or 0.1% total reactive impurity (e.g., aldehyde) content.
- lipid reagents comprising less than 5%, 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, or 0.1% total reactive impurity (e.g., aldehyde) content.
- lipid nanoparticle formulation is produced using one or more lipid reagents comprising less than 3% total reactive impurity (e.g., aldehyde) content.
- lipid nanoparticle formulation is produced using one or more lipid reagents comprising less than 5%, 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, or 0.1% of any single reactive impurity (e.g., aldehyde) species.
- lipid reagents comprising less than 5%, 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, or 0.1% of any single reactive impurity (e.g., aldehyde) species.
- lipid nanoparticle formulation is produced using one or more lipid reagent comprising less than 0.3% of any single reactive impurity (e.g., aldehyde) species.
- lipid nanoparticle formulation is produced using one or more lipid reagents comprising less than 0.1% of any single reactive impurity (e.g., aldehyde) species.
- lipid nanoparticle formulation comprises less than 5%, 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, or 0.1% total reactive impurity (e.g., aldehyde) content.
- lipid nanoparticle formulation comprises less than 3% total reactive impurity (e.g., aldehyde) content.
- lipid nanoparticle formulation comprises less than 5%, 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, or 0.1% of any single reactive impurity (e.g., aldehyde) species.
- lipid nanoparticle formulation comprises less than 0.3% of any single reactive impurity (e.g., aldehyde) species.
- lipid nanoparticle formulation comprises less than 0.1% of any single reactive impurity (e.g., aldehyde) species.
- lipid reagents used for a lipid nanoparticle as described herein or a formulation thereof comprise less than 5%, 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, or 0.1% total reactive impurity (e.g., aldehyde) content. 162.
- lipid reagents used for a lipid nanoparticle as described herein or a formulation thereof comprise less than 3% total reactive impurity (e.g., aldehyde) content. 163.
- lipid reagents used for a lipid nanoparticle as described herein or a formulation thereof comprise less than 5%, 4%, 3%, 2%, 1%, 0.9%, 0.8%, 0.7%, 0.6%, 0.5%, 0.4%, 0.3%, 0.2%, or 0.1% of any single reactive impurity (e.g., aldehyde) species. 164.
- the system, kit, or polypeptide of any of the preceding embodiments, wherein one or more, or optionally all, of the lipid reagents used for a lipid nanoparticle as described herein or a formulation thereof comprise less than 0.1% of any single reactive impurity (e.g., aldehyde) species.
- the total aldehyde content and/or quantity of reactive impurity (e.g., aldehyde) species is determined by detecting one or more chemical modifications of a nucleic acid molecule (e.g., as described herein) associated with the presence of reactive impurities (e.g., aldehydes), e.g., in the lipid reagents. 168.
- reactive impurities e.g., aldehydes
- nucleotide or nucleoside e.g., a ribonucleotide or ribonucleoside, e.g., comprised in or isolated from a nucleic acid molecule, e.g., as described herein
- reactive impurities e.g., aldehydes
- lipid reagents e.g., as described in Example 8.
- polypeptide comprises a sequence of at least 50 amino acids (e.g., at least 100, 150, 200, 300, 500 amino acids) having at least 80% identity (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identity) to a sequence of a polypeptide encoded by a sequence of an element of Table 10, Table 11, or Table X, or a reverse transcriptase domain or endonuclease domain thereof. 171.
- polypeptide comprises a sequence of at least 50 amino acids (e.g., at least 100, 150, 200, 300, 500 amino acids) having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 amino acid differences to a sequence of a polypeptide encoded by a sequence of an element of Table 10, Table 11, or Table X, or a reverse transcriptase domain or endonuclease domain thereof. 172.
- amino acids e.g., at least 100, 150, 200, 300, 500 amino acids
- polypeptide comprises a sequence of at least 50 amino acids (e.g., at least 100, 150, 200, 300, 500 amino acids) having at least 80% identity (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identity) to a sequence of a polypeptide listed in Table 3A or 3B or a reverse transcriptase domain, endonuclease domain, or DNA binding domain thereof. 173.
- polypeptide comprises a sequence of at least 50 amino acids (e.g., at least 100, 150, 200, 300, 500 amino acids) having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 amino acid differences to a sequence of a polypeptide listed in Table 3A or 3B or a reverse transcriptase domain, endonuclease domain, or DNA binding domain thereof. 174.
- amino acids e.g., at least 100, 150, 200, 300, 500 amino acids
- polypeptide comprises a sequence of at least 50 amino acids (e.g., at least 100, 150, 200, 300, 500 amino acids) having at least 80% identity (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identity) to the amino acid sequence of column 7 of Table 3A or 3B, or a reverse transcriptase domain, endonuclease domain, or DNA binding domain thereof. 175.
- amino acids e.g., at least 100, 150, 200, 300, 500 amino acids
- at least 80% identity e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identity
- polypeptide comprises a sequence of at least 50 amino acids (e.g., at least 100, 150, 200, 300, 500 amino acids) having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 amino acid differences to the amino acid sequence of column 7 of Table 3A or 3B, or a reverse transcriptase domain, endonuclease domain, or DNA binding domain thereof. 176.
- amino acids e.g., at least 100, 150, 200, 300, 500 amino acids
- the template RNA comprises a sequence of an element of Table 10 or Table X (e.g., one or both of a 5’ UTR of Table X or 10 and a 3’ UTR of Table X or 10), or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 177.
- the template RNA comprises a sequence of an element of Table 10 or Table X (e.g., one or both of a 5’ UTR of Table X or 10 and a 3’ UTR of Table X or 10), or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 178.
- the template RNA comprises a sequence of Table 3A or 3B (e.g., one or both of a 5’ UTR of column 5 of Table 3A or 3B and a 3’ UTR of column 6 of Table 3A or 3B), or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 179.
- the template RNA comprises a sequence of Table 3A or 3B (e.g., one or both of a 5’ UTR of column 5 of Table 3A or 3B and a 3’ UTR of column 6 of Table 3A or 3B), or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 180.
- the template RNA comprises a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to: (i) the nucleotides located 5’ relative to a start codon of a sequence of an element of Table 10 or Table X (e.g., comprising a retrotransposase-binding region). 181.
- the template RNA comprises a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to: (i) the nucleotides located 3’ relative to a stop codon of a sequence of an element of Table 10 or Table X (e.g., comprising a retrotransposase-binding region). 182.
- the template RNA comprises a sequence of about 100-125 bp from a 3’ UTR of Table 10 or 11 or column 6 of Table 3A or 3B, e.g., wherein the sequence comprises nucleotides 1-100, 101-200, or 201-325 of the 3’ UTR of column 6 of Table 3A or 3B, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 183.
- the template RNA comprises a sequence of about 100-125 bp from a 3’ UTR of Table 10 or 11 or column 6 of Table 3A or 3B, e.g., wherein the sequence comprises nucleotides 1-100, 101-200, or 201-325 of the 3’ UTR of column 6 of Table 3A or 3B, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom.
- (a) comprises RNA and (b) comprises RNA.
- Any above-numbered system which comprises only RNA, or which comprises more RNA than DNA by an RNA:DNA ratio of at least 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1, 90:1, or 100:1.
- Any above-numbered system which does not comprise DNA, or which does not comprise more than 10%, 5%, 4%, 3%, 2%, or 1% DNA by mass or by molar amount.
- Any above-numbered system which is capable of modifying DNA by insertion of the heterologous object sequence via target primed reverse transcription.
- Any above-numbered system which is capable of modifying DNA by insertion of a heterologous object sequence in the presence of an inhibitor of a DNA repair pathway (e.g., SCR7, a PARP inhibitor), or in a cell line deficient for a DNA repair pathway (e.g., a cell line deficient for the nucleotide excision repair pathway or the homology-directed repair pathway).
- a DNA repair pathway e.g., SCR7, a PARP inhibitor
- a cell line deficient for a DNA repair pathway e.g., a cell line deficient for the nucleotide excision repair pathway or the homology-directed repair pathway.
- Any above-numbered system which does not cause formation of a detectable level of double stranded breaks in a target cell.
- Any above-numbered system which is capable of modifying DNA using reverse transcriptase activity, and optionally in the absence of homologous recombination activity. 192.
- the template RNA (or DNA encoding the template RNA) comprises a first homology domain having at least 5 or at least 10 bases of 100% identity to a target DNA strand, at the 5’ end of the template RNA, and a second homology domain having at least 5 or at least 10 bases of 100% identity to a target DNA strand, at the 3’ end of the template RNA.
- a and (b) are part of the same nucleic acid.
- 196 The system of any of the preceding embodiments, wherein (a) and (b) are separate nucleic acids. 197.
- the template RNA comprises at least 5 or at least 10 bases of 100% identity to a target DNA strand (e.g., wherein the target DNA strand is a human DNA sequence), at the 5’ end of the template RNA.
- the template RNA comprises at least 5 or at least 10 bases of 100% identity to a target DNA strand (e.g., wherein the target DNA strand is a human DNA sequence), at the 3’ end of the template RNA.
- the polypeptide comprises an active RNase H domain. 200.
- polypeptide does not comprise an active RNase H domain.
- an endogenous RNase H domain of the polypeptide is inactivated.
- transposase polypeptide comprises a mutation inactivating and/or deleting a nucleolar localization signal.
- polypeptide does not comprise a functional nucleolar localization signal, e.g., does not comprise a nucleolar localization signal.
- nucleolar localization signal activity of the nucleolar localization signal is reduced by at least 50%, 60%, 70%, 80%, 90%, 95%, or 99%.
- polypeptide comprises a nuclear localization signal (NLS), e.g., an endogenous NLS or an exogenous NLS.
- NLS nuclear localization signal
- the polypeptide comprises (i) a first target DNA binding domain, e.g., comprising a first Zn finger domain, (ii) a reverse transcriptase domain, (iii) an endonuclease domain, and (iv) a second target DNA binding domain, e.g., comprising a second Zn finger domain, heterologous to the first target DNA binding domain; and wherein (a) binds to a smaller number of target DNA sequences in a target cell than a similar polypeptide that comprises only the first target DNA binding domain, e.g., wherein the presence of the second target DNA binding domain in the polypeptide with the first DNA binding domain refines the target sequence specificity of the polypeptide relative to the polypeptide target sequence specificity of the polypeptide comprising only the first target DNA binding domain.
- a first target DNA binding domain e.g., comprising a first Zn finger domain
- a reverse transcriptase domain e.g., a reverse transcriptase domain
- the second target DNA binding domain binds to a genomic DNA sequence that is 1-100, 1-90, 1-80, 1-70, 1-60, 1-50, 1- 40, 1-30, 1-20, 1-10, 1-5, 5-100, 5-90, 5-80, 5-70, 5-60, 5-50, 5-40, 5-30, 5-20, 5-10, 10-100, 10- 90, 10-80, 10-70, 10-60, 10-50, 10-40, 10-30, 10-20, 20-100, 20-90, 20-80, 20-70, 20-60, 20-50, 20-40, 20-30, 30-100, 30-90, 30-80, 30-70, 30-60, 30-50, 30-40, 40-100, 40-90, 40-80, 40-70, 40-60, 40-50, 50-100, 50-90, 50-80, 50-70, 50-60, 60-100, 60-90, 60-80, 60-70, 70-100, 70-90, 70-80, 80-100, 80-90, or 90-100 nucleotides
- the first or second target DNA binding domain comprises a CRISPR/Cas protein, a TAL Effector domain, a Zn finger domain, or a meganuclease domain.
- the system is capable of cutting the first strand of the target DNA at least twice (e.g., twice), and optionally wherein the cuts are at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, or 200 nucleotides away one another (and optionally no more than 500, 400, 300, 200, or 100 nucleotides away from one another).
- the system is capable of cutting the first strand of the target DNA at least twice (e.g., twice), and optionally wherein the cuts are at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, or 200 nucleotides away one another (and optionally no more than 500, 400, 300, 200, or 100 nucleotides away from one another).
- the system is capable of cutting the first strand and the second strand of the target DNA, and wherein the distance between the cuts is the same as the distance between cuts made by the reverse transcriptase domain, e.g., the reverse transcriptase domain when situated in its endogenous polypeptide. 213.
- any of the preceding embodiments wherein the cuts are 1-500, 1-400, 1- 300, 1-200, 1-100, 1-90, 1-80, 1-70, 1-60, 1-50, 1-40, 1-30, 1-20, 1-10, 1-5, 5-500, 5-400, 5-300, 5-200, 5-100, 5-90, 5-80, 5-70, 5-60, 5-50, 5-40, 5-30, 5-20, 5-10, 10-500, 10-400, 10-300, 10- 200, 10-100, 10-90, 10-80, 10-70, 10-60, 10-50, 10-40, 10-30, 10-20, 20-500, 20-400, 20-300, 20-200, 20-100, 20-90, 20-80, 20-70, 20-60, 20-50, 20-40, 20-30, 30-500, 30-400, 30-300, 30- 200, 30-100, 30-90, 30-80, 30-70, 30-80, 30-70, 30-80, 30-70, 30-80, 30-70, 30-80, 30-70, 30-80, 30-70, 30-80, 30-70, 30-80, 30-70, 30-80, 30-70,
- the first endonuclease domain e.g., nickase
- the second endonuclease domain e.g., nickase
- the first endonuclease domain makes one of the two cuts to the to-be- edited strand of the target DNA
- the second endonuclease domain e.g., nickase
- the template RNA (or DNA encoding the template RNA) comprises (i) a sequence that binds the polypeptide, (ii) a heterologous object sequence, and (iii) a ribozyme that is heterologous to (a)(i), (a)(ii), (b)(i), or a combination thereof. 221.
- (a), (b), or (a) and (b) comprise an intron that increases the expression of the polypeptide, the heterologous object sequence (e.g., a coding sequence situated in the heterologous object sequence), or both.
- a host cell e.g., a mammalian cell, e.g., a human cell
- a method of modifying a target DNA strand in a cell, tissue or subject comprising administering any preceding numbered system to the cell, tissue or subject, wherein the system reverse transcribes the template RNA sequence into the target DNA strand, thereby modifying the target DNA strand.
- the cell, tissue or subject is a mammalian (e.g., human) cell, tissue or subject.
- the tissue is liver, lung, skin, blood, immune, or muscle tissue. 226.
- the cell is a fibroblast. 227.
- the method of any of the preceding embodiments, wherein the cell is a primary cell. 228.
- the method of any of the preceding embodiments, where in the cell is not immortalized. 229.
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence encoded by a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a reverse transcriptase domain e.g.,
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a hetero
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence; wherein the sequence of the template RNA that binds the polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a 5’ UTR sequence or a 3’ UTR sequence of a sequence of an element of Table 3B
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence; wherein the sequence of the template RNA that binds the polypeptide has at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to: (i) the nucleotides located 5’ relative to a start codon of a sequence of an element
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain from a protein other than a retrotransposase, e.g., from a retrovirus, e.g., reverse transcriptase domain as listed in Table Z1 or Z2, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (ii) an endonuclease domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a polypeptide or a nucleic acid e.g., DNA or mRNA
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid (e.g., DNA or mRNA) encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain from a protein other than a retrotransposase, e.g., from a retrovirus, e.g., reverse transcriptase domain as listed in Table Z1 or Z2, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (ii) an endonuclease domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence.
- a polypeptide or a nucleic acid e.g., DNA or mRNA
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence; and (c) an intein. 238.
- a reverse transcriptase domain e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2
- the polypeptide comprises the intein. 239.
- the polypeptide does not comprise a target DNA binding domain.
- the method of any of the preceding embodiments, wherein the polypeptide is derived from an APE-type retrotransposon reverse transcriptase. 242.
- the polypeptide further comprises a target DNA binding domain, e.g., having an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 243.
- a target DNA binding domain e.g., having an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the polypeptide further comprises a target DNA binding domain, e.g., having an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 244.
- the polypeptide further comprises a target DNA binding domain, e.g., having an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 245.
- the polypeptide further comprises a target DNA binding domain, e.g., having an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 246.
- a target DNA binding domain e.g., having an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 246.
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) an RNA encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (b) a template RNA comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence, wherein the method does not comprise contacting the ma
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) an RNA encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (b) a template RNA comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence, wherein the method does not comprise contacting the mamma
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) an RNA encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (b) a template RNA comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence, wherein the method does not comprise contacting the mammalian
- a method of modifying the genome of a mammalian cell comprising contacting the cell with: (a) an RNA encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (b) a template RNA comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence, wherein the method does not comprise contacting the mammalian cell with DNA, or where
- the method of any of the preceding embodiments which results in the addition of a protein coding sequence to the genome of the mammalian cell. 254. The method of any of the preceding embodiments, which results in the deletion of a protein coding sequence to the genome of the mammalian cell. 255. The method of any of the preceding embodiments, which results in the alteration of a protein coding sequence to the genome of the mammalian cell. 256. The method of any of the preceding embodiments, which results in the addition of a non- coding sequence to the genome of the mammalian cell, e.g., encoding a non-coding RNA, e.g., a miRNA. 257.
- any of the preceding embodiments which results in the deletion of a non- coding sequence to the genome of the mammalian cell, e.g., encoding a non-coding RNA, e.g., a miRNA. 258.
- the method of any of the preceding embodiments which results in the alteration of a non-coding sequence to the genome of the mammalian cell, e.g., encoding a non-coding RNA, e.g., a miRNA. 259.
- the method of any of the preceding embodiments which results in the addition of a regulatory sequence to the genome of the mammalian cell, e.g., a promoter, an enhancer, a miRNA binding site. 260.
- the method of any of the preceding embodiments which results in the deletion of a regulatory sequence to the genome of the mammalian cell, e.g., a promoter, an enhancer, a miRNA binding site. 261.
- the method of any of the preceding embodiments which results in the alteration of a regulatory sequence to the genome of the mammalian cell, e.g., a promoter, an enhancer, a miRNA binding site. 262.
- the method of any of the preceding embodiments, wherein the addition, deletion, or alteration of the regulatory sequence to the genome of the mammalian cell results in increased expression of a coding or non-coding sequence in the genome of the mammalian cell. 263.
- a method of inserting DNA into the genome of a mammalian cell comprising contacting the cell with an RNA composition, wherein the RNA composition comprises: (a) a first RNA that directs insertion of a template RNA into the genome, and (b) a template RNA comprising a heterologous sequence, wherein the method does not comprise contacting the mammalian cell with DNA, or wherein the compositions of (a) and (b) do not comprise more than 1%, 0.5%, 0.2%, 0.1%, 0.05%, 0.02%, or 0.01% DNA by mass or by molar amount of nucleic acid, wherein the method results in the addition of at least 1, 5, 10, 20, 50, 100, 200, 500, 1,000, 2,000, or 5,000 base pairs of DNA (e
- a method of inserting DNA into the genome of a mammalian cell comprising contacting the cell with an RNA composition, wherein the RNA composition comprises: (a) a first RNA that directs insertion of a template RNA into the genome, and (b) a template RNA comprising a heterologous sequence, wherein the method does not comprise contacting the mammalian cell with DNA, or wherein the compositions of (a) and (b) do not comprise more than 1%, 0.5%, 0.2%, 0.1%, 0.05%, 0.02%, or 0.01% DNA by mass or by molar amount of nucleic acid, wherein the method results in the addition of at least 1, 5, 10, 20, 50, 100, 200, 500, 1,000, 2,000, or 5,000 base pairs of DNA (e.g., exogenous DNA) sequence to the genome of the mammalian cell; and wherein the first RNA encodes a polypeptide encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a
- a method of inserting DNA into the genome of a mammalian cell comprising contacting the cell with an RNA composition, wherein the RNA composition comprises: (a) a first RNA that directs insertion of a template RNA into the genome, and (b) a template RNA comprising a heterologous sequence, wherein the method does not comprise contacting the mammalian cell with DNA, or wherein the compositions of (a) and (b) do not comprise more than 1%, 0.5%, 0.2%, 0.1%, 0.05%, 0.02%, or 0.01% DNA by mass or by molar amount of nucleic acid, wherein the method results in the addition of at least 5, 10, 20, 50, 100, 200, 500, 1,000, 2,000, or 5,000 base pairs of DNA (e.g., exogenous DNA) sequence to the genome of the mammalian cell; and wherein the first RNA encodes a polypeptide of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%,
- a method of inserting DNA into the genome of a mammalian cell comprising contacting the cell with an RNA composition, wherein the RNA composition comprises: (a) a first RNA that directs insertion of a template RNA into the genome, and (b) a template RNA comprising a heterologous sequence, wherein the method does not comprise contacting the mammalian cell with DNA, or wherein the compositions of (a) and (b) do not comprise more than 1%, 0.5%, 0.2%, 0.1%, 0.05%, 0.02%, or 0.01% DNA by mass or by molar amount of nucleic acid, wherein the method results in the addition of at least 5, 10, 20, 50, 100, 200, 500, 1,000, 2,000, or 5,000 base pairs of DNA (e.g., exogenous DNA) sequence to the genome of the mammalian cell; and wherein the first RNA encodes a polypeptide of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having no more than 10,
- a method of inserting DNA into the genome of a mammalian cell comprising contacting the cell with an RNA composition, wherein the RNA composition comprises: (a) a first RNA that directs insertion of a template RNA into the genome, and (b) a template RNA comprising a heterologous sequence and (i) a flanking sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a 5’ UTR sequence of a sequence of an element of Table 3B, Table 10, or Table X, and/or (ii) a flanking sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a 3’ UTR sequence of a sequence of an element of Table 3B, Table 10, or Table X, wherein the method does not comprise contacting the mammalian cell with DNA, or wherein the compositions of (a) and (b) RNA
- a method of inserting DNA into the genome of a mammalian cell comprising contacting the cell with an RNA composition, wherein the RNA composition comprises: (a) a first RNA that directs insertion of a template RNA into the genome, and (b) a template RNA comprising a heterologous sequence and (i) a flanking sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the nucleotides located 5’ relative to a start codon of a sequence of an element of Table 3B, Table 10, or Table X (e.g., comprising a retrotransposase-binding region), and/or (ii) a flanking sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to the nucleotides located 3’ relative to a stop codon of a sequence of an element of Table 3B, Table
- the template RNA further comprises a sequence that binds the polypeptide; optionally wherein the sequence that binds the polypeptide has: (a) at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a 5’ UTR sequence or a 3’ UTR sequence of a sequence of an element of Table 3B, Table 10, or Table X; or (b) at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to: (i) the nucleotides located 5’ relative to a start codon of a sequence of an element of Table 3B, Table 10, or Table X (e.g., comprising a retrotransposase-binding region), or (ii) the nucleotides located 3’ relative to a stop codon of a sequence of an element of Table X (e.g.
- RNA of (a) and the RNA of (b) are covalently linked, e.g., are part of the same transcript. 279.
- RNA of (a) and the RNA of (b) are separate RNAs. 280.
- a method of modifying the genome of a human cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a
- a method of modifying the genome of a human cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous
- a method of modifying the genome of a human cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object
- a method of modifying the genome of a human cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table Table 3B, Table 10, Table 11, Table X, or Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; wherein one, two, or three of (i), (ii), and/or (iii) have an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide and (ii) a heterologous object sequence, wherein the
- a method of modifying the genome of a human cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a 5’ UTR sequence or a 3’ UTR sequence of a sequence of an element of Table 3B, Table 10, Table 11, or Table X, and (ii) a heterologous object sequence, wherein the method results in insertion of the heterogon
- a method of modifying the genome of a human cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain (e.g., as listed in Table 3B, Table 10, Table 11, Table X, or Table Z1 or Z2), (ii) an endonuclease domain, and optionally (iii) a DNA-binding domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (i) a sequence that binds the polypeptide having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to: (i) the portion of a sequence of an element of Table 3B, Table 10, or Table X consisting of the nucleotides located 5’ relative to the start codon, or (ii) the portion of a sequence of an element of Table
- a method of adding an exogenous coding region to the genome of a cell comprising contacting the cell with: (i) an RNA comprising the non-coding strand of the exogenous coding region, wherein optionally the RNA does not comprise a coding strand of the exogenous coding region, and (ii) a polypeptide comprising a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, wherein optionally the delivery comprises non-viral delivery. 288.
- a method of adding an exogenous coding region to the genome of a cell comprising contacting the cell with: (i) an RNA comprising the non-coding strand of the exogenous coding region, wherein optionally the RNA does not comprise a coding strand of the exogenous coding region, and (ii) a polypeptide comprising a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, wherein optionally the delivery comprises non-viral delivery.
- a method of expressing a polypeptide of interest in a cell comprising contacting the cell with: (i) an RNA, wherein the RNA comprises a non-coding strand that is the reverse complement of a sequence that would encoding the polypeptide of interest, wherein optionally the RNA does not comprise a coding strand encoding the polypeptide of interest, and (ii) and a retrotransposase polypeptide comprising an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, wherein optionally the delivery comprises non-viral delivery.
- a method of expressing a polypeptide of interest in a cell comprising contacting the cell with: (i) an RNA, wherein the RNA comprises a non-coding strand that is the reverse complement of a sequence that would encoding the polypeptide of interest, wherein optionally the RNA does not comprise a coding strand encoding the polypeptide of interest, and (ii) and a retrotransposase polypeptide comprising an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, wherein optionally the delivery comprises non-viral delivery.
- a method of expressing a polypeptide of interest in a cell comprising contacting the cell with: (i) an RNA, wherein the RNA comprises a non-coding strand that is the reverse complement of a sequence that would encoding the polypeptide of interest, wherein optionally the RNA does not comprise a coding strand encoding the polypeptide of interest, and (ii) a retrotransposase polypeptide comprising an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, wherein optionally the delivery comprises non-viral delivery.
- a method of expressing a polypeptide of interest in a cell comprising contacting the cell with: (i) an RNA, wherein the RNA comprises a non-coding strand that is the reverse complement of a sequence that would encoding the polypeptide of interest, wherein optionally the RNA does not comprise a coding strand encoding the polypeptide of interest, and (ii) a retrotransposase polypeptide comprising an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, wherein optionally the delivery comprises non-viral delivery.
- a retrotransposase polypeptide comprising an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X, or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleot
- the mammalian cell is euploid, is not immortalized, is part of an organism, is a primary cell, is non-dividing, is a hepatocyte, or is from a subject having a genetic disease. 299.
- the method of any of the preceding embodiments, wherein the mammalian cell is in a subject does not have a disease, e.g., for supplementing the genome of the subject.
- the contacting comprises contacting the cell with a plasmid, virus, viral-like particle, virosome, liposome, vesicle, exosome, fusosome, or lipid nanoparticle. 301.
- any of the preceding embodiments wherein the contacting comprises using non-viral delivery.
- the method of any of the preceding embodiments which comprises comprising contacting the cell with the template RNA (or DNA encoding the template RNA), wherein the template RNA comprises the non-coding strand of an exogenous coding region, wherein optionally the template RNA does not comprise a coding strand of the exogenous coding region, wherein optionally the delivery comprises non-viral delivery, thereby adding the exogenous coding region to the genome of the cell.
- the template RNA or DNA encoding the template RNA
- any of the preceding embodiments which comprises contacting the cell with the template RNA (or DNA encoding the template RNA), wherein the template RNA comprises a non-coding strand that is the reverse complement of a sequence encoding the polypeptide, wherein optionally the template RNA does not comprise a coding strand encoding the polypeptide, wherein optionally the delivery comprises non-viral delivery, thereby adding the exogenous coding region to the genome of the cell and expressing the polypeptide in the cell.
- the contacting comprises administering (a) and (b) to a subject, e.g., intravenously.
- the contacting comprises administering a dose of (a) and (b) to a subject at least twice. 306.
- the method of any of the preceding embodiments, wherein (a) and (b) are administered together.
- the nucleic acid of (a) is not integrated into the genome of the host cell. 310.
- tissue is liver, lung, skin, muscle tissue (e.g., skeletal muscle), eye or ocular tissue, or central nervous system. 311.
- cell is a hematopoietic stem cell (HSC), a T-cell, or a Natural Killer (NK) cell. 312.
- any preceding numbered method wherein the sequence that binds the polypeptide has one or more of the following characteristics: (a) is at the 3’ end of the template RNA; (b) is at the 5’ end of the template RNA; (b) is a non-coding sequence; (c) is a structured RNA; (d) forms at least 1 hairpin loop structures; and/or (e) is a guide RNA. 313. Any preceding numbered method, wherein the template RNA further comprises a sequence comprising at least 20 nucleotides of at least 80% identity (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identity) to a target DNA strand. 314.
- the template RNA further comprises a sequence comprising at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150 nucleotides of at least 80% identity (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identity) to a target DNA strand. 315.
- any preceding numbered method wherein the sequence comprising at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150 nucleotides, or about: 2-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 10-100, or 2-100 nucleotides, of at least 80% identity to a target DNA strand is at the 3’ end of the template RNA. 316.
- the template RNA further comprises a sequence comprising at least 100 nucleotides of at least 80% identity (e.g., at least 85%, 90%, 95%, 97%, 98%, 99%, 100% identity) to a target DNA strand, e.g., at the 3’ end of the template RNA. 317.
- the site in the target DNA strand to which the sequence comprises at least 80% identity is proximal to (e.g., within about: 0-10, 10-20, 20-30, 30-50, or 50-100 nucleotides of) a target site on the target DNA strand that is recognized (e.g., bound and/or cleaved) by the polypeptide comprising the endonuclease. 318.
- the target RNA comprises a homology domain that comprises a sequence according to a 3’ homology arm of Table 11, or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 319.
- the target RNA comprises a homology domain that comprises a sequence according to a 5’ homology arm of Table 11, or a sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 320.
- any preceding numbered method wherein the sequence comprising at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150 nucleotides, or about: 2-10, 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, 90-100, 10-100, or 2-100 nucleotides, of at least 80% identity to a target DNA strand is at the 3’ end of the template RNA; optionally wherein the site in the target DNA strand to which the sequence comprises at least 80% identity is proximal to (e.g., within about: 0-10, 10-20, or 20-30 nucleotides of) a target site on the target DNA strand that is recognized (e.g., bound and/or cleaved) by the polypeptide comprising the endonuclease.
- the target site is the site in the human genome that has the closest identity to a native target site of the polypeptide comprising the endonuclease, e.g., wherein the target site in the human genome has at least about: 16, 17, 18, 19, or 20 nucleotides identical to the native target site.
- the template RNA has at least 3, 4, 5, 6, 7, 8, 9, or 10 bases of 100% identity to the target DNA strand.
- Any preceding numbered method, wherein the at least 3, 4, 5, 6, 7, 8, 9, or 10 bases of 100% identity to the target DNA strand are at the 3’ end of the template RNA. 324.
- any preceding numbered method wherein the at least 3, 4, 5, 6, 7, 8, 9, or 10 bases of 100% identity to the target DNA strand are at the 5’ end of the template RNA. 325. Any preceding numbered method, wherein the template RNA comprises at least 3, 4, 5, 6, 7, 8, 9, or 10 bases of 100% identity to the target DNA strand at the 5’ end of the template RNA and at least 3, 4, 5, 6, 7, 8, 9, or 10 bases of 100% identity to the target DNA strand at the 3’ end of the template RNA. 326.
- any preceding numbered method, wherein the heterologous object sequence is between 50-50,000 base pairs (e.g., between 50-40,000 bp, between 500-30,000 bp between 500-20,000 bp, between 100-15,000 bp, between 500-10,000 bp, between 50-10,000 bp, between 50-5,000 bp). 327. Any preceding numbered method, wherein the heterologous object sequence is at least 1, 10, 25, 50, 100, 150, 200, 250, 300, 400, 500, 600, or 700 bp. 328. Any preceding numbered method, wherein the heterologous object sequence is at least 715, 750, 800, 950, 1,000, 2,000, 3,000, or 4,000 bp. 329.
- any preceding numbered method, wherein the heterologous object sequence is less than 5,000, 10,000, 15,000, 20,000, 30,000, or 40,000 bp. 330. Any preceding numbered method, wherein the heterologous object sequence is less than 700, 600, 500, 400, 300, 200, 150, or 100 bp. 331.
- the heterologous object sequence comprises one or more of: (a) an open reading frame, e.g., a sequence encoding a polypeptide, e.g., an enzyme (e.g., a lysosomal enzyme), a membrane protein, a blood factor, an exon, an intracellular protein (e.g., a cytoplasmic protein, a nuclear protein, an organellar protein such as a mitochondrial protein or lysosomal protein), an extracellular protein, a structural protein, a signaling protein, a regulatory protein, a transport protein, a sensory protein, a motor protein, a defense protein, a storage protein, or an immune receptor protein (e.g., a chimeric antigen receptor (CAR) protein, a T cell receptor, a B cell receptor), or an antibody; (b) a non-coding and/or regulatory sequence, e.g., a sequence that binds a transcriptional modulator, e.g.
- an enzyme e.g
- any preceding numbered method, wherein the target DNA is a genomic safe harbor (GSH) site.
- GSH genomic safe harbor
- Any preceding numbered method, wherein the target DNA is a genomic Natural Harbor TM site.
- Any preceding numbered method which results in about 25-100%, 50-100%, 60-100%, 70-100%, 75-95%, 80%-90%, of integrants into a target site in the genome being non-truncated, as measured by an assay described herein, e.g., an assay of Example 6 of PCT Application No. PCT/US2019/048607. 336. Any preceding numbered method, which results in insertion of the heterologous object sequence only at one target site in the genome of the cell. 337.
- any preceding numbered method which results in insertion of the heterologous object sequence into a target site in a cell, wherein the inserted heterologous sequence comprises less than 10%, 5%, 2%, 1%, 0.5%, 0.2%, or 0.1% mutations (e.g., SNPs or one or more deletions, e.g., truncations or internal deletions) relative to the heterologous sequence prior to insertion, e.g., as measured by an assay of Example 12 of PCT Application No. PCT/US2019/048607. 338.
- mutations e.g., SNPs or one or more deletions, e.g., truncations or internal deletions
- any preceding numbered method which results in insertion of the heterologous object sequence into a target site in a plurality of cells, wherein less than 10%, 5%, 2%, or 1% of copies of the inserted heterologous sequence comprise a mutation (e.g., a SNP or a deletion, e.g., a truncation or an internal deletion), e.g., as measured by an assay of Example 12 of PCT Application No. PCT/US2019/048607. 339.
- a mutation e.g., a SNP or a deletion, e.g., a truncation or an internal deletion
- any preceding numbered method which results in insertion of the heterologous object sequence into a target cell genome, and wherein the target cell does not show upregulation of p53, or shows upregulation of p53 by less than 50%, 25%, 10%, 5%, 2%, or 1%, e.g., wherein upregulation of p53 is measured by p53 protein level, e.g., according to the method described in Example 30, or by the level of p53 phosphorylated at Ser15 and Ser20. 340.
- any preceding numbered method which results in insertion of the heterologous object sequence into a target cell genome, and wherein the target cell does not show upregulation of any DNA repair genes and/or tumor suppressor genes, or wherein no DNA repair gene and/or tumor suppressor gene is upregulated by more than 50%, 25%, 10%, 5%, 2%, or 1%, e.g., wherein upregulation is measured by RNA-seq. 341.
- any preceding numbered method which results in insertion of the heterologous object sequence into the target site (e.g., at a copy number of 1 insertion or more than one insertion) in about 1-80% of cells in a population of cells contacted with the system, e.g., about: 1-10%, 10- 20%, 20-30%, 30-40%, 40-50%, 50-60%, 60-70%, or 70-80% of cells, e.g., as measured using single cell ddPCR, e.g., as described in Example 17. 342.
- any preceding numbered method which results in insertion of the heterologous object sequence into the target site at a copy number of 1 insertion in about 1-80% of cells in a population of cells contacted with the system, e.g., about: 1-10%, 10-20%, 20-30%, 30-40%, 40- 50%, 50-60%, 60-70%, or 70-80% of cells, e.g., as measured using colony isolation and ddPCR, e.g., as described in Example 18. 343.
- any preceding numbered method which results in insertion of the heterologous object sequence into the target site (on-target insertions) at a higher rate that insertion into a non-target site (off-target insertions) in a population of cells, wherein the ratio of on-target insertions to off- target insertions is greater than 10:1, 20:1, 30:1, 40:1, 50:1, 60:1, 70:1, 80:1.90:1, 100:1, 200:1, 500:1, or 1,000:1, e.g., using an assay of Example 11 of PCT Application No. PCT/US2019/048607. 344.
- any above-numbered method which results in insertion of a heterologous object sequence in the presence of an inhibitor of a DNA repair pathway (e.g., SCR7, a PARP inhibitor), or in a cell line deficient for a DNA repair pathway (e.g., a cell line deficient for the nucleotide excision repair pathway or the homology-directed repair pathway).
- an inhibitor of a DNA repair pathway e.g., SCR7, a PARP inhibitor
- a cell line deficient for a DNA repair pathway e.g., a cell line deficient for the nucleotide excision repair pathway or the homology-directed repair pathway.
- any preceding numbered system formulated as a pharmaceutical composition.
- a pharmaceutically acceptable carrier e.g., a vesicle, a liposome, a natural or synthetic lipid bilayer, a lipid nanoparticle, an exosome.
- Any preceding numbered method which results in a plurality of (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, or 10) insertions of a heterologous object sequence into a target cell genome. 349. The method of any of the preceding embodiments, wherein the plurality of insertions occur simultaneously or sequentially. 350. Any preceding numbered method, which results in a plurality of (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, or 10) deletions of a heterologous object sequence into a target cell genome. 351. The method of any of the preceding embodiments, wherein the plurality of deletions occur simultaneously or sequentially. 352.
- Any preceding numbered method which results in a plurality of (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, or 10) base changes of a heterologous object sequence into a target cell genome. 353. The method of any of the preceding embodiments, wherein the plurality of base changes occur simultaneously or sequentially. 354. Any preceding numbered method, comprising contacting the cell with a plurality of distinct template RNAs each comprising a heterologous object sequence. 355. The method ofany of the preceding embodiments, wherein the distinct template RNAs comprise at least two (e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, or 10) distinct heterologous object sequences. 356.
- any preceeding numbered embodiment, wherein the one or more previous modifications are selected from gene knockouts, e.g., of an endogenous TCR (e.g., TRAC, TRBC), HLA Class I (B2M), PD1, CD52, CTLA-4, TIM-3, LAG-3, or DGK. 361. Any preceding numbered embodiment, wherein the heterologous object sequence comprises a TCR or a CAR. 362.
- a method of making a system for modifying the genome of a mammalian cell comprising: a) providing a template RNA comprising (i) a sequence that binds a polypeptide comprising a reverse transcriptase domain and an endonuclease domain, the sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to a 5’ UTR sequence or a 3’ UTR sequence of a sequence of an element of Table X; and (ii) a heterologous object sequence. 363.
- any of the preceding embodiments further comprising: b) treating the template RNA to reduce secondary structure, e.g., heating the template RNA, e.g., to at least 70, 75, 80, 85, 90, or 95 C, and/orc) subsequently cooling the template RNA, e.g., to a temperature that allows for secondary structure, e.g, to less than or equal to 37, 30, 25, or 20 C. 364.
- a method of making a system for modifying DNA comprising: (a) providing a template nucleic acid (e.g., a template RNA or DNA) comprising a heterologous homology sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% homology to a sequence comprised in a target DNA molecule, and/or (b) providing a polypeptide of the system (e.g., comprising a DNA-binding domain (DBD) and/or an endonuclease domain) comprising a heterologous targeting domain that binds specifically to a sequence comprised in the target DNA molecule.
- a template nucleic acid e.g., a template RNA or DNA
- a heterologous homology sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% homology to a sequence comprised in a target DNA molecule
- a polypeptide of the system e.g., comprising
- the introducing of (a) comprises inserting the homology sequence into the template nucleic acid. 367.
- the method of any of the preceding embodiments, wherein the introducing of (a) comprises replacing a segment of the template nucleic acid with the homology sequence. 368.
- the method of any of the preceding embodiments, wherein the introducing of (a) comprises mutating one or more nucleotides (e.g., at least 2, 3, 4, 5, 10, 15, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, or 100 nucleotides) of the template nucleic acid, thereby producing a segment of the template nucleic acid having the sequence of the homology sequence. 369.
- the introducing of (b) comprises inserting the amino acid sequence of the targeting domain into the amino acid sequence of the polypeptide. 370. The method of any of the preceding embodiments, wherein the introducing of (b) comprises inserting a nucleic acid sequence encoding the targeting domain into a coding sequence of the polypeptide comprised in a nucleic acid molecule. 371. The method of any of the preceding embodiments, wherein the introducing of (b) comprises replacing at least a portion of the polypeptide with the targeting domain. 372.
- the introducing of (a) comprises mutating one or more amino acids (e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 400, 500, or more amino acids) of the polypeptide. 373.
- amino acids e.g., at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 400, 500, or more amino acids
- a method for modifying a target site in genomic DNA in a cell comprising contacting the cell with: (a) a polypeptide or a nucleic acid encoding the polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain; and (b) a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence that binds the target site (e.g., a second strand of a site in a target genome), (ii) optionally a sequence that binds the polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ target homology domain, wherein: (i) the polypeptide comprises a heterologous targeting domain (e.
- a method of making a system for modifying the genome of a mammalian cell comprising: a) providing a template RNA comprising (i) a sequence that binds a polypeptide comprising a reverse transcriptase domain and an endonuclease domain, the sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identity to: (i) the nucleotides located 5’ relative to a start codon of a sequence of an element of Table 3B, Table 10, or Table X (e.g., comprising a retrotransposase-binding region), or (ii) the nucleotides located 3’ relative to a stop codon of a sequence of an element of Table 3B, Table 10, or Table X (e.g., comprising a retrotransposase-binding region) 375.
- a template RNA comprising (i) a sequence that binds a polypeptide compris
- any of the preceding embodiments further comprising: b) treating the template RNA to reduce secondary structure, e.g., heating the template RNA, e.g., to at least 70, 75, 80, 85, 90, or 95 C, and/or c) subsequently cooling the template RNA, e.g., to a temperature that allows for secondary structure, e.g, to less than or equal to 37, 30, 25, or 20 C. 376.
- the system is the system of any of the preceding embodiments. 377.
- any of the preceding embodiments which further comprises contacting the template RNA with a polypeptide that comprises (i) a reverse transcriptase domain and (ii) an endonuclease domain, or with a nucleic acid (e.g., RNA) encoding the polypeptide.
- a polypeptide that comprises (i) a reverse transcriptase domain and (ii) an endonuclease domain, or with a nucleic acid (e.g., RNA) encoding the polypeptide.
- RNA nucleic acid
- the method of any of the preceding embodiments which further comprises contacting the template RNA with a cell. 379.
- the heterologous object sequence encodes a therapeutic polypeptide.
- the heterologous object sequence encodes a mammalian (e.g., human) polypeptide, or a fragment or variant thereof.
- the heterologous object sequence encodes an enzyme (e.g., a lysosomal enzyme), a blood factor (e.g., Factor I, II, V, VII, X, XI, XII or XIII), a membrane protein, an exon, an intracellular protein (e.g., a cytoplasmic protein, a nuclear protein, an organellar protein such as a mitochondrial protein or lysosomal protein), an extracellular protein, a structural protein, a signaling protein, a regulatory protein, a transport protein, a sensory protein, a motor protein, a defense protein, a storage protein, an immune receptor protein (e.g., a chimeric antigen receptor (CAR) protein, a T cell receptor, a B cell receptor), or an antibody.
- an enzyme e.g., a lysosomal enzyme
- a blood factor e.g., Factor I, II, V, VII, X, XI, XII or
- heterologous object sequence comprises a tissue specific promoter or enhancer. 383.
- the heterologous object sequence encodes a polypeptide of greater than 250, 300, 400, 500, or 1,000 amino acids, and optionally up to 1300 amino acids.
- the heterologous object sequence encodes a fragment of a mammalian gene but does not encode the full mammalian gene, e.g., encodes one or more exons but does not encode a full-length protein. 385.
- heterologous object sequence encodes one or more introns.
- heterologous object sequence is other than a GFP, e.g., is other than a fluorescent protein or is other than a reporter protein.
- polypeptide has an activity at 37°C that is no less than 70%, 75%, 80%, 85%, 90%, or 95% of its activity at 25°C under otherwise similar conditions. 388.
- nucleic acid encoding the polypeptide and the template RNA or a nucleic acid encoding the template RNA are separate nucleic acids.
- the template RNA does not encode an active reverse transcriptase, e.g., comprises an inactivated mutant reverse transcriptase, e.g., as described in Example 1 or 2, or does not comprise a reverse transcriptase sequence.
- the template RNA comprises one or more chemical modifications. 391.
- heterologous object sequence is disposed between the promoter and the sequence that binds the polypeptide. 392. The system or method of any of the preceding embodiments, wherein the promoter is disposed between the heterologous object sequence and the sequence that binds the polypeptide. 393. The system or method of any of the preceding embodiments, wherein the heterologous object sequence comprises an open reading frame (or the reverse complement thereof) in a 5’ to 3’ orientation on the template RNA. 394. The system or method of any of the preceding embodiments, wherein the heterologous object sequence comprises an open reading frame (or the reverse complement thereof) in a 3’ to 5’ orientation on the template RNA. 395.
- polypeptide comprises (a) a reverse transcriptase domain and (b) an endonuclease domain, wherein at least one of (a) or (b) is heterologous.
- polypeptide comprises (a) a target DNA binding domain, (b) a reverse transcriptase domain and (c) an endonuclease domain, wherein at least one of (a), (b) or (c) is heterologous. 397.
- a substantially pure polypeptide comprising (a) a reverse transcriptase domain and (b) a heterologous endonuclease domain; wherein one or both of (a) or (b) have an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 398.
- a substantially pure polypeptide comprising (a) a reverse transcriptase domain and (b) a heterologous endonuclease domain; wherein one or both of (a) or (b) have an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 399.
- a substantially pure polypeptide comprising (a) a reverse transcriptase domain and (b) a heterologous endonuclease domain; wherein one or both of (a) or (b) have an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 400.
- a substantially pure polypeptide comprising (a) a reverse transcriptase domain and (b) a heterologous endonuclease domain; wherein one or both of (a) or (b) have an amino acid sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 401.
- a substantially pure polypeptide comprising (a) a reverse transcriptase domain encoded by a first sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and (b) a endonuclease domain encoded by a second sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; wherein the first sequence and the second sequences are selected from elements of different rows of Table 3B, Table 10, Table 11, or Table X. 402.
- a substantially pure polypeptide comprising (a) a reverse transcriptase domain encoded by a first sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, and (b) a endonuclease domain encoded by a second sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; wherein the first sequence and the second sequences are selected from elements of different rows of Table 3B, Table 10, Table 11, or Table X. 403.
- a substantially pure polypeptide comprising (a) a reverse transcriptase domain of a first sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and (b) a endonuclease domain of a second sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; wherein the first sequence and the second sequences are selected from elements of different rows of Table 3B, Table 10, Table 11, or Table X. 404.
- a substantially pure polypeptide comprising (a) a reverse transcriptase domain of a first sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, and (b) a endonuclease domain of a second sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; wherein the first sequence and the second sequences are selected from elements of different rows of Table 3B, Table 10, Table 11, or Table X. 405.
- the substantially pure polypeptide of any of the preceding embodiments further comprising a target DNA binding domain encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 406.
- the substantially pure polypeptide of any of the preceding embodiments further comprising a target DNA binding domain encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 407.
- the substantially pure polypeptide of any of the preceding embodiments further comprising a target DNA binding domain of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 408.
- the substantially pure polypeptide of any of the preceding embodiments further comprising a target DNA binding domain of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 409.
- a substantially pure polypeptide comprising (a) a reverse transcriptase domain and (b) a heterologous endonuclease domain; wherein (a) has an amino acid sequence listed in Table 3B, Table 10, Table 11, or Table Z1 or Z2 or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, optionally wherein (b) has an amino acid sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 410.
- a substantially pure polypeptide comprising (a) a reverse transcriptase domain and (b) a heterologous endonuclease domain; wherein (a) has an amino acid sequence listed in Table 3B, Table 10, Table 11, or Table Z1 or Z2 or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, optionally wherein (b) has an amino acid sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 411.
- the substantially pure polypeptide of any of the preceding embodiments further comprising a target DNA binding domain comprising an amino acid sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 412.
- the substantially pure polypeptide of any of the preceding embodiments further comprising a target DNA binding domain comprising an amino acid sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom. 413.
- a substantially pure polypeptide comprising (a) a target DNA binding domain encoded by a first sequence listed in Table 3B, Table 10, Table 11, or Table X, (b) a reverse transcriptase domain encoded by a second sequence listed in Table 3B, Table 10, Table 11, or Table X, and (c) an endonuclease domain encoded by a third sequence listed in Table 3B, Table 10, Table 11, or Table X; wherein: (i) the first sequence and the second sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; (ii) the first sequence and the third sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; (iii) the second sequence and the third sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; or (iv) the first sequence, second sequence, and third sequence are each selected from different rows of Table 3B, Table 10, Table 11, or Table X.
- a substantially pure polypeptide comprising (a) a target DNA binding domain of a first sequence listed in Table 3B, Table 10, Table 11, or Table X, (b) a reverse transcriptase domain of a second sequence listed in Table 3B, Table 10, Table 11, or Table X, and (c) an endonuclease domain of a third sequence listed in Table 3B, Table 10, Table 11, or Table X; wherein: (i) the first sequence and the second sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; (ii) the first sequence and the third sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; (iii) the second sequence and the third sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; or (iv) the first sequence, second sequence, and third sequence are each selected from different rows of Table 3B, Table 10, Table 11, or Table X.
- a substantially pure polypeptide comprising (a) a target DNA binding domain, e.g., comprising a first amino acid sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, (b) a reverse transcriptase domain comprising a second amino acid sequence listed in Table Z1 or Z2 or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and (c) an endonuclease domain comprising a third amino acid sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto; optionally wherein the elements of the first amino acid sequence and the third amino acid sequence are selected from
- a substantially pure polypeptide comprising (a) a target DNA binding domain, e.g., comprising a first amino acid sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, (b) a reverse transcriptase domain comprising a second amino acid sequence listed in Table Z1 or Z2 or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, and (c) an endonuclease domain comprising a third amino acid sequence of an element listed in Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom; optionally wherein the elements of the first amino acid sequence and the third amino acid sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X
- a substantially pure polypeptide comprising (a) a target DNA binding domain comprising a first amino acid sequence, (b) a reverse transcriptase domain comprising a second amino acid sequence, and (c) an endonuclease domain comprising a third amino acid sequence; wherein the first, second, and third amino acid sequences are each encoded by a sequence listed in Table 3B, Table 10, Table 11, or Table X or comprise an amino acid sequence listed in Table Z1 or an amino acid sequence of a domain listed in Table Z2. 418.
- the substantially pure polypeptide of any of the preceding embodiments, wherein the third amino acid sequence is encoded by a sequence listed in Table 3B, Table 10, Table 11, or Table X. 423.
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide comprises (a) a reverse transcriptase domain and (b) an endonuclease domain, wherein one or both of (a) or (b) have an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, and wherein at least one of (a) or (b) is heterologous to the other. 426.
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide is a fusion protein comprising (a) a reverse transcriptase domain encoded by a first sequence of an element listed in Table 3B, Table 10, Table 11, or Table X, and (b) a endonuclease domain encoded by a second sequence of an element listed in Table 3B, Table 10, Table 11, or Table X; wherein the first sequence and the second sequences are selected from elements of different rows of Table 3B, Table 10, Table 11, or Table X. 427.
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide comprises (a) a target DNA binding domain, (b) a reverse transcriptase domain and (c) an endonuclease domain, wherein at least one (e.g., 1, 2, or all) of (a), (b) or (c) comprises an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and wherein at least one of (a), (b) or (c) is heterologous to the other. 428.
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide comprises (a) a target DNA binding domain, (b) a reverse transcriptase domain and (c) an endonuclease domain, wherein at least one (e.g., 1, 2, or all) of (a), (b) or (c) comprises an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, and wherein at least one of (a), (b) or (c) is heterologous to the other. 429.
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide is a fusion protein comprising (a) a target DNA binding domain encoded by a first sequence listed in Table 3B, Table 10, Table 11, or Table X, (b) a reverse transcriptase domain encoded by a second sequence listed in Table 3B, Table 10, Table 11, or Table X, and (c) an endonuclease domain encoded by a third sequence listed in Table 3B, Table 10, Table 11, or Table X; wherein: (i) the first sequence and the second sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; (ii) the first sequence and the third sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; (iii) the second sequence and the third sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; or (iv) the first sequence, second sequence, and third sequence are each selected from different rows of Table 3B, Table 10, Table 11,
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide comprises (a) a reverse transcriptase domain and (b) an endonuclease domain, wherein one or both of (a) or (b) have an amino acid sequence of a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and wherein at least one of (a) or (b) is heterologous to the other. 434.
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide comprises (a) a reverse transcriptase domain and (b) an endonuclease domain, wherein one or both of (a) or (b) have an amino acid sequence of a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, and wherein at least one of (a) or (b) is heterologous to the other. 435.
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide is a fusion protein comprising (a) a reverse transcriptase domain of a first sequence listed in Table 3B, Table 10, Table 11, or Table X, and (b) an endonuclease domain of a second sequence listed in Table 3B, Table 10, Table 11, or Table X; wherein the first sequence and the second sequences are selected from different rows of Table 3B, Table 10, Table 11, or Table X. 436.
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide comprises (a) a target DNA binding domain, (b) a reverse transcriptase domain and (c) an endonuclease domain, wherein at least one (e.g., 1, 2, or all) of (a), (b) or (c) comprises an amino acid sequence of a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto, and wherein at least one of (a), (b) or (c) is heterologous to the other. 437.
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide comprises (a) a target DNA binding domain, (b) a reverse transcriptase domain and (c) an endonuclease domain, wherein at least one (e.g., 1, 2, or all) of (a), (b) or (c) comprises an amino acid sequence of a sequence of an element of Table 3B, Table 10, Table 11, or Table X or a sequence having no more than 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotide differences therefrom, and wherein at least one of (a), (b) or (c) is heterologous to the other. 438.
- polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide is a fusion protein comprising (a) a target DNA binding domain of a first sequence listed in Table 3B, Table 10, Table 11, or Table X, (b) a reverse transcriptase domain of a second sequence listed in Table 3B, Table 10, Table 11, or Table X, and (c) an endonuclease domain of a third sequence listed in Table 3B, Table 10, Table 11, or Table X; wherein: (i) the first sequence and the second sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; (ii) the first sequence and the third sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; (iii) the second sequence and the third sequence are selected from different rows of Table 3B, Table 10, Table 11, or Table X; or (iv) the first sequence, second sequence, and third sequence are each selected from different rows of Table 3B, Table 10, Table 11, or Table X.
- a polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain, e.g., a nickase domain, wherein the RT domain has a sequence of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- RT domain reverse transcriptase domain
- DBD DNA-binding domain
- an endonuclease domain e.g., a nickase domain
- the RT domain has a sequence of Table 3B, Table 10, Table 11, or Table X, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity
- a host cell comprising the nucleic acid of any of the preceding embodiments. 446.
- a host cell comprising the polypeptide of any of the preceding embodiments. 447.
- a host cell comprising: a heterologous object sequence (e.g., a sequence encoding a therapeutic polypeptide) at a target site in a chromosome, and one or both of: (a) one or both of an untranslated region (e.g., a retrotransposon untranslated sequence, e.g., a sequence of Table 10 or column 5 of Table 3A or 3B) on one side (e.g., upstream) of the heterologous object sequence, and an untranslated region (e.g., a retrotransposon untranslated sequence, e.g., a sequence of Table 10 or column 6 of Table 3A or 3B) on the other side (e.g., downstream) of the heterologous object sequence; and/or (b) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain and (ii) an endonucle
- a host cell comprising: a heterologous object sequence (e.g., a sequence encoding a therapeutic polypeptide) at a target site in a chromosome, and one or both of: (a) one or both of an untranslated region (e.g., a retrotransposon untranslated sequence, e.g., a sequence of Table 10 or column 5 of Table 3A or 3B) on one side (e.g., upstream) of the heterologous object sequence, and an untranslated region (e.g., a retrotransposon untranslated sequence, e.g., a sequence of Table 10 or column 6 of Table 3A or 3B) on the other side (e.g., downstream) of the heterologous object sequence; and/or (b) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain and (ii) an end
- a host cell comprising: a heterologous object sequence (e.g., a sequence encoding a therapeutic polypeptide) at a target site in a chromosome, and one or both of: (a) one or both of an untranslated region (e.g., a retrotransposon untranslated sequence, e.g., a sequence of Table 10 or column 5 of Table 3A or 3B) on one side (e.g., upstream) of the heterologous object sequence, and an untranslated region (e.g., a retrotransposon untranslated sequence, e.g., a sequence of Table 10 or column 6 of Table 3A or 3B) on the other side (e.g., downstream) of the heterologous object sequence; and/or (b) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain and (ii) an end
- a host cell comprising: a heterologous object sequence (e.g., a sequence encoding a therapeutic polypeptide) at a target site in a chromosome, and one or both of: (a) one or both of an untranslated region (e.g., a retrotransposon untranslated sequence, e.g., a sequence of column 5 of Table 10 or Table 3A or 3B) on one side (e.g., upstream) of the heterologous object sequence, and an untranslated region (e.g., a retrotransposon untranslated sequence, e.g., a sequence of column 6 of Table 10 or Table 3A or 3B) on the other side (e.g., downstream) of the heterologous object sequence; and/or (b) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain and (ii) an endon
- the host cell of any of the preceding embodiments comprising: (i) a heterologous object sequence (e.g., a sequence encoding a therapeutic polypeptide) at a target site in a chromosome, wherein the target locus is a Natural Harbor TM site, e.g., a site of Table 4 herein. 453.
- the host cell of any of the preceding embodiments which further comprises (ii) one or both of an untranslated region 5’ of the heterologous object sequence, and an untranslated region 3’ of the heterologous object sequence. 454.
- the host cell of any of the preceding embodiments which further comprises (ii) one or both of an untranslated region (e.g., a retrotransposon untranslated sequence, e.g., a sequence of Table 10 or column 5 of Table 3A or 3B) on one side (e.g., upstream) of the heterologous object sequence, and an untranslated region (e.g., a retrotransposon untranslated sequence, e.g., a sequence of Table 10 or column 6 of Table 3A or 3B) on the other side (e.g., downstream) of the heterologous object sequence. 455.
- the host cell of any of the preceding embodiments which comprises a heterologous object sequence at only the target site. 456.
- a pharmaceutical composition comprising any preceding numbered system, nucleic acid, polypeptide, or vector; and a pharmaceutically acceptable excipient or carrier. 457.
- a vector e.g., a viral or plasmid vector
- a vesicle e.g., a liposome, an exosome, a natural or synthetic lipid bilayer
- a fusosome e.g., a lipid nanoparticle.
- a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) optionally a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (ii) optionally a sequence that binds an endonuclease and/or a DNA-binding domain of a polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ homology domain.
- a target site e.g., a non-edited strand of a site in a target genome
- optionally a sequence that binds an endonuclease and/or a DNA-binding domain of a polypeptide e.g., a heterologous object sequence
- a 3’ homology domain 460.
- the template RNA of any of the preceding embodiments, wherein the template RNA comprises (i). 461.
- a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (ii) a sequence that specifically binds an RT domain of a polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ homology domain. 463.
- the template RNA of any of the preceding embodiments, wherein the sequence that specifically binds the RT domain is a sequence of Table 10, Table 11, or Table X, 3A, or 3B, or a sequence having at least 70, 75, 80, 85, 90, 95, or 99% identity thereto. 467.
- a template RNA (or DNA encoding the template RNA) comprising from 5’ to 3’: (ii) a sequence that binds an endonuclease and/or a DNA-binding domain of a polypeptide, (i) a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (iii) a heterologous object sequence, and (iv) a 3’ homology domain. 468.
- a template RNA (or DNA encoding the template RNA) comprising from 5’ to 3’: (iii) a heterologous object sequence, (iv) a 3’ homology domain, (i) a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), and (ii) a sequence that binds an endonuclease and/or a DNA-binding domain of a polypeptide. 469.
- the system or template RNA of any of the preceding embodiments, wherein the sequence that specifically binds the RT domain is disposed between (iii) and (iv). 473.
- a system for modifying DNA comprising: (a) a first template RNA (or DNA encoding the first template RNA) comprising (i) sequence that binds an endonuclease domain, e.g., a nickase domain, and/or a DNA-binding domain (DBD) of a polypeptide, and (ii) a sequence that binds a target site (e.g., a non-edited strand of a site in a target genome), (e.g., wherein the first RNA comprises a gRNA); (b) a second template RNA (or DNA encoding the second template RNA) comprising (i) a sequence that specifically binds a reverse transcriptase (RT) domain of a polypeptide (e.g., the polypeptide of (a
- nucleic acid encoding the first template RNA and the nucleic acid encoding the second template RNA are two separate nucleic acids.
- nucleic acid encoding the first template RNA and the nucleic acid encoding the second template RNA are part of the same nucleic acid molecule, e.g., are present on the same vector.
- a method of modifying a target DNA strand in a cell, tissue or subject comprising administering any preceding numbered system to the cell, tissue or subject, thereby modifying the target DNA strand. 479.
- RLE restriction-endonuclease-like
- APE apurinic-endonuclease-like
- PLE Penelope-like element
- RTE e.g., AviRTE_Brh or BovB
- I Jockey
- CR1 Rex1, RandI/Dualen
- Penelope e.g., Penelope_SM
- Tx1, RTEX Crack
- Nimb Proto1, Proto2, R
- the target DNA binding domain is heterologous relative to one or more other domains of the polypeptide (e.g., a reverse transcriptase domain and/or an endonuclease domain).
- the heterologous target DNA binding domain comprises a Cas9, Cas9 nickase, dCas9, zinc finger, or TAL domain.
- the heterologous target DNA binding domain comprises a Cas domain according to Table 9 or Table 37, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto. 489.
- the heterologous target DNA binding domain comprises an N-terminal dCas9 domain. 490.
- the system further comprises a guide RNA (e.g., a U6-driven gRNA) comprising at least 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 nucleotides of homology to a target DNA sequence.
- a guide RNA e.g., a U6-driven gRNA
- the template RNA further comprises a gRNA region comprising at least 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 nucleotides of homology to a target DNA sequence.
- the gRNA sequence is at the 5’ end of the template. 493.
- any preceeding numbered embodiment, wherein the gRNA sequence is at the 3’ end of the template. 494. Any preceeding numbered embodiment, wherein the gRNA sequence comprises a scaffold capable of recruiting Cas9. 495. Any preceeding numbered embodiment, wherein the gRNA sequence comprises a homology domain, e.g., as described herein. 496. Any preceding numbered embodiment, wherein the endonuclease domain is heterologous relative to one or more other domains of the polypeptide (e.g., a reverse transcriptase domain and/or a target DNA binding domain). 497.
- heterologous endonuclease domain comprises a Cas9, Cas9 nickase, or FokI domain. 498. Any preceding numbered embodiment, wherein the polypeptide comprises an RNase H domain. 499. Any preceding numbered embodiment, wherein the polypeptide does not comprise an RNase H domain or comprises an inactivated RNase H domain. 500. Any preceding numbered embodiment, wherein the nucleic acid encoding the polypeptide further comprises a second open reading frame. 501.
- nucleic acid encoding the polypeptide comprises a 2A sequence, e.g., positioned between an ORF1 sequence and an ORF2 sequence, optionally wherein the 2A sequence is selected from T2A ( ), ( ( 502. Any preceding numbered embodiment, wherein the polypeptide comprises an intein. 503. Any preceding numbered embodiment, wherein the system comprises an intein (e.g., comprised in a second polypeptide). 504. Any preceding numbered embodiment, wherein the polypeptide is encoded by two or more separate open reading frames each encoding a polypeptide fragment. 505.
- any preceding numbered embodiment, wherein the intein joins the two or more polypeptide fragments to form the polypeptide.
- the system comprises: (i) a first polypeptide fragment comprising at least one of a reverse transcriptase domain, an endonuclease domain, and a target DNA binding domain, and (ii) a second polypeptide fragment comprising at least one of a reverse transcriptase domain, an endonuclease domain, and a target DNA binding domain, wherein the first polypeptide fragment does not comprise the same type of domain as the second polypeptide fragment. 507.
- the first polypeptide fragment comprises a reverse transcriptase domain and the second polypeptide fragment comprises an endonuclease domain, optionally wherein the first polypeptide fragment further comprises a target DNA binding domain or wherein the second polypeptide fragment further comprises a target DNA binding domain;
- the first polypeptide fragment comprises a reverse transcriptase domain and the second polypeptide fragment comprises a target DNA binding domain, optionally wherein the first polypeptide fragment further comprises an endonuclease domain or wherein the second polypeptide fragment further comprises an endonuclease domain; or
- the first polypeptide fragment comprises an endonuclease domain and the second polypeptide fragment comprises a target DNA binding domain, optionally wherein the first polypeptide fragment further comprises a reverse transcriptase domain or wherein the second polypeptide fragment further comprises a reverse transcriptase domain.
- any preceding numbered embodiment, wherein the intein is a split intein.
- the DNA encoding the polypeptide comprises a plasmid, minicircle, a Doggybone DNA (dbDNA), or a ceDNA.
- the RNA encoding the polypeptide comprises one or more of the following: a cap region, a poly-A tail, and/or a chemical modification, e.g., one or more chemically modified nucleotides. 514.
- the RNA encoding the polypeptide comprises a circRNA. 515.
- nucleic acid encoding the polypeptide is comprised within a virus (e.g., AAV, adenovirus, or lentivirus, e.g., integration-deficient lentivirus). 516. Any of the preceding embodiments, wherein the nucleic acid encoding the polypeptide is comprised within a nanoparticle (e.g., a lipid nanoparticle), vesicle, or fusosome. 517.
- viruses e.g., AAV, adenovirus, or lentivirus, e.g., integration-deficient lentivirus.
- polypeptide comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a sequence of an element of Table X. 518.
- reverse transcriptase domain comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse transcriptase domain of an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X. 519.
- the retrotransposase comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence encoded by a sequence of an element of Table 3B, Table 10, Table 11, or Table X. 520.
- the polypeptide comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence of a sequence of an element of Table 3B, Table 10, Table 11, or Table X. 521.
- reverse transcriptase domain comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the reverse transcriptase domain of an amino acid sequence of a sequence of an element of Table 3B, Table 10, Table 11, or Table X. 522.
- the retrotransposase comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence of a sequence of an element of Table 3B, Table 10, Table 11, or Table X. 523.
- polypeptide comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 1023) or GGGS (SEQ ID NO: 1024).
- the reverse transcriptase domain comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 1023) or GGGS (SEQ ID NO: 1024). 525.
- the retrotransposase comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 1023) or GGGS (SEQ ID NO: 1024). 526.
- polypeptide, reverse transcriptase domain, or retrotransposase comprises a linker comprising an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 1023) or GGGS (SEQ ID NO: 1024). 527.
- the polypeptide comprises a DNA binding domain covalently attached to the remainder of the polypeptide by a linker, e.g., a linker comprising at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 125, 150, 200, 300, 400, or 500 amino acids. 528.
- a linker e.g., a linker comprising at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 125, 150, 200, 300, 400, or 500 amino acids. 528.
- the linker is attached to the remainder of the polypeptide at a position in the DNA binding domain, RNA binding domain, reverse transcriptase domain, or endonuclease domain (e.g., as shown in any of Figures 17A-17F of PCT Application No.
- RNA binding motif e.g., a -1 RNA binding motif
- linker is attached to the remainder of the polypeptide at a position in the C-terminal side of a random coil region of the polypeptide, e.g., N-terminal relative to a DNA binding motif (e.g., a c-myb DNA binding motif), e.g., at a position corresponding to version v3 as described in Example 26 of PCT Application No. PCT/US2019/048607. 532.
- a DNA binding motif e.g., a c-myb DNA binding motif
- linker comprises an amino acid sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 1023) or GGGS (SEQ ID NO: 1024).
- SGSETPGTSESATPES SEQ ID NO: 1023
- GGGS SEQ ID NO: 1024.
- a polynucleotide sequence comprising at least about 500, 1000, 2000, 3000, 3500, 3600, 3700, 3800, 3900, or 4000 contiguous nucleotides from the 5’ end of the template RNA sequence are integrated into a target cell genome. 534.
- a polynucleotide sequence comprising at least about 500, 1000, 2000, 2500, 2600, 2700, 2800, 2900, or 3000 contiguous nucleotides from the 3’ end of the template RNA sequence are integrated into a target cell genome. 535.
- nucleic acid sequence of the template RNA integrates into the genomes of a population of target cells at a copy number of at least about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, or 1.0 integrants/genome. 536.
- nucleic acid sequence of the template RNA integrates into the genomes of a population of target cells at a copy number of at least about 0.01, 0.02, 0.03, 0.04, 0.05, 0.75, or 0.1 integrants/genome. 537.
- polypeptide comprises a functional endonuclease domain (e.g., wherein the endonuclease domain does not comprise a mutation that abolishes endonuclease activity, e.g., as described herein).
- introduction of the system into a target cell does not result in alteration (e.g., upregulation) of p53 and/or p21 protein levels, H2AX phosphorylation (e.g., gamma H2AX), ATM phosphorylation, ATR phosphorylation, Chk1 phosphorylation, Chk2 phosphorylation, and/or p53 phosphorylation. 539.
- a site-specific nuclease e.g., Cas9
- a site-specific nuclease e.g., Cas9
- a site-specific nuclease e.g., Cas9
- a site-specific nuclease e.g., Cas9
- a site-specific nuclease e.g., Cas9
- a site-specific nuclease e.g., Cas9
- any preceding numbered embodiment wherein introduction of the system into a target cell results in upregulation of Chk2 phosphorylation level in the target cell to a level that is less than about 0.001%, 0.005%, 0.01%, 0.05%, 0.1%, 0.5%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 30%, 40%, 45%, 50%, 55%, 60%, 70%, 80%, or 90% of the Chk2 phosphorylation level induced by introducing a site-specific nuclease, e.g., Cas9, that targets the same genomic site as said system. 549. Any preceding numbered embodiment, wherein the target DNA binding domain recognizes a specific target DNA sequence.
- a site-specific nuclease e.g., Cas9
- a guide RNA e.g., a U6-driven gRNA
- the target DNA binding domain comprises one or more of a DNA binding domain of a retrotransposase as described herein (e.g., a retrotransposase of an element of Table X, 10, 11, 3A, or 3B), Cas9, nickase Cas9, dCas9, a zinc finger, a TAL, a meganuclease, and/or a transcription factor. 553.
- the reverse transcriptase domain comprises a reverse transcriptase domain of a retrotransposase as described herein (e.g., a retrotransposase of an element of Table X, 10, 11, Z1, Z2, 3A, or 3B).
- the endonuclease domain comprises an endonuclease domain of of a retrotransposase as described herein (e.g., a retrotransposase of an element of Table X, 10, 11, 3A, or 3B), Cas9, nickase Cas9, a type II restriction enzyme (e.g., FokI), a Holliday junction resolvase, an RLE endonuclease domain, an APE endonuclease domain, or a GIY-YIG endonuclease domain.
- a retrotransposase as described herein (e.g., a retrotransposase of an element of Table X, 10, 11, 3A, or 3B), Cas9, nickase Cas9, a type II restriction enzyme (e.g., FokI), a Holliday junction resolvase, an RLE endonuclease domain, an APE endonucle
- a polypeptide or a nucleic acid encoding the polypeptide wherein the polypeptide comprises (i) a reverse transcriptase (RT) domain, (ii) a DNA-binding domain (DBD); and (iii) an endonuclease domain; wherein the DBD and/or the endonuclease domain comprise a heterologous targeting domain that binds specifically to a sequence comprised in a target DNA molecule (e.g., a genomic DNA). 556.
- RT reverse transcriptase
- DBD DNA-binding domain
- an endonuclease domain comprise a heterologous targeting domain that binds specifically to a sequence comprised in a target DNA molecule (e.g., a genomic DNA).
- a template RNA (or DNA encoding the template RNA) comprising a targeting domain (e.g., a heterologous targeting domain) that binds specifically to a sequence comprised in the target DNA molecule (e.g., a genomic DNA), a sequence that specifically binds an RT domain of a polypeptide, and a heterologous object sequence.
- a targeting domain e.g., a heterologous targeting domain
- the polypeptide comprises a heterologous targeting domain that binds specifically to a sequence comprised in the target DNA molecule (e.g., a genomic DNA).
- heterologous targeting domain binds to a different nucleic acid sequence than the unmodified polypeptide.
- the polypeptide does not comprise a functional endogenous targeting domain (e.g., wherein the polypeptide does not comprise an endogenous targeting domain).
- the heterologous targeting domain comprises a zinc finger (e.g., a zinc finger that binds specifically to the sequence comprised in the target DNA molecule). 561.
- heterologous targeting domain comprises a Cas domain (e.g., a Cas9 domain, or a mutant or variant thereof, e.g., a Cas9 domain that binds specifically to the sequence comprised in the target DNA molecule).
- the heterologous targeting domain comprises an endonuclease domain (e.g., a heterologous endonuclease domain).
- the endonuclease domain comprises a Cas domain (e.g., a Cas9 or a mutant or variant thereof).
- the Cas domain is associated with a guide RNA (gRNA).
- gRNA guide RNA
- the template nucleic acid molecule comprises at least one (e.g., one or two) heterologous homology sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% homology to a sequence comprised in a target DNA molecule (e.g., a genomic DNA). 568.
- the system, method, or template RNA of any of the preceding embodiments, wherein the heterologous homology sequence has less than 50%, 40%, 30%, 20%, 10%, 5%, 4%, 3%, 2%, or 1% sequence identity with a nucleic acid sequence complementary to an endogenous homology sequence of an unmodified form of the template RNA.
- heterologous homology sequence has having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% homology to a sequence of the target DNA molecule that is different the sequence bound by an endogenous homology sequence (e.g., replaced by the heterologous homology sequence). 573.
- heterologous homology sequence comprises a sequence (e.g., at its 3’ end) having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% homology to a sequence positioned 5’ to a nick site of the target DNA molecule (e.g., a site nicked by a nickase, e.g., an endonuclease domain as described herein). 574.
- heterologous homology sequence comprises a sequence (e.g., at its 5’ end) suitable for priming target-primed reverse transcription (TPRT) initiation. 575.
- TPRT target-primed reverse transcription
- the heterologous homology sequence has at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% homology to a sequence positioned within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, or 100 nucleotides of (e.g., 3’ relative to) a target insertion site, e.g., for a heterologous object sequence (e.g., as described herein), in the target DNA molecule.
- TPRT target-primed reverse transcription
- gRNA guide RNA
- the template nucleic acid molecule comprises a guide RNA (gRNA), e.g., as described herein. 577.
- gRNA spacer sequence e.g., at or within 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, 60, 70, 80, 90, or 100 nucleotides of its 5’ end.
- a template RNA (or DNA encoding the template RNA) comprising (e.g., from 5’ to 3’) (i) a sequence that binds a target site (e.g., a second strand of a site in a target genome), (ii) a sequence that specifically binds an RT domain of a polypeptide, (iii) a heterologous object sequence, and (iv) a 3’ target homology domain. 579.
- the template RNA of any of the preceding embodiments further comprising (v) a sequence that binds an endonuclease and/or a DNA-binding domain of a polypeptide (e.g., the same polypeptide comprising the RT domain). 580.
- the template RNA of any of the preceding embodiments, wherein the sequence that specifically binds the RT domain is a sequence, e.g., a UTR sequence, of Table 3B or 10, or a sequence having at least 70, 75, 80, 85, 90, 95, or 99% identity thereto. 584.
- a template RNA (or DNA encoding the template RNA) comprising from 5’ to 3’: (ii) a sequence that binds an endonuclease and/or a DNA-binding domain of a polypeptide, (i) a sequence that binds a target site (e.g., a second strand of a site in a target genome), (iii) a heterologous object sequence, and (iv) a 3’ target homology domain. 585.
- a template RNA (or DNA encoding the template RNA) comprising from 5’ to 3’: (iii) a heterologous object sequence, (iv) a 3’ target homology domain, (i) a sequence that binds a target site (e.g., a second strand of a site in a target genome), and (ii) a sequence that binds an endonuclease and/or a DNA-binding domain of a polypeptide. 586.
- RNA of the system e.g., template RNA, the RNA encoding the polypeptide of (a), or an RNA expressed from a heterologous object sequence integrated into a target DNA
- a microRNA binding site e.g., in a 3’ UTR. 587.
- the system, method, kit, template RNA, or reaction mixture of any of the preceding embodiments wherein the microRNA binding site is recognized by a miRNA that is present in a non-target cell type, but that is not present (or is present at a reduced level relative to the non- target cell) in a target cell type. 588.
- the system, method, kit, template RNA, or reaction mixture of any of the preceding embodiments wherein the system comprises a first miRNA binding site that is recognized by a first miRNA (e.g., miR-142) and the system further comprises a second miRNA binding site that is recognized by a second miRNA (e.g., miR-182 or miR-183), wherein the first miRNA binding site and the second miRNA binding site are situated on the same RNA or on different RNAs of the system. 589.
- the template RNA comprises at least 2, 3, or 4 miRNA binding sites, e.g., wherein the miRNA binding sites are recognized by the same or different miRNAs.
- RNA encoding the polypeptide of (a) comprises at least 2, 3, or 4 miRNA binding sites, e.g., wherein the miRNA binding sites are recognized by the same or different miRNAs.
- RNA expressed from a heterologous object sequence integrated into a target DNA comprises at least 2, 3, or 4 miRNA binding sites, e.g., wherein the miRNA binding sites are recognized by the same or different miRNAs.
- domain refers to a structure of a biomolecule that contributes to a specified function of the biomolecule.
- a domain may comprise a contiguous region (e.g., a contiguous sequence) or distinct, non-contiguous regions (e.g., non-contiguous sequences) of a biomolecule.
- protein domains include, but are not limited to, an endonuclease domain, a DNA binding domain, a reverse transcription domain; an example of a domain of a nucleic acid is a regulatory domain, such as a transcription factor binding domain.
- exogenous when used with reference to a biomolecule (such as a nucleic acid sequence or polypeptide) means that the biomolecule was introduced into a host genome, cell or organism by the hand of man.
- a nucleic acid that is as added into an existing genome, cell, tissue or subject using recombinant DNA techniques or other methods is exogenous to the existing nucleic acid sequence, cell, tissue or subject.
- Genomic safe harbor site GSH site: A genomic safe harbor site is a site in a host genome that is able to accommodate the integration of new genetic material, e.g., such that the inserted genetic element does not cause significant alterations of the host genome posing a risk to the host cell or organism.
- a GSH site generally meets 1, 2, 3, 4, 5, 6, 7, 8 or 9 of the following criteria: (i) is located >300kb from a cancer-related gene; (ii) is >300kb from a miRNA/other functional small RNA; (iii) is >50kb from a 5’ gene end; (iv) is >50kb from a replication origin; (v) is >50kb away from any ultraconservered element; (vi) has low transcriptional activity (i.e. no mRNA +/- 25 kb); (vii) is not in copy number variable region; (viii) is in open chromatin; and/or (ix) is unique, with 1 copy in the human genome.
- GSH sites in the human genome that meet some or all of these criteria include (i) the adeno-associated virus site 1 (AAVS1), a naturally occurring site of integration of AAV virus on chromosome 19; (ii) the chemokine (C-C motif) receptor 5 (CCR5) gene, a chemokine receptor gene known as an HIV-1 coreceptor; (iii) the human ortholog of the mouse Rosa26 locus; (iv) the rDNA locus. Additional GSH sites are known and described, e.g., in Pellenz et al. epub August 20, 2018 (https://doi.org/10.1101/396390).
- heterologous when used to describe a first element in reference to a second element means that the first element and second element do not exist in nature disposed as described.
- a heterologous polypeptide, nucleic acid molecule, construct or sequence refers to (a) a polypeptide, nucleic acid molecule or portion of a polypeptide or nucleic acid molecule sequence that is not native to a cell in which it is expressed, (b) a polypeptide or nucleic acid molecule or portion of a polypeptide or nucleic acid molecule that has been altered or mutated relative to its native state, or (c) a polypeptide or nucleic acid molecule with an altered expression as compared to the native expression levels under similar conditions.
- a heterologous regulatory sequence e.g., promoter, enhancer
- a heterologous domain of a polypeptide or nucleic acid sequence e.g., a DNA binding domain of a polypeptide or nucleic acid encoding a DNA binding domain of a polypeptide
- a heterologous nucleic acid molecule may exist in a native host cell genome, but may have an altered expression level or have a different sequence or both.
- heterologous nucleic acid molecules may not be endogenous to a host cell or host genome but instead may have been introduced into a host cell by transformation (e.g., transfection, electroporation), wherein the added molecule may integrate into the host genome or can exist as extra-chromosomal genetic material either transiently (e.g., mRNA) or semi-stably for more than one generation (e.g., episomal viral vector, plasmid or other self-replicating vector).
- a domain is heterologous relative to another domain, if the first domain is not naturally comprised in the same polypeptide as the other domain (e.g., a fusion between two domains of different proteins from the same organism).
- Mutation or Mutated The term “mutated” when applied to nucleic acid sequences means that nucleotides in a nucleic acid sequence may be inserted, deleted or changed compared to a reference (e.g., native) nucleic acid sequence. A single alteration may be made at a locus (a point mutation) or multiple nucleotides may be inserted, deleted or changed at a single locus. In addition, one or more alterations may be made at any number of loci within a nucleic acid sequence.
- Nucleic acid sequence may be mutated by any method known in the art. In some embodiments a mutation occurs naturally. In some embodiments a desired mutation can be produced by a system described herein.
- Nucleic acid molecule refers to both RNA and DNA molecules including, without limitation, cDNA, genomic DNA and mRNA, and also includes synthetic nucleic acid molecules, such as those that are chemically synthesized or recombinantly produced, such as RNA templates, as described herein.
- the nucleic acid molecule can be double-stranded or single-stranded, circular or linear. If single-stranded, the nucleic acid molecule can be the sense strand or the antisense strand.
- nucleic acid comprising SEQ. ID NO:1 refers to a nucleic acid, at least a portion which has either (i) the sequence of SEQ. ID NO:1, or (ii) a sequence complimentary to SEQ. ID NO:1.
- the choice between the two is dictated by the context in which SEQ. ID NO:1 is used. For instance, if the nucleic acid is used as a probe, the choice between the two is dictated by the requirement that the probe be complimentary to the desired target.
- Nucleic acid sequences of the present disclosure may be modified chemically or biochemically or may contain non-natural or derivatized nucleotide bases, as will be readily appreciated by those of skill in the art. Such modifications include, for example, labels, methylation, substitution of one or more naturally occurring nucleotides with an analog, inter-nucleotide modifications such as uncharged linkages (for example, methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.), charged linkages (for example, phosphorothioates, phosphorodithioates, etc.), pendant moieties, (for example, polypeptides), intercalators (for example, acridine, psoralen, etc.), chelators, alkylators, and modified linkages (for example, alpha anomeric nucleic acids, etc.).
- uncharged linkages for example, methyl phosphonates, phosphotriesters, phosphoramidates, carbamates, etc.
- Gene expression unit is a nucleic acid sequence comprising at least one regulatory nucleic acid sequence operably linked to at least one effector sequence.
- a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence.
- a promoter or enhancer is operably linked to a coding sequence if the promoter or enhancer affects the transcription or expression of the coding sequence.
- Operably linked DNA sequences may be contiguous or non-contiguous. Where necessary to join two protein-coding regions, operably linked sequences may be in the same reading frame.
- Host The terms host genome or host cell, as used herein, refer to a cell and/or its genome into which protein and/or genetic material has been introduced.
- a host genome or host cell may be an isolated cell or cell line grown in culture, or genomic material isolated from such a cell or cell line, or may be a host cell or host genome which composing living tissue or an organism. In some instances, a host cell may be an animal cell or a plant cell, e.g., as described herein.
- a host cell may be a bovine cell, horse cell, pig cell, goat cell, sheep cell, chicken cell, or turkey cell. In certain instances, a host cell may be a corn cell, soy cell, wheat cell, or rice cell.
- Pseudoknot A “pseudoknot sequence” sequence, as used herein, refers to a nucleic acid (e.g., RNA) having a sequence with suitable self-complementarity to form a pseudoknot structure, e.g., having: a first segment, a second segment between the first segment and a third segment, wherein the third segment is complementary to the first segment, and a fourth segment, wherein the fourth segment is complementary to the second segment.
- RNA nucleic acid
- the pseudoknot may optionally have additional secondary structure, e.g., a stem loop disposed in the second segment, a stem-loop disposed between the second segment and third segment, sequence before the first segment, or sequence after the fourth segment.
- the pseudoknot may have additional sequence between the first and second segments, between the second and third segments, or between the third and fourth segments.
- the segments are arranged, from 5’ to 3’: first, second, third, and fourth.
- the first and third segments comprise five base pairs of perfect complementarity.
- the second and fourth segments comprise 10 base pairs, optionally with one or more (e.g., two) bulges.
- the second segment comprises one or more unpaired nucleotides, e.g., forming a loop.
- the third segment comprises one or more unpaired nucleotides, e.g., forming a loop.
- Stem-loop sequence refers to a nucleic acid sequence (e.g., RNA sequence) with sufficient self-complementarity to form a stem-loop, e.g., having a stem comprising at least two (e.g., 3, 4, 5, 6, 7, 8, 9, or 10) base pairs, and a loop with at least three (e.g., four) base pairs.
- the stem may comprise mismatches or bulges.
- FIG.1 is a schematic of the Gene WritingTM genome editing system.
- FIG.2 is a schematic of the structure of the Gene WriterTM genome editor polypeptide.
- FIG.3 is a schematic of the structure of exemplary Gene WriterTM template RNAs.
- FIGS.4A and 4B are a series of diagrams showing examples of configurations of Gene Writers using domains derived from a variety of sources. Gene Writers as described herein may or may not comprise all domains depicted.
- a GeneWrite may, in some instances, lack an RNA-binding domain, or may have single domains that fulfill the functions of multiple domains, e.g., a Cas9 domain for DNA binding and endonuclease activity.
- Exemplary domains that can be included in a GeneWriter polypeptide include DNA binding domains (e.g., comprising a DNA binding domain of an element of a sequence listed in any of Tables X, Y, Z1, Z2, 3A, or 3B; a zinc finger; a TAL domain; Cas9; dCas9; nickase Cas9; a transcription factor, or a meganuclease), RNA binding domains (e.g., comprising an RNA binding domain of B-box protein, MS2 coat protein, dCas, or an element of a sequence listed in any of Tables X, Y, Z1, Z2, 3A, or 3B), reverse transcriptase domains (e.g., comprising
- FIG.5 is a diagram showing the modules of an exemplary GeneWriter RNA template. Individual modules of the exemplary template can be combined, re-arranged, and/or omitted, e.g., to produce a Gene Writer template.
- FIG.6 is a table listing the modules of an exemplary Gene Writer RNA template. Individual modules can be combined, re-arranged, and/or omitted, e.g., to produce a Gene Writer template.
- FIGS.7A and 7B are diagrams showing an exemplary second strand nicking process.
- a Cas9 nickase is fused to a Gene Writer protein. The Gene Writer protein introduces a nick in a DNA strand through its EN domain (shown as *), and the fused Cas9 nickase introduces a nicks on either top or bottom DNA strands (shown as X).
- a Gene Writer is targeted to DNA through its DNA biding domain and introduces a DNA nick with its EN domain (*).
- FIG.8 represents screening construct design for retrotransposon-mediated integration in human cells.
- a driver plasmid comprising a retrotransposase (Driver) expression cassette is transfected together with a template plasmid comprising a retrotransposon-dependent reporter cassette.
- expression from the template plasmid results in a non-functional GFP because of an interrupting antisense intron
- transcription of the template molecule from the template plasmid results in the generation of an RNA with the intron removed by splicing that can then be reverse transcribed and integrated by the system.
- FIG.9 discloses screening of candidate retrotransposons and identifies 25 candidates that integrate a trans payload in human cells. A total of 163 retrotransposon systems were assayed for activity in human cells as described in Example 4.
- FIG.10 High-activity Gene Writing configurations based on retrotransposon hits from Table 3B and further improved in Examples 7,8 , and 9. Where multiple configurations of a given system, e.g., alternate coding sequence of the retrotransposase (Example 8 ) or addition of homology arms (Example 9) were tested, only the highest performing configuration is shown.
- FIG.11 Retrotransposon consensus sequence can rescue or improve trans integration activity in human cells. Integration efficiency measured by copies/genome via ddPCR as described in Example 5 is shown for each retrotransposon driver/template system. The height of each bar indicates the average value of two replicates. Empty circles indicate each replicate and bars represent the original sequences (light gray) or the novel consensus-generated protein sequence (dark gray).
- FIG.12 shows that consensus motif-generated homology arm sequences can rescue or improve retrotransposon trans integration activity in human cells.
- FIG.13 A & B show luciferase activity assay for primary cells. LNPs formulated as according to Example 11 were analyzed for delivery of cargo to primary human (A) and mouse (B) hepatocytes, as according to Example 12.
- FIG.14 discloses LNP-mediated delivery of RNA cargo to the murine liver.
- Firefly luciferase mRNA-containing LNPs were formulated and delivered to mice by iv, and liver samples were harvested and assayed for luciferase activity at 6, 24, and 48 hours post administration.
- Reporter activity by the various formulations followed the ranking LIPIDV005>LIPIDV004>LIPIDV003.
- RNA expression was transient and enzyme levels returned near vehicle background by 48 hours. Post-administration.
- compositions, systems and methods for targeting, editing, modifying or manipulating a DNA sequence e.g., inserting a heterologous object DNA sequence into a target site of a mammalian genome
- a DNA sequence e.g., inserting a heterologous object DNA sequence into a target site of a mammalian genome
- the object DNA sequence may include, e.g., a coding sequence, a regulatory sequence, a gene expression unit.
- the disclosure provides retrotransposon-based systems for inserting a sequence of interest into the genome.
- This disclosure is based, in part, on a bioinformatic analysis to identify retrotransposase sequences and the associated 5’ UTR and 3’ UTR from a variety of organisms (see Tables 3B, 10, 11, and X). Additional examples of retrotransposon elements are listed, e.g., in Tables 1 and 2 of PCT Application No. PCT/US2019/048607, incorporated herein by reference in its entirety.
- systems described herein can have a number of advantages relative to various earlier systems. For instance, the disclosure describes retrotransposases capable of inserting long sequences of heterologous nucleic acid into a genome.
- retrotransposases described herein can insert heterologous nucleic acid in an endogenous site in the genome, such as the rDNA locus. This is in contrast to Cre/loxP systems which require a first step of inserting an exogenous loxP site before a second step of inserting a sequence of interest into the loxP site.
- Gene-writerTM genome editors Non-long terminal repeat (LTR) retrotransposons are a type of mobile genetic elements that are widespread in eukaryotic genomes. They include, for example, the apurinic/apyrimidinic endonuclease (APE)-type, the restriction enzyme-like endonuclease (RLE)-type, and the Penelope-like element (PLE)-type.
- APE apurinic/apyrimidinic endonuclease
- RLE restriction enzyme-like endonuclease
- PLE Penelope-like element
- the APE class retrotransposons are comprised of two functional domains: an endonuclease/DNA binding domain, and a reverse transcriptase domain. Examples of APE-class retrotransposons can be found, for example, in Table 1 of PCT Application No. PCT/US2019/048607, incorporated herein by reference in its entirety, including the sequence listing and sequences referred to in Table 1 therein.
- the RLE class are comprised of three functional domains: a DNA binding domain, a reverse transcription domain, and an endonuclease domain. Examples of RLE-class retrotransposons can be found, for example, in Table 2 of PCT Application No.
- the reverse transcriptase domain of non-LTR retrotransposon functions by binding an RNA sequence template and reverse transcribing it into the host genome’s target DNA.
- the RNA sequence template has a 3’ untranslated region which is specifically bound to the retrotransposase, and a variable 5’ region generally having Open Reading Frame(s) (“ORF”) encoding retrotransposase proteins.
- the RNA sequence template may also comprise a 5’ untranslated region which specifically binds the retrotransposase.
- Penelope-like elements (PLEs) are distinct from both LTR and non-LTR retrotransposons.
- PLEs generally comprise a reverse transcriptase domain distinct from that of APE and RLE elements, but similar to that of telomerases and Group II introns, and an optional GIY-YIG endonuclease domain.
- Other exemplary classes of retrotransposon include, without limitation, CRE, NeSL, R4, R2, Hero, L1, RTE (e.g., AviRTE_Brh or BovB), I, Jockey, CR1, Rex1, RandI/Dualen, Penelope or Penelope-like (PLE) (e.g., Penelope_SM), Tx1, RTEX, Crack, Nimb, Proto1, Proto2, RTETP, L2, Tad1, Loa, Ingi, Outcast, R1, Daphne, L2A, L2B, Ambal, Vingi (e.g., Vingi-1_EE), and Kiri retrotransposons.
- the elements of such retrotransposons can be functionally modularized and/or modified to target, edit, modify or manipulate a target DNA sequence, e.g., to insert an object (e.g., heterologous) nucleic acid sequence into a target genome, e.g., a mammalian genome, by reverse transcription.
- object e.g., heterologous nucleic acid sequence
- Gene WriterTM gene editors Such modularized and modified nucleic acids, polypeptide compositions and systems are described herein and are referred to as Gene WriterTM gene editors.
- a Gene WriterTM gene editor system comprises: (A) a polypeptide or a nucleic acid encoding a polypeptide, wherein the polypeptide comprises (i) a reverse transcriptase domain, and either (x) an endonuclease domain that contains DNA binding functionality or (y) an endonuclease domain and separate DNA binding domain; and (B) a template RNA comprising (i) a sequence that binds the polypeptide and (ii) a heterologous insert sequence.
- the Gene Writer genome editor protein may comprise a DNA-binding domain, a reverse transcriptase domain, and an endonuclease domain.
- the Gene Writer genome editor protein may comprise a reverse transcriptase domain and an endonuclease domain.
- the elements of the Gene WriterTM gene editor polypeptide can be derived from sequences of retrotransposons, e.g., APE-type, RLE-type, or PLE-type retrotransposons or portions or domains thereof.
- the RLE-type non-LTR retrotransposon is from the R2, NeSL, HERO, R4, or CRE clade.
- the Gene Writer genome editor is derived from R4 element X4_Line, which is found in the human genome.
- the APE-type non-LTR retrotransposon is from the R1, or Tx1 clade.
- the Gene Writer genome editor is derived from Tx1 element Mare6, which is found in the human genome.
- the RNA template element of a Gene WriterTM gene editor system is typically heterologous to the polypeptide element and provides an object sequence to be inserted (reverse transcribed) into the host genome.
- the Gene Writer genome editor protein is capable of target primed reverse transcription.
- the Gene Writer genome editor is combined with a second polypeptide.
- the second polypeptide is derived from an APE-type non- LTR retrotransposon.
- the second polypeptide has a zinc knuckle-like motif. In some embodiments the second polypeptide is a homolog of Gag proteins.
- the Gene Writer genome editor comprises a retrotransposase sequence of an element listed in Table X.
- Table X provides a series of nucleic acid and amino acid sequences (listed by Repbase gene name and species), with associated GenBank Accession numbers where available. The Repbase nucleic acid and amino acid sequences of elements listed in Table X are incorporated herein by reference in their entireties. The GenBank sequences of elements listed in Table X are also incorporated herein by reference in their entireties.
- the nucleic acid sequences of Table X include, in some instances, a sequence encoding a polypeptide (e.g., an open reading frame) (e.g., the protein-coding sequence of the corresponding Repbase entry, incorporated herein by reference).
- the nucleic acid sequences of Table X include, in some instances, a 5’ UTR sequence (e.g., the 5’ UTR sequence of the corresponding Repbase entry, incorporated herein by reference).
- the nucleic acid sequences of Table X include, in some instances, a 3’ UTR sequence (e.g., the 3’ UTR sequence of the corresponding Repbase entry, incorporated herein by reference).
- an open reading frame (ORF) for the amino acid sequence is annotated in Repbase.
- an ORF for the amino acid sequence is not annotated in Repbase.
- the ORF can be identified by one of skill in the art, e.g., by performing one or more translations (e.g., all-frame translations), and optionally comparing the translation to a reverse transcriptase sequence or consensus motif.
- an amino acid sequence of Table X e.g., as used herein, is an amino acid sequence listed in the corresponding Repbase entry, or an amino acid sequence encoded by the nucleic acid sequence in the corresponding Repbase entry.
- an amino acid sequence encoded by an element of Table X is an amino acid sequence encoded by the full length sequence of an element listed in Table X, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
- the full length sequence of an element listed in Table X may comprise one or more (e.g., all of) of a 5’ UTR, polypeptide-encoding sequence, or 3’ UTR of a retrotransposon as described herein.
- an amino acid sequence of Table X is an amino acid sequence encoded by the full length sequence of an element listed in Table X, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
- a 5’ UTR of an element of Table X comprises a 5’ UTR of the full length sequence of an element listed in Table X, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
- a 3’ UTR of an element of Table X comprises a 3’ UTR of the full length sequence of an element listed in Table X, or a sequence having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
- Table X Also indicated in Table X are the host organisms from which the nucleic acid sequences were obtained and a listing of domains present within the polypeptide encoded by the open reading frame of the nucleic acid sequence. The domains listed in Table X are indicated as domain identifiers, which correspond to InterPro domain entries as listed in Table Y.
- a Repbase sequence listed in Table X can encode a polypeptide including one or more domains, indicated in Table X by their domain identifiers. The specific domain or domain type associated with each domain identifier is described in greater detail in Table Y.
- a domain of interest e.g., as listed in Table Y
- a nucleic acid sequence e.g., as listed in Table X
- Retrotransposon discovery tools As the result of repeated mobilization over time, transposable elements in genomic DNA often exist as tandem or interspersed repeats (Jurka Curr Opin Struct Biol 8, 333-337 (1998)).
- Tools capable of recognizing such repeats can be used to identify new elements from genomic DNA and for populating databases, e.g., Repbase (Jurka et al Cytogenet Genome Res 110, 462- 467 (2005)).
- One such tool for identifying repeats that may comprise transposable elements is RepeatFinder (Volfovsky et al Genome Biol 2 (2001)), which analyzes the repetitive structure of genomic sequences. Repeats can further be collected and analyzed using additional tools, e.g., Censor (Kohany et al BMC Bioinformatics 7, 474 (2006)). The Censor package takes genomic repeats and annotates them using various BLAST approaches against known transposable elements.
- An all-frames translation can be used to generate the ORF(s) for comparison.
- Other exemplary methods for identification of transposable elements include RepeatModeler2, which automates the discovery and annotation of transposable elements in genome sequences (Flynn et al bioRxiv (2019)).
- RepeatModeler2 automates the discovery and annotation of transposable elements in genome sequences
- InterProScan a protein domain tool like InterProScan, which tags the domains of a given amino acid sequence using the InterPro database (Mitchell et al.
- Retrotransposons can be further classified according to the reverse transcriptase domain using a tool such as RTclass1 (Kapitonov et al Gene 448, 207-213 (2009)).
- Polypeptide component of Gene Writer gene editor system RT domain In certain aspects of the present invention, the reverse transcriptase domain of the Gene Writer system is based on a reverse transcriptase domain of an APE-type or RLE-type non-LTR retrotransposon, or of a PLE-type retrotransposon.
- a wild-type reverse transcriptase domain of an APE-type, RLE-type, or PLE-type retrotransposon can be used in a Gene Writer system or can be modified (e.g., by insertion, deletion, or substitution of one or more residues) to alter the reverse transcriptase activity for target DNA sequences.
- the reverse transcriptase is altered from its natural sequence to have altered codon usage, e.g. improved for human cells.
- the reverse transcriptase domain is a heterologous reverse transcriptase from a different retrovirus, retron, diversity-generating retroelement, retroplasmid, Group II intron, LTR-retrotransposon, non-LTR retrotransposon, or other source, e.g., as exemplified in Table Z1 or as comprising a domain listed in Table Z2.
- a Gene Writer system includes a polypeptide that comprises a reverse transcriptase domain of an RLE-type non-LTR retrotransposon from the R2, NeSL, HERO, R4, or CRE clade, of an APE- type non-LTR retrotransposon from the L1, RTE, I, Jockey, CR1, Rex1, RandI/Dualen, T1, RTEX, Crack, Nimb, Proto1, Proto2, RTETP, L2, Tad1, Loa, Ingi, Outcast, R1, Daphne, L2A, L2B, Ambal, Vingi, or Kiri clade, or of a PLE-type retrotransposon.
- a Gene Writer system includes a polypeptide that comprises a reverse transcriptase domain of a retrotransposon listed in Table 10, Table 11, Table X, Table Z1, Table Z2, or Table 3A or 3B.
- the amino acid sequence of the reverse transcriptase domain of a Gene Writer system is at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% identical to the amino acid sequence of a reverse transcriptase domain of a retrotransposon whose DNA sequence is referenced in Table 10, Table 11, Table X, Table Z1, Table Z2, or Table 3A or 3B.
- Reverse transcription domains can be identified, for example, based upon homology to other known reverse transcription domains using routine tools as Basic Local Alignment Search Tool (BLAST).
- BLAST Basic Local Alignment Search Tool
- reverse transcriptase domains are modified, for example by site-specific mutation.
- the reverse transcriptase domain is engineered to bind a heterologous template RNA.
- a polypeptide e.g., RT domain
- RNA-binding domain e.g., that specifically binds to an RNA sequence.
- a template RNA comprises an RNA sequence that is specifically bound by the RNA-binding domain.
- the RT domain exhibits enhanced stringency of target-primed reverse transcription (TPRT) initiation, e.g., relative to an endogenous RT domain.
- TPRT target-primed reverse transcription
- the RT domain initiates TPRT when the 3 nt in the target site immediately upstream of the first strand nick, e.g., the genomic DNA priming the RNA template, have at least 66% or 100% complementarity to the 3 nt of homology in the RNA template.
- the RT domain initiates TPRT when there are less than 5 nt mismatched (e.g., less than 1, 2, 3, 4, or 5 nt mismatched) between the template RNA homology and the target DNA priming reverse transcription.
- the RT domain is modified such that the stringency for mismatches in priming the TPRT reaction is increased, e.g., wherein the RT domain does not tolerate any mismatches or tolerates fewer mismatches in the priming region relative to a wild-type (e.g., unmodified) RT domain.
- the RT domain comprises a HIV-1 RT domain.
- the HIV-1 RT domain initiates lower levels of synthesis even with three nucleotide mismatches relative to an alternative RT domain (e.g., as described by Jamburuthugoda and Eickbush J Mol Biol 407(5):661-672 (2011); incorporated herein by reference in its entirety).
- the RT domain forms a dimer (e.g., a heterodimer or homodimer).
- the RT domain is monomeric.
- an RT domain e.g., a retroviral RT domain, naturally functions as a monomer or as a dimer (e.g., heterodimer or homodimer).
- an RT domain naturally functions as a monomer, e.g., is derived from a virus wherein it functions as a monomer. Exemplary monomeric RT domains, their viral sources, and the RT signatures associated with them can be found in Table 30 with descriptions of domain signatures in Table 32.
- the RT domain of a system described herein comprises an amino acid sequence of Table 30, or a functional fragment or variant thereof, or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity thereto.
- the RT domain is selected from an RT domain from murine leukemia virus (MLV; sometimes referred to as MoMLV) (e.g., P03355), porcine endogenous retrovirus (PERV) (e.g., UniProt Q4VFZ2), mouse mammary tumor virus (MMTV) (e.g., UniProt P03365), Mason-Pfizer monkey virus (MPMV) (e.g., UniProt P07572), bovine leukemia virus (BLV) (e.g., UniProt P03361), human T-cell leukemia virus-1 (HTLV-1) (e.g., UniProt P03362), human foamy virus (HFV) (e.g., UniProt P14350), simian foam
- MMV murine
- an RT domain is dimeric in its natural functioning. Exemplary dimeric RT domains, their viral sources, and the RT signatures associated with them can be found in Table 31 with descriptions of domain signatures in Table 32.
- the RT domain of a system described herein comprises an amino acid sequence of Table 31, or a functional fragment or variant thereof, or a sequence having at least 70%, 80%, 90%, 95%, or 99% identity thereto.
- the RT domain is derived from a virus wherein it functions as a dimer.
- the RT domain is selected from an RT domain from avian sarcoma/leukemia virus (ASLV) (e.g., UniProt A0A142BKH1), Rous sarcoma virus (RSV) (e.g., UniProt P03354), avian myeloblastosis virus (AMV) (e.g., UniProt Q83133), human immunodeficiency virus type I (HIV-1) (e.g., UniProt P03369), human immunodeficiency virus type II (HIV-2) (e.g., UniProt P15833), simian immunodeficiency virus (SIV) (e.g., UniProt P05896), bovine immunodeficiency virus (BIV) (e.g., UniProt P19560), equine infectious anemia virus (EIAV) (e.g., UniProt P03371), or feline immunodeficiency virus (FIV) (e
- Naturally heterodimeric RT domains may, in some embodiments, also be functional as homodimers.
- dimeric RT domains are expressed as fusion proteins, e.g., as homodimeric fusion proteins or heterodimeric fusion proteins.
- the RT function of the system is fulfilled by multiple RT domains (e.g., as described herein).
- the multiple RT domains are fused or separate, e.g., may be on the same polypeptide or on different polypeptides.
- a GeneWriter described herein comprises an integrase domain, e.g., wherein the integrase domain may be part of the RT domain.
- an RT domain (e.g., as described herein) comprises an integrase domain.
- an RT domain (e.g., as described herein) lacks an integrase domain, or comprises an integrase domain that has been inactivated by mutation or deleted.
- a GeneWriter described herein comprises an RNase H domain, e.g., wherein the RNase H domain may be part of the RT domain.
- an RT domain (e.g., as described herein) comprises an RNase H domain, e.g., an endogenous RNAse H domain or a heterologous RNase H domain.
- an RT domain (e.g., as described herein) lacks an RNase H domain.
- an RT domain (e.g., as described herein) comprises an RNase H domain that has been added, deleted, mutated, or swapped for a heterologous RNase H domain.
- mutation of an RNase H domain yields a polypeptide exhibiting lower RNase activity, e.g., as determined by the methods described in Kotewicz et al.
- Nucleic Acids Res 16(1):265-277 (1988) (incorporated herein by reference in its entirety), e.g., lower by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% compared to an otherwise similar domain without the mutation.
- RNase H activity is abolished.
- an RT domain is mutated to increase fidelity compared to to an otherwise similar domain without the mutation. For instance, in some embodiments, a YADD or YMDD motif in an RT domain (e.g., in a reverse transcriptase) is replaced with YVDD.
- replacement of the YADD or YMDD or YVDD results in higher fidelity in retroviral reverse transcriptase activity (e.g., as described in Jamburuthugoda and Eickbush J Mol Biol 2011; incorporated herein by reference in its entirety).
- the diversity of reverse transcriptases has been described in, but not limited to, those used by prokaryotes (Zimmerly et al. Microbiol Spectr 3(2):MDNA3-0058-2014 (2015); Lampson B.C. (2007) Prokaryotic Reverse Transcriptases. In: Polaina J., MacCabe A.P. (eds) Industrial Enzymes.
- Table 32 InterPro descriptions of signatures present in reverse transcriptases in Table 30 (monomeric viral RTs) and Table 31 (dimeric viral RTs).
- the polypeptide comprises an endonuclease domain (e.g., a heterologous endonuclease domain).
- the endonuclease/DNA binding domain of an APE-type retrotransposon, the endonuclease domain of an RLE-type retrotransposon, or the endonuclease domain of a PLE-type retrotransposon can be used or can be modified (e.g., by insertion, deletion, or substitution of one or more residues) in a Gene Writer system described herein.
- the endonuclease domain or endonuclease/DNA binding domain is altered from its natural sequence to have altered codon usage, e.g. improved for human cells.
- the endonuclease element is a heterologous endonuclease element, such as Fok1 nuclease, Cas9, Cas9 nickase, a type-II restriction enzyme like endonuclease (RLE-type nuclease), or another RLE-type endonuclease (also known as REL).
- the heterologous endonuclease domain cleaves both DNA strands and forms double-stranded breaks.
- the heterologous endonuclease activity has nickase activity and does not form double stranded breaks.
- the amino acid sequence of an endonuclease domain of a Gene Writer system described herein may be at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% identical to the amino acid sequence of an endonuclease domain of a retrotransposon whose DNA sequence is referenced in Table X, Z1, Z2, 3A, or 3B.
- Endounclease domains can be identified, for example, based upon homology to other known endonuclease domains using tools as Basic Local Alignment Search Tool (BLAST).
- BLAST Basic Local Alignment Search Tool
- the heterologous endonuclease is Cas9 or Cas9 nickase or a functional fragment thereof.
- the heterologous endonuclease is Fok1 or a functional fragment thereof.
- the heterologous endonuclease is a Holliday junction resolvase or homolog thereof, such as the Holliday junction resolving enzyme from Sulfolobus solfataricus––Ssol Hje (Govindaraju et al., Nucleic Acids Research 44:7, 2016).
- the heterologous endonuclease is the endonuclease of the large fragment of a spliceosomal protein, such as Prp8 (Mahbub et al., Mobile DNA 8:16, 2017).
- a Gene Writer polypeptide described herein may comprise a reverse transcriptase domain from an APE-, RLE-, or PLE-type retrotransposon and an endonuclease domain that comprises Fok1 or a functional fragment thereof.
- homologous endonuclease domains are modified, for example by site-specific mutation, to alter DNA endonuclease activity.
- endonuclease domains are modified to remove any latent DNA-sequence specificity.
- a Gene Writer polypeptide possesses the function of DNA target site cleavage via an endonuclease domain.
- the endonuclease domain is also a DNA-binding domain.
- the endonuclease domain is also a template nucleic acid (e.g., template RNA) binding domain.
- a polypeptide comprises a CRISPR-associated endonuclease domain that binds a template RNA comprising a gRNA, binds a target DNA sequence (e.g., with complementarity to a portion of the gRNA), and cuts the target DNA sequence.
- the endonuclease/DNA binding domain of an APE-type retrotransposon or the endonuclease domain of an RLE-type retrotransposon can be used or can be modified (e.g., by insertion, deletion, or substitution of one or more residues) in a Gene Writer system described herein.
- the endonuclease domain or endonuclease/DNA binding domain is altered from its natural sequence to have altered codon usage, e.g. improved for human cells.
- the endonuclease element is a heterologous endonuclease element, such as Fok1 nuclease, a type-II restriction l-like endonuclease (RLE-type nuclease), or another RLE-type endonuclease (also known as REL).
- RLE-type nuclease a type-II restriction l-like endonuclease
- REL RLE-type endonuclease
- the heterologous endonuclease activity has nickase activity and does not form double stranded breaks.
- the amino acid sequence of an endonuclease domain of a Gene Writer system described herein may be at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% identical to the amino acid sequence of an endonuclease domain of a retrotransposon whose DNA sequence is referenced in Table 1, 2, 3A, or 3B.
- Endonuclease domains can be identified, for example, based upon homology to other known endonuclease domains using tools such as Basic Local Alignment Search Tool (BLAST).
- BLAST Basic Local Alignment Search Tool
- the heterologous endonuclease is Fok1 or a functional fragment thereof.
- the heterologous endonuclease is a Holliday junction resolvase or homolog thereof, such as the Holliday junction resolving enzyme from Sulfolobus solfataricus––Ssol Hje (Govindaraju et al., Nucleic Acids Research 44:7, 2016).
- the heterologous endonuclease is the endonuclease of the large fragment of a spliceosomal protein, such as Prp8 (Mahbub et al., Mobile DNA 8:16, 2017).
- the heterologous endonuclease is derived from a CRISPR-associated protein, e.g., Cas9.
- the heterologous endonuclease is engineered to have only ssDNA cleavage activity, e.g., only nickase activity, e.g., be a Cas9 nickase.
- a Gene Writer polypeptide described herein may comprise a reverse transcriptase domain from an APE- or RLE-type retrotransposon and an endonuclease domain that comprises Fok1 or a functional fragment thereof.
- homologous endonuclease domains are modified, for example by site-specific mutation, to alter DNA endonuclease activity.
- endonuclease domains are modified to remove any latent DNA-sequence specificity.
- the endonuclease domain has nickase activity and does not form double stranded breaks.
- the endonuclease domain forms single stranded breaks at a higher frequency than double stranded breaks, e.g., at least 90%, 95%, 96%, 97%, 98%, or 99% of the breaks are single stranded breaks, or less than 10%, 5%, 4%, 3%, 2%, or 1% of the breaks are double stranded breaks.
- the endonuclease forms substantially no double stranded breaks.
- the enonuclease does not form detectable levels of double stranded breaks.
- the endonuclease domain has nickase activity that nicks the target site DNA of the to-be-edited strand; e.g., in some embodiments, the endonuclease domain cuts the genomic DNA of the target site near to the site of alteration on the strand that will be extended by the writing domain. In some embodiments, the endonuclease domain has nickase activity that nicks the target site DNA of the to-be-edited strand and does not nick the target site DNA of the non-edited strand.
- a polypeptide comprises a CRISPR-associated endonuclease domain having nickase activity and that does not form double stranded breaks
- said CRISPR-associated endonuclease domain nicks the target site DNA strand containing the PAM site (e.g., and does not nick the target site DNA strand that does not contain the PAM site).
- the endonuclease domain has nickase activity that nicks the target site DNA of the to-be-edited strand and the non-edited strand.
- a writing domain e.g., RT domain
- a polypeptide described herein polymerizes (e.g., reverse transcribes) from the heterologous object sequence of a template nucleic acid (e.g., template RNA)
- the cellular DNA repair machinery must repair the nick on the to-be-edited DNA strand.
- the target site DNA now contains two different sequences for the to- be-edited DNA strand: one corresponding to the original genomic DNA and a second corresponding to that polymerized from the heterologous object sequence.
- the additional nick is positioned at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 nucleotides 5’ or 3’ of the target site modification (e.g., the insertion, deletion, or substitution) or to the nick on the to-be-edited strand.
- the target site modification e.g., the insertion, deletion, or substitution
- an additional nick to the non-edited strand may promote second strand synthesis.
- the polypeptide comprises a single domain having endonuclease activity (e.g., a single endonuclease domain) and said domain nicks both the to-be-edited strand and the non-edited strand.
- the endonuclease domain may be a CRISPR-associated endonuclease domain
- the template nucleic acid e.g., template RNA
- the template nucleic acid comprises a gRNA that directs nicking of the to-be-edited strand and an additional gRNA that directs nicking of the non-edited strand.
- the polypeptide comprises a plurality of domains having endonuclease activity, and a first endonuclease domain nicks the to- be-edited strand and a second endonuclease domain nicks the non-edited strand (optionally, the first endonuclease domain does not (e.g., cannot) nick the non-edited strand and the second endonuclease domain does not (e.g., cannot) nick the to-be-edited strand).
- the endonuclease domain is capable of nicking a first strand and a second strand.
- the first and second strand nicks occur at the same position in the target site but on opposite strands.
- the second strand nick occurs in a staggered location, e.g., upstream or downstream, from the first nick.
- the endonuclease domain generates a target site deletion if the second strand nick is upstream of the first strand nick.
- the endonuclease domain generates a target site duplication if the second strand nick is downstream of the first strand nick.
- the endonuclease domain generates no duplication and/or deletion if the first and second strand nicks occur in the same position of the target site (e.g., as described in Gladyshev and Arkhipova Gene 2009, incorporated by reference herein in its entirety).
- the endonuclease domain has altered activity depending on protein conformation or RNA-binding status, e.g., which promotes the nicking of the first or second strand (e.g., as described in Christensen et al. PNAS 2006; incorporated by reference herein in its entirety).
- the endonuclease domain comprises a meganuclease, or a functional fragment thereof.
- the endonuclease domain comprises a homing endonuclease, or a functional fragment thereof.
- the endonuclease domain comprises a meganuclease from the LAGLIDADG, GIY-YIG, HNH, His-Cys Box, or PD-(D/E) XK families, or a functional fragment or variant thereof, e.g., which possess conserved amino acid motifs, e.g., as indicated in the family names.
- the endonuclease domain comprises a meganuclease, or fragment thereof, chosen from, e.g., I- SmaMI (Uniprot F7WD42), I-SceI (Uniprot P03882), I-AniI (Uniprot P03880), I-DmoI (Uniprot P21505), I-CreI (Uniprot P05725), I-TevI (Uniprot P13299), I-OnuI (Uniprot Q4VWW5), or I- BmoI (Uniprot Q9ANR6).
- I- SmaMI Uniprot F7WD42
- I-SceI Uniprot P03882
- I-AniI Uniprot P03880
- I-DmoI Uniprot P21505
- I-CreI Uniprot P05725)
- I-TevI Uniprot P13299
- the meganuclease is naturally monomeric, e.g., I-SceI, I-TevI, or dimeric, e.g., I-CreI, in its functional form.
- the LAGLIDADG meganucleases with a single copy of the LAGLIDADG motif generally form homodimers, whereas members with two copies of the LAGLIDADG motif are generally found as monomers.
- a meganuclease that normally forms as a dimer is expressed as a fusion, e.g., the two subunits are expressed as a single ORF and, optionally, connected by a linker, e.g., an I-CreI dimer fusion (Rodriguez-Fornes et al. Gene Therapy 2020; incorporated by reference herein in its entirety).
- a meganuclease, or a functional fragment thereof is altered to favor nickase activity for one strand of a double- stranded DNA molecule, e.g., I-SceI (K122I and/or K223I) (Niu et al.
- a meganuclease or functional fragment thereof possessing this preference for single-strand cleavage is used as an endonuclease domain, e.g., with nickase activity.
- an endonuclease domain comprises a meganuclease, or a functional fragment thereof, which naturally targets or is engineered to target a safe harbor site, e.g., an I-CreI targeting SH6 site (Rodriguez-Fornes et al., supra).
- an endonuclease domain comprises a meganuclease, or a functional fragment thereof, with a sequence tolerant catalytic domain, e.g., I-TevI recognizing the minimal motif CNNNG (Kleinstiver et al. PNAS 2012).
- a target sequence tolerant catalytic domain is fused to a DNA binding domain, e.g., to direct activity, e.g., by fusing I-TevI to: (i) zinc fingers to create Tev-ZFEs (Kleinstiver et al. PNAS 2012), (ii) other meganucleases to create MegaTevs (Wolfs et al. Nucleic Acids Res 2014), and/or (iii) Cas9 to create TevCas9 (Wolfs et al. PNAS 2016).
- the endonuclease domain comprises a restriction enzyme, e.g., a Type IIS or Type IIP restriction enzyme.
- the endonuclease domain comprises a Type IIS restriction enzyme, e.g., FokI, or a fragment or variant thereof.
- the endonuclease domain comprises a Type IIP restriction enzyme, e.g., PvuII, or a fragment or variant thereof.
- a dimeric restriction enzyme is expressed as a fusion such that it functions as a single chain, e.g., a FokI dimer fusion (Minczuk et al. Nucleic Acids Res 36(12):3926-3938 (2008)).
- an endonuclease domain or DNA binding domain (e.g., as described herein) comprises a Streptococcus pyogenes Cas9 (SpCas9) or a functional fragment or variant thereof.
- the endonuclease domain or DNA binding domain comprises a modified SpCas9.
- the modified SpCas9 comprises a modification that alters protospacer-adjacent motif (PAM) specificity.
- the PAM has specificity for the nucleic acid sequence 5’-NGT-3’.
- the modified SpCas9 comprises one or more amino acid substitutions, e.g., at one or more of positions L1111, D1135, G1218, E1219, A1322, of R1335, e.g., selected from L1111R, D1135V, G1218R, E1219F, A1322R, R1335V.
- the modified SpCas9 comprises the amino acid substitution T1337R and one or more additional amino acid substitutions, e.g., selected from L1111, D1135L, S1136R, G1218S, E1219V, D1332A, D1332S, D1332T, D1332V, D1332L, D1332K, D1332R, R1335Q, T1337, T1337L, T1337Q, T1337I, T1337V, T1337F, T1337S, T1337N, T1337K, T1337H, T1337Q, and T1337M, or corresponding amino acid substitutions thereto.
- additional amino acid substitutions e.g., selected from L1111, D1135L, S1136R, G1218S, E1219V, D1332A, D1332S, D1332T, D1332V, D1332L, D1332K, D1332R, R1335Q, T1337, T1337L,
- the modified SpCas9 comprises: (i) one or more amino acid substitutions selected from D1135L, S1136R, G1218S, E1219V, A1322R, R1335Q, and T1337; and (ii) one or more amino acid substitutions selected from L1111R, G1218R, E1219F, D1332A, D1332S, D1332T, D1332V, D1332L, D1332K, D1332R, T1337L, T1337I, T1337V, T1337F, T1337S, T1337N, T1337K, T1337R, T1337H, T1337Q, and T1337M, or corresponding amino acid substitutions thereto.
- an endonuclease domain or DNA binding domain comprises a Cas domain, e.g., a Cas9 domain.
- the endonuclease domain or DNA binding domain comprises a nuclease-active Cas domain, a Cas nickase (nCas) domain, or a nuclease-inactive Cas (dCas) domain.
- the endonuclease domain or DNA binding domain comprises a nuclease-active Cas9 domain, a Cas9 nickase (nCas9) domain, or a nuclease-inactive Cas9 (dCas9) domain.
- the endonuclease domain or DNA binding domain comprises a Cas9 domain of Cas9 (e.g., dCas9 and nCas9), Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, or Cas12i.
- Cas9 e.g., dCas9 and nCas9
- the endonuclease domain or DNA binding domain comprises a Cas9 (e.g., dCas9 and nCas9), Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, or Cas12i.
- the endonuclease domain or DNA binding domain comprises an S. pyogenes or an S. thermophilus Cas9, or a functional fragment thereof.
- the endonuclease domain or DNA binding domain comprises a Cas9 sequence, e.g., as described in Chylinski, Rhun, and Charpentier (2013) RNA Biology 10:5, 726-737; incorporated herein by reference.
- the endonuclease domain or DNA binding domain comprises the HNH nuclease subdomain and/or the RuvC1 subdomain of a Cas, e.g., Cas9, e.g., as described herein, or a variant thereof.
- the endonuclease domain or DNA binding domain comprises Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, or Cas12i.
- the endonuclease domain or DNA binding domain comprises a Cas polypeptide (e.g., enzyme), or a functional fragment thereof.
- the Cas polypeptide (e.g., enzyme) is selected from Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas8a, Cas8b, Cas8c, Cas9 (e.g., Csn1 or Csx12), Cas10, Cas10d, Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, Csy1 , Csy2, Csy3, Csy4, Cse1, Cse2, Cse3, Cse4, Cse5e, Csc1, Csc2, Csa5, Csn1, Csn2, Csm1, Csm2, Csm3, Csm4, Csm
- the Cas9 comprises one or more substiutions, e.g., selected from H840A, D10A, P475A, W476A, N477A, D1125A, W1126A, and D1127A.
- the Cas9 comprises one or more mutations at positions selected from: D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or A987, e.g., one or more substitutions selected from D10A, G12A, G17A, E762A, H840A, N854A, N863A, H982A, H983A, A984A, and/or D986A.
- the endonuclease domain or DNA binding domain comprises a Cas (e.g., Cas9) sequence from Corynebacterium ulcerans, Corynebacterium diphtheria, Spiroplasma syrphidicola, Prevotella intermedia, Spiroplasma taiwanense, Streptococcus iniae, Belliella baltica, Psychroflexus torquis, Streptococcus thermophilus, Listeria innocua, Campylobacter jejuni, Neisseria meningitidis, Streptococcus pyogenes, or Staphylococcus aureus, or a fragment or variant thereof.
- Cas e.g., Cas9 sequence from Corynebacterium ulcerans, Corynebacterium diphtheria, Spiroplasma syrphidicola, Prevotella intermedia, Spiroplasma taiwanense, Streptococcus in
- an endonuclease domain or DNA binding domain comprises a Cpf1 domain, e.g., comprising one or more substitutions, e.g., at position D917, E1006A, D1255 or any combination thereof, e.g., selected from D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, and D917A/E1006A/D1255A.
- an endonuclease domain or DNA binding domain comprises spCas9, spCas9-VRQR, spCas9- VRER, xCas9 (sp), saCas9, saCas9-KKH, spCas9-MQKSER, spCas9-LRKIQK, or spCas9- LRVSQL.
- an endonuclease domain or DNA binding domain comprises an amino acid sequence as listed in Table 37 below, or an amino acid sequence having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity thereto.
- the endonuclease domain or DNA-binding domain comprises an amino acid sequence that has no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 differences (e.g., mutations) relative to any of the amino acid sequences described herein. Table 37. Each of the Reference Sequences are incorporated by reference in their entirety.
- a Gene Writing polypeptide has an endonuclease domain comprising a Cas9 nickase, e.g., Cas9 H840A.
- the Cas9 H840A has the following amino acid sequence: Cas9 nickase (H840A):
- a Gene Writing polypeptide comprises the RT domain from a retroviral reverse transcriptase, e.g., a wild-type M-MLV RT, e.g., comprising the following sequence: M-MLV (WT):
- a Gene Writing polypeptide comprises the RT domain from a retroviral reverse transcriptase, e.g., an M-MLV RT, e.g., comprising the following sequence:
- a Gene Writing polypeptide comprises the RT domain from a retroviral reverse transcriptase comprising the sequence of amino acids 659-1329 of NP_057933.
- the Gene Writing polypeptide further comprises one additional amino acid at the N-terminus of the sequence of amino acids 659-1329 of NP_057933, e.g., as shown below: Core RT (bold), annotated per above RNAseH (underlined), annotated per above
- the Gene Writing polypeptide further comprises one additional amino acid at the C-terminus of the sequence of amino acids 659-1329 of NP_057933.
- the Gene Writing polypeptide comprises an RNaseH1 domain (e.g., amino acids 1178-1318 of NP_057933).
- a retroviral reverse transcriptase domain e.g., M-MLV RT
- M-MLV RT may comprise one or more mutations from a wild-type sequence that may improve features of the RT, e.g., thermostability, processivity, and/or template binding.
- an M-MLV RT domain comprises, relative to the M-MLV (WT) sequence above, one or more mutations, e.g., selected from D200N, L603W, T330P, T306K, W313F, D524G, E562Q, D583N, P51L, S67R, E67K, T197A, H204R, E302K, F309N, L435G, N454K, H594Q, D653N, R110S, K103L, e.g., a combination of mutations, such as D200N, L603W, and T330P, optionally further including T306K and W313F.
- one or more mutations e.g., selected from D200N, L603W, T330P, T306K, W313F, D524G, E562Q, D583N, P51L, S67R, E67K, T197A, H204R, E302K
- an M-MLV RT used herein comprises the mutations D200N, L603W, T330P, T306K and W313F.
- the mutant M-MLV RT comprises the following amino acid sequence: M-MLV (PE2):
- a Gene Writer polypeptide may comprise a linker, e.g., a peptide linker, e.g., a linker as described in Table 7.
- a Gene Writer polypeptide comprises a flexible linker between the endonuclease and the RT domain, e.g., a linker comprising the amino acid sequence SGGSSGGSSGSETPGTSESATPESSGGSSGGSS.
- an RT domain of a Gene Writer polypeptide may be located C-terminal to the endonuclease domain. In some embodiments, an RT domain of a Gene Writer polypeptide may be located N-terminal to the endonuclease domain.
- a Gene Writer polypeptide comprises a dCas9 sequence comprising a D10A and/or H840A mutation, e.g., the following sequence:
- a template RNA molecule for use in the system comprises, from 5’ to 3’ (1) a gRNA spacer; (2) a gRNA scaffold; (3) heterologous object sequence (4) 3’ homology domain.
- Is a Cas9 spacer of ⁇ 18-22 nt e.g., is 20 nt
- Is a gRNA scaffold comprising one or more hairpin loops, e.g., 1, 2, of 3 loopd for associating the template with a nickase Cas9 domain.
- the gRNA scaffold carries the sequence, from 5’ to 3’, G G
- the heterologous object sequence is, e.g., 7-74, e.g., 10-20, 20-30, 30-40, 40-50, 50-60, 60-70, or 70-80 nt or, 80-90 nt in length.
- the first (most 5’) base of the sequence is not C.
- the 3’ homology domain that binds the target priming sequence after nicking occurs is e.g., 3-20 nt, e.g., 7-15 nt, e.g., 12-14 nt. In some embodiments, the 3’ homology domain has 40-60% GC content.
- a second gRNA associated with the system may help drive complete integration. In some embodiments, the second gRNA may target a location that is 0-200 nt away from the first-strand nick, e.g., 0-50, 50-100, 100-200 nt away from the first-strand nick.
- the second gRNA can only bind its target sequence after the edit is made, e.g., the gRNA binds a sequence present in the heterologous object sequence, but not in the initial target sequence.
- a Gene Writing system described herein is used to make an edit in HEK293, K562, U2OS, or HeLa cells.
- a Gene Writing system is used to make an edit in primary cells, e.g., primary cortical neurons from E18.5 mice.
- a reverse transcriptase or RT domain (e.g., as described herein) comprises a MoMLV RT sequence or variant thereof.
- the MoMLV RT sequence comprises one or more mutations selected from D200N, L603W, T330P, T306K, W313F, D524G, E562Q, D583N, P51L, S67R, E67K, T197A, H204R, E302K, F309N, L435G, N454K, H594Q, D653N, R110S, and K103L.
- the MoMLV RT sequence comprises a combination of mutations, such as D200N, L603W, and T330P, optionally further including T306K and/or W313F.
- an endonuclease domain (e.g., as described herein) comprises nCAS9, e.g., comprising the H840A mutation.
- the heterologous object sequence (e.g., of a system as described herein) is about 1-50, 50-100, 100-200, 200-300, 300-400, 400-500, 500-600, 600-700, 700-800, 800-900, 900-1000, or more, nucleotides in length.
- the RT and endonuclease domains are joined by a flexible linker, e.g., comprising the amino acid sequence SGGSSGGSSGSETPGTSESATPESSGGSSGGSS.
- the endonuclease domain is N-terminal relative to the RT domain. In some embodiments, the endonuclease domain is C-terminal relative to the RT domain. In some embodiments, the system incorporates a heterologous object sequence into a target site by TPRT, e.g., as described herein. In some embodiments, a system or method described herein involves a CRISPR DNA targeting enzyme or system described in US Pat. App. Pub. No.20200063126, 20190002889, or 20190002875 (each of which is incorporated by reference herein in its entirety) or a functional fragment or variant thereof.
- a GeneWriter polypeptide or Cas endonuclease described herein comprises a polypeptide sequence of any of the applications mentioned in this paragraph, and in some embodiments a template RNA or guide RNA comprises a nucleic acid sequence of any of the applications mentioned in this paragraph.
- Template nucleic acid binding domain A Gene Writer polypeptide typically contains regions capable of associating with the Gene Writer template nucleic acid (e.g., template RNA). In some embodiments, the template nucleic acid binding domain is an RNA binding domain.
- the RNA binding domain is a modular domain that can associate with RNA molecules containing specific signatures, e.g., structural motifs, e.g., secondary structures present in the 3’ UTR in non-LTR retrotransposons.
- the template nucleic acid binding domain e.g., RNA binding domain
- RNA binding domain is contained within the reverse transcription domain, e.g., the reverse transcriptase-derived component has a known signature for RNA preference, e.g., secondary structures present in the 3’ UTR in non-LTR retrotransposons.
- the template nucleic acid binding domain e.g., RNA binding domain
- the DNA binding domain is contained within the DNA binding domain.
- the DNA binding domain is a CRISPR-associated protein that recognizes the structure of a template nucleic acid (e.g., template RNA) comprising a gRNA.
- a template nucleic acid e.g., template RNA
- the gRNA is a short synthetic RNA composed of a scaffold sequence that participates in CRISPR-associated protein binding and a user-defined ⁇ 20 nucleotide targeting sequence for a genomic target.
- the structure of a complete gRNA was described by Nishimasu et al. Cell 156, P935-949 (2014).
- the gRNA (also referred to as sgRNA for single-guide RNA) consists of crRNA- and tracrRNA-derived sequences connected by an artificial tetraloop.
- the crRNA sequence can be divided into guide (20 nt) and repeat (12 nt) regions, whereas the tracrRNA sequence can be divided into anti-repeat (14 nt) and three tracrRNA stem loops (Nishimasu et al. Cell 156, P935-949 (2014)).
- guide RNA sequences are generally designed to have a length of between 17 – 24 nucleotides (e.g., 19, 20, or 21 nucleotides) and be complementary to a targeted nucleic acid sequence. Custom gRNA generators and algorithms are available commercially for use in the design of effective guide RNAs.
- the gRNA comprises two RNA components from the native CRISPR system, e.g. crRNA and tracrRNA.
- the gRNA may also comprise a chimeric, single guide RNA (sgRNA) containing sequence from both a tracrRNA (for binding the nuclease) and at least one crRNA (to guide the nuclease to the sequence targeted for editing/binding).
- sgRNA single guide RNA
- a gRNA comprises a nucleic acid sequence that is complementary to a DNA sequence associated with a target gene.
- a polypeptide comprises a DNA-binding domain comprising a CRISPR-associated protein that associates with a gRNA that allows the DNA-binding domain to bind a target genomic DNA sequence.
- the gRNA is comprised within the template nucleic acid (e.g., template RNA), thus the DNA-binding domain is also the template nucleic acid binding domain.
- the polypeptide possesses RNA binding function in multiple domains, e.g., can bind a gRNA structure in a CRISPR-associated DNA binding domain and a 3’ UTR structure in a non-LTR retrotransposon derived reverse transcription domain.
- a template nucleic acid (e.g., template RNA) comprises a 3’ target homology domain.
- a 3’ target homology domain is disposed 3’ of the heterologous object sequence and is complementary to a sequence adjacent to a site to be modified by a system described herein, or comprises no more than 1, 2, 3, 4, or 5 mismatches to a sequence complementary to the sequence adjacent to a site to be modified by the system/Gene WriterTM.
- the 3’ target homology domain anneals to the target site, which provides a binding site and the 3’ hydroxyl for the initiation of TPRT by a Gene Writer polypeptide.
- the 3’ target homology domain is 3-5, 5-10, 10-30, 10-25, 10-20, 10-19, 10-18, 10-17, 10-16, 10-15, 10-14, 10-13, 10-12, 10-11, 11-30, 11-25, 11-20, 11- 19, 11-18, 11-17, 11-16, 11-15, 11-14, 11-13, 11-12, 12-30, 12-25, 12-20, 12-19, 12-18, 12-17, 12-16, 12-15, 12-14, 12-13, 13-30, 13-25, 13-20, 13-19, 13-18, 13-17, 13-16, 13-15, 13-14, 14- 30, 14-25, 14-20, 14-19, 14-18, 14-17, 14-16, 14-15, 15-30, 15-25, 15-20, 15-19, 15-18, 15-17, 15-16, 16-30, 16-25, 16-20, 16-19, 16-18, 16-17, 17-30, 17-25, 17-20, 17-19, 17-18, 18-30, 18- 25, 18-20, 18-19, 19-30, 19-25, 19-20, 20-30, 20-25, or 25-30 nt in
- the template nucleic acid may comprise a gRNA (e.g., pegRNA).
- the template nucleic acid e.g., template RNA
- the heterologous RNA binding domain is a CRISPR/Cas protein, e.g., Cas9.
- the region of the template nucleic acid, e.g., template RNA, comprising the gRNA adopts an underwound ribbon-like structure of gRNA bound to target DNA (e.g., as described in Mulepati et al. Science 19 Sep 2014:Vol.345, Issue 6203, pp.1479- 1484). Without wishing to be bound by theory, this non-canonical structure is thought to be facilitated by rotation of every sixth nucleotide out of the RNA-DNA hybrid.
- the region of the template nucleic acid, e.g., template RNA, comprising the gRNA may tolerate increased mismatching with the target site at some interval, e.g., every sixth base.
- the region of the template nucleic acid, e.g., template RNA, comprising the gRNA comprising homology to the target site may possess wobble positions at a regular interval, e.g., every sixth base, that do not need to base pair with the target site.
- a template nucleic acid, e.g., template RNA comprises a guide RNA (gRNA) with inducible activity.
- Inducible activity may be achieved by the template nucleic acid, e.g., template RNA, further comprising (in addition to the gRNA) a blocking domain, wherein the sequence of a portion of or all of the blocking domain is at least partially complementary to a portion or all of the gRNA.
- the blocking domain is thus capable of hybridizing or substantially hybridizing to a portion of or all of the gRNA.
- the blocking domain and inducibly active gRNA are disposed on the template nucleic acid, e.g., template RNA, such that the gRNA can adopt a first conformation where the blocking domain is hybridized or substantially hybridized to the gRNA, and a second conformationwhere the blocking domain is not hybridized or or not substantially hybridized to the gRNA.
- the gRNA in the first conformation the gRNA is unable to bind to the Gene Writer polypeptide (e.g., the template nucleic acid binding domain, DNA binding domain, or endonuclease domain (e.g., a CRISPR/Cas protein)) or binds with substantially decreased affinity compared to an otherwise similar template RNA lacking the blocking domain.
- the gRNA in the second conformation the gRNA is able to bind to the Gene Writer polypeptide (e.g., the template nucleic acid binding domain, DNA binding domain, or endonuclease domain (e.g., a CRISPR/Cas protein)).
- the Gene Writer polypeptide e.g., the template nucleic acid binding domain, DNA binding domain, or endonuclease domain (e.g., a CRISPR/Cas protein
- whether the gRNA is in the first or second conformation can influence whether the DNA binding or endonuclease activities of the Gene Writer polypeptide (e.g., of the CRISPR/Cas protein the Gene Writer polypeptide comprises) are active.
- hybridization of the gRNA to the blocking domain can be disrupted using an opener molecule.
- an opener molecule comprises an agent that binds to a portion or all of the gRNA or blocking domain and inhibits hybridization of the gRNA to the blocking domain.
- the opener molecule comprises a nucleic acid, e.g., comprising a sequence that is partially or wholly complementary to the gRNA, blocking domain, or both.
- a Gene Writer may comprise a Cas protein as listed in Table 9 or Table 37 or a functional fragment thereof, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% identity thereto.
- Table .9 CRISPR/Cas Proteins, Species, and Mutations
- Table 9B provides parameters to define the necessary components for designing gRNA and/or Template RNAs to apply Cas variants listed in Table 3A for Gene Writing.
- Tier indicates preferred Cas variants if they are available for use at a given locus.
- the cut site indicates the validated or predicted protospacer adjacent motif (PAM) requirements, validated or predicted location of cut site (relative to the most upstream base of the PAM site).
- the gRNA for a given enzyme can be assembled by concatenating the crRNA, Tetraloop, and tracrRNA sequences, and further adding a 5’ spacer of a length within Spacer (min) and Spacer (max) that matches a protospacer at a target site.
- the predicted location of the ssDNA nick at the target is important for designing the 3’ region of a Template RNA that needs to anneal to the sequence immediately 5’ of the nick in order to initiate target primed reverse transcription.
- the opener molecule is exogenous to the cell comprising the Gene Writer polypeptide and or template nucleic acid.
- the opener molecule comprises an endogenous agent (e.g., endogenous to the cell comprising the Gene Writer polypeptide and or template nucleic acid comprising the gRNA and blocking domain).
- an inducible gRNA, blocking domain, and opener molecule may be chosen such that the opener molecule is an endogenous agent expressed in a target cell or tissue, e.g., thereby ensuring activity of a Gene Writer system in the target cell or tissue.
- an inducible gRNA, blocking domain, and opener molecule may be chosen such that the opener molecule is absent or not substantially expressed in one or more non-target cells or tissues, e.g., thereby ensuring that activity of a Gene Writer system does not occur or substantially occur in the one or more non-target cells or tissues, or occurs at a reduced level compared to a target cell or tissue.
- Exemplary blocking domains, opener molecules, and uses thereof are described in PCT App. Publication WO2020044039A1, which is incorporated herein by reference in its entirety.
- the template nucleic acid e.g., template RNA
- the UTR facilitates interaction of the template nucleic acid (e.g., template RNA) with the writing domain, e.g., reverse transcriptase domain, of the Gene Writer polypeptide.
- the gRNA facilitates interaction with the template nucleic acid binding domain (e.g., RNA binding domain) of the polypeptide.
- the gRNA directs the polypeptide to the matching target sequence, e.g., in a target cell genome.
- the template nucleic acid may contain only the reverse transcriptase binding motif (e.g.3’ UTR from R2) and the gRNA may be provided as a second nucleic acid molecule (e.g., second RNA molecule) for target site recognition.
- the template nucleic acid containing the RT- binding motif may exist on the same molecule as the gRNA, but be processed into two RNA molecules by cleavage activity (e.g. ribozyme).
- a template RNA may be customized to correct a given mutation in the genomic DNA of a target cell (e.g., ex vivo or in vivo, e.g., in a target tissue or organ, e.g., in a subject).
- the mutation may be a disease-associated mutation relative to the wild- type sequence.
- sets of empirical parameters help ensure optimal initial in silico designs of template RNAs or portions thereof.
- the following design parameters may be employed.
- design is initiated by acquiring approximately 500 bp (e.g., up to 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, or 700 bp, and optionally at least 20, 30, 40, 50, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, or 650 bp) flanking sequence on either side of the mutation to serve as the target region.
- a template nucleic acid comprises a gRNA. Methodology for designing gRNAs is known to those of skill in the art.
- a gRNA comprises a sequence (e.g., a CRISPR spacer) that binds a target site .
- the sequence (e.g., a CRISPR spacer) that binds a target site for use in targeting a template nucleic acid to a target region is selected by considering the particular Gene Writer polypeptide (e.g., endonuclease domain or writing domain, e.g., comprising a CRISPR/Cas domain) being used (e.g., for Cas9, a protospacer-adjacent motif (PAM) of NGG immediately 3’ of a 20 nt gRNA binding region).
- the CRISPR spacer is selected by ranking first by whether the PAM will be disrupted by the Gene Writing induced edit. In some embodiments, disruption of the PAM may increase edit efficiency.
- the PAM can be disrupted by also introducing (e.g., as part of or in addition to another modification to a target site in genomic DNA) a silent mutation (e.g., a mutation that does not alter an amino acid residue encoded by the target nucleic acid sequence, if any) in the target site during Gene Writing.
- a silent mutation e.g., a mutation that does not alter an amino acid residue encoded by the target nucleic acid sequence, if any
- the CRISPR spacer is selected by ranking sequences by the proximity of their corresponding genomic site to the desired edit location.
- the gRNA comprises a gRNA scaffold.
- the gRNA scaffold used may be a standard scaffold (e.g., for Cas9, 5’- GTTTTAGAGCTAGAAATAGCAAGTTAAAATAAGGCTAGTCCGTTATCAACTTGAAAA AGTGGGACCGAGTCGGTCC-3’), or may contain one or more nucleotide substitutions.
- the heterologous object sequence has at least 90% identity, e.g., at least 90%, 95%, 98%, 99%, or 100% identity, or comprises no more than 1, 2, 3, 4, or 5 positions of non-identity to the target site 3’ of the first strand nick (e.g., immediately 3’ of the first strand nick or up to 1, 2, 3, 4, or 5 nucleotides 3’ of the first strand nick), with the exception of any insertion, substitution, or deletion that may be written into the target site by the Gene Writer.
- the 3’ target homology domain contains at least 90% identity, e.g., at least 90%, 95%, 98%, 99%, or 100% identity, or comprises no more than 1, 2, 3, 4, or 5 positions of non-identity to the target site 5’ of the first strand nick (e.g., immediately 5’ of the first strand nick or up to 1, 2, 3, 4, or 5 nucleotides 3’ of the first strand nick).
- a template RNA can comprise a gRNA sequence, e.g., to direct the GeneWriter to a target site of interest.
- a template RNA comprises (e.g., from 5’ to 3’) (i) optionally a sequence (e.g., a CRISPR spacer) that binds a target site (e.g., a second strand of a site in a target genome), (ii) optionally a sequence that binds a polypeptide described herein (e.g., a GeneWriter or a Cas polypeptide), (iii) a heterologous object sequence, and (iv) 5’ homology domain and/or a 3’ target homology domain.
- a target site e.g., a second strand of a site in a target genome
- a polypeptide described herein e.g., a GeneWriter or a Cas polypeptide
- a heterologous object sequence e.g., a
- the template nucleic acid molecule comprises a 5’ homology domain and/or a 3’ homology domain.
- the 5’ homology domain comprises a nucleic acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with a nucleic acid sequence comprised in a target nucleic acid molecule.
- the nucleic acid sequence in the target nucleic acid molecule is within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, or 100 nucleotides of (e.g., 5’ relative to) a target insertion site, e.g., for a heterologous object sequence, e.g., comprised in the template nucleic acid molecule.
- the 3’ homology domain comprises a nucleic acid sequence having at least 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity with a nucleic acid sequence comprised in a target nucleic acid molecule.
- the nucleic acid sequence in the target nucleic acid molecule is within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, or 100 nucleotides of (e.g., 3’ relative to) a target insertion site, e.g., for a heterologous object sequence, e.g., comprised in the template nucleic acid molecule.
- the 5’ homology domain is heterologous to the remainder of the template nucleic acid molecule.
- the 3’ homology domain is heterologous to the remainder of the template nucleic acid molecule.
- a template nucleic acid (e.g., template RNA) comprises a 3’ target homology domain.
- a 3’ target homology domain is disposed 3’ of the heterologous object sequence and is complementary to a sequence adjacent to a site to be modified by a system described herein, or comprises no more than 1, 2, 3, 4, or 5 mismatches to a sequence complementary to the sequence adjacent to a site to be modified by the system/Gene WriterTM.
- the 3’ homology domain binds within 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides of a nick site in the target nucleic acid molecule.
- binding of the 3’ homology domain to the target nucleic acid molecule permits initiation of target-primed reverse transcription (TPRT), e.g., with the 3’ homology domain acting as a primer for TPRT.
- TPRT target-primed reverse transcription
- an RNA component of the system e.g., a template RNA or a gRNA, e.g., as described herein
- the modification pattern of a gRNA can significantly affect in vivo activity compared to unmodified or end-modified guides (e.g., as shown in Figure 1D from Finn et al.
- this process may be due, at least in part, to a stabilization of the RNA conferred by the modifications.
- modifications may include 2'-O-methyl (2'-O-Me), 2'-0-(2-methoxyethyl) (2'-0-MOE), 2'- fluoro (2'-F), phosphorothioate (PS) bond between nucleotides, G-C substitutions, and inverted abasic linkages between nucleotides and equivalents thereof.
- the template RNA (e.g., at the portion thereof that binds a target site) or the guide RNA comprises a 5' terminus region.
- the template RNA or the guide RNA does not comprise a 5' terminus region.
- the 5' terminus region comprises a CRISPR spacer region, e.g., as described with respect to sgRNA in Briner AE et al, Molecular Cell 56: 333-339 (2014) (incorporated herein by reference in its entirety; applicable herein, e.g., to all guide RNAs).
- the 5' terminus region comprises a 5' end modification.
- a 5' terminus region with or without a spacer region may be associated with a crRNA, trRNA, sgRNA and/or dgRNA.
- the CRISPR spacer region can, in some instances, comprise a guide region, guide domain, or targeting domain.
- a target domain or target sequence may comprise a sequence of nucleic acid to which the guide region/domain directs a nuclease for cleavage.
- a spyCas9 protein may be directed by a guide region/domain to a target sequence of a target nucleic acid molecule by the nucleotides present in the CRISPR spacer region.
- the template RNA (e.g., at the portion thereof that binds a target site) or guide RNA, e.g., as described herein, comprises any of the sequences shown in Table 4 of WO2018107028A1, incorporated herein by reference in its entirety.
- the composition may comprise this region or not.
- a guide RNA comprises one or more of the modifications of any of the sequences shown in Table 4 of WO2018107028A1, e.g., as identified therein by a SEQ ID NO.
- the nucleotides may be the same or different, and/or the modification pattern shown may be the same or similar to a modification pattern of a guide sequence as shown in Table 4 of WO2018107028A1.
- a modification pattern includes the relative position and identity of modifications of the gRNA or a region of the gRNA (e.g.5' terminus region, lower stem region, bulge region, upper stem region, nexus region, hairpin 1 region, hairpin 2 region, 3' terminus region).
- the modification pattern contains at least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% of the modifications of any one of the sequences shown in the sequence column of Table 4 of WO2018107028A1, and/or over one or more regions of the sequence. In some embodiments, the modification pattern is at least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the modification pattern of any one of the sequences shown in the sequence column of Table 4 of WO2018107028A1.
- the modification pattern is at least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical over one or more regions of the sequence shown in Table 4 of WO2018107028A1, e.g., in a 5 ' terminus region, lower stem region, bulge region, upper stem region, nexus region, hairpin 1 region, hairpin 2 region, and/or 3' terminus region.
- the modification pattern is least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the modification pattern of a sequence over the 5 ' terminus region.
- the modification pattern is least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the lower stem. In some embodiments, the modification pattern is least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the bulge. In some embodiments, the modification pattern is least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the upper stem.
- the modification pattern is least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the nexus. In some embodiments, the modification pattern is least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the hairpin 1. In some embodiments, the modification pattern is least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the hairpin 2.
- the modification pattern is least 50%, 55%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the 3 ' terminus.
- the modification pattern differs from the modification pattern of a sequence of Table 4 of WO2018107028A1, or a region (e.g.5' terminus, lower stem, bulge, upper stem, nexus, hairpin 1, hairpin 2, 3' terminus) of such a sequence, e.g., at 0, 1, 2, 3, 4, 5, 6, or more nucleotides.
- the gRNA comprises modifications that differ from the modifications of a sequence of Table 4 of WO2018107028A1, e.g., at 0, 1, 2, 3, 4, 5, 6, or more nucleotides.
- the gRNA comprises modifications that differ from modifications of a region (e.g.5 ' terminus, lower stem, bulge, upper stem, nexus, hairpin 1, hairpin 2, 3' terminus) of a sequence of Table 4 of WO2018107028A1, e.g., at 0, 1, 2, 3, 4, 5, 6, or more nucleotides.
- the template RNA e.g., at the portion thereof that binds a target site
- the gRNA comprises a 2'-O-methyl (2'-O-Me) modified nucleotide.
- the gRNA comprises a 2'-O-(2-methoxy ethyl) (2'-O-moe) modified nucleotide.
- the gRNA comprises a 2'-fluoro (2'- F) modified nucleotide.
- the gRNA comprises a phosphorothioate (PS) bond between nucleotides.
- the gRNA comprises a 5' end modification, a 3' end modification, or 5' and 3' end modifications.
- the 5' end modification comprises a phosphorothioate (PS) bond between nucleotides.
- the 5' end modification comprises a 2'-O- methyl (2'-O-Me), 2'-O-(2-methoxy ethyl) (2'-O-MOE), and/or 2'-fluoro (2'-F) modified nucleotide.
- the 5' end modification comprises at least one phosphorothioate (PS) bond and one or more of a 2'-O-methyl (2'-O- Me), 2'-O-(2- methoxyethyl) (2'-O-MOE), and/or 2'-fluoro (2'-F) modified nucleotide.
- the end modification may comprise a phosphorothioate (PS), 2'-O-methyl (2'-O-Me) , 2'-O-(2- methoxyethyl) (2'-O- MOE), and/or 2'-fluoro (2'-F) modification.
- Equivalent end modifications are also encompassed by embodiments described herein.
- the template RNA or gRNA comprises an end modification in combination with a modification of one or more regions of the template RNA or gRNA. Additional exemplary modifications and methods for protecting RNA, e.g., gRNA, and formulae thereof, are described in WO2018126176A1, which is incorporated herein by reference in its entirety.
- structure-guided and systematic approaches are used to introduce modifications (e.g., 2′-OMe-RNA, 2′-F-RNA, and PS modifications) to a template RNA or guide RNA, for example, as described in Mir et al. Nat Commun 9:2641 (2016) (incorporated by reference herein in its entirety).
- the incorporation of 2′-F-RNAs increases thermal and nuclease stability of RNA:RNA or RNA:DNA duplexes, e.g., while minimally interfering with C3′-endo sugar puckering.
- 2′-F may be better tolerated than 2′-OMe at positions where the 2′-OH is important for RNA:DNA duplex stability.
- a crRNA comprises one or more modifications that do not reduce Cas9 activity, e.g., C10, C20, or C21 (fully modified), e.g., as dscribed in Supplementary Table 1 of Mir et al. Nat Commun 9:2641 (2016), incorporated herein by reference in its entirety.
- a tracrRNA comprises one or more modifications that do not reduce Cas9 activity, e.g., T2, T6, T7, or T8 (fully modified) of Supplementary Table 1 of Mir et al. Nat Commun 9:2641 (2016).
- a crRNA comprises one or more modifications (e.g., as described herein) may be paired with a tracrRNA comprising one or more modifications, e.g., C20 and T2.
- a gRNA comprises a chimera, e.g., of a crRNA and a tracrRNA (e.g., Jinek et al. Science 337(6096):816-821 (2012)).
- modifications from the crRNA and tracrRNA are mapped onto the single-guide chimera, e.g., to produce a modified gRNA with enhanced stability.
- gRNA molecules may be modified by the addition or subtraction of the naturally occurring structural components, e.g., hairpins.
- a gRNA may comprise a gRNA with one or more 3’ hairpin elements deleted, e.g., as described in WO2018106727, incorporated herein by reference in its entirety.
- a gRNA may contain an added hairpin structure, e.g., an added hairpin structure in the spacer region, which was shown to increase specificity of a CRISPR-Cas system in the teachings of Kocak et al. Nat Biotechnol 37(6):657-666 (2019). Additional modifications, including examples of shortened gRNA and specific modifications improving in vivo activity, can be found in US20190316121, incorporated herein by reference in its entirety. In some embodiments, structure-guided and systematic approaches (e.g., as described in Mir et al. Nat Commun 9:2641 (2016); incorporated herein by reference in its entirety) are employed to find modifications for the template RNA.
- the modifications are identified with the inclusion or exclusion of a guide region of the template RNA.
- a structure of polypeptide bound to template RNA is used to determine non- protein-contacted nucleotides of the RNA that may then be selected for modifications, e.g., with lower risk of disrupting the association of the RNA with the polypeptide.
- Secondary structures in a template RNA can also be predicted in silico by software tools, e.g., the RNAstructure tool available at rna.urmc.rochester.edu/RNAstructureWeb (Bellaousov et al.
- a Gene Writing system comprises one or more circular RNAs (circRNAs). In some embodiments of any of the aspects described herein, a Gene Writing system comprises one or more linear RNAs.
- a nucleic acid as described herein is a circRNA.
- a circular RNA molecule encodes the Gene Writer polypeptide.
- the circRNA molecule encoding the Gene Writer polypeptide is delivered to a host cell.
- a circular RNA molecule encodes a recombinase, e.g., as described herein.
- the circRNA molecule encoding the recombinase is delivered to a host cell.
- the circRNA molecule encoding the Gene Writer polypeptide is linearized (e.g., in the host cell, e.g., in the nucleus of the host cell) prior to translation.
- Circular RNAs (circRNAs) have been found to occur naturally in cells and have been found to have diverse functions, including both non-coding and protein coding roles in human cells. It has been shown that a circRNA can be engineered by incorporating a self-splicing intron into an RNA molecule (or DNA encoding the RNA molecule) that results in circularization of the RNA, and that an engineered circRNA can have enhanced protein production and stability (Wesselhoeft et al. Nature Communications 2018).
- the Gene WriterTM polypeptide is encoded as circRNA.
- the template nucleic acid is a DNA, such as a dsDNA or ssDNA.
- the circRNA comprises one or more ribozyme sequences.
- the ribozyme sequence is activated for autocleavage, e.g., in a host cell, e.g., thereby resulting in linearization of the circRNA.
- the ribozyme is activated when the concentration of magnesium reaches a sufficient level for cleavage, e.g., in a host cell.
- the circRNA is maintained in a low magnesium environment prior to delivery to the host cell.
- the ribozyme is a protein-responsive ribozyme. In some embodiments, the ribozyme is a nucleic acid-responsive ribozyme. In some embodiments, the circRNA comprises a cleavage site. In some embodiments, the circRNA comprises a second cleavage site. In some embodiments, the circRNA is linearized in the nucleus of a target cell. In some embodiments, linearization of a circRNA in the nucleus of a cell involves components present in the nucleus of the cell, e.g., to activate a cleavage event.
- ribozyme e.g., a ribozyme from a B2 or ALU element, that is responsive to a nuclear element, e.g., a nuclear protein, e.g., a genome-interacting protein, e.g., an epigenetic modifier, e.g., EZH2, is incorporated into a circRNA, e.g., of a Gene Writing system.
- a nuclear element e.g., a nuclear protein, e.g., a genome-interacting protein, e.g., an epigenetic modifier, e.g., EZH2
- nuclear localization of the circRNA results in an increase in autocatalytic activity of the ribozyme and linearization of the circRNA.
- the ribozyme is heterologous to one or more of the other components of the Gene Writing system.
- an inducible ribozyme e.g., in a circRNA as described herein
- a system responds to protein ligand localized to the cytoplasm or the nucleus.
- the protein ligand is not MS2.
- an aptamer for a target ligand is generated and incorporated into a synthetic ribozyme system, e.g., to trigger ribozyme-mediated cleavage and circRNA linearization, e.g., in the presence of the protein ligand.
- circRNA linearization is triggered in the cytoplasm, e.g., using an aptamer that associates with a ligand in the cytoplasm.
- circRNA linearization is triggered in the nucleus, e.g., using an aptamer that associates with a ligand in the nucleus.
- the ligand in the nucleus comprises an epigenetic modifier or a transcription factor.
- the ligand that triggers linearization is present at higher levels in on-target cells than off-target cells.
- a nucleic acid-responsive ribozyme system can be employed for circRNA linearization.
- biosensors that sense defined target nucleic acid molecules to trigger ribozyme activation are described, e.g., in Penchovsky (Biotechnology Advances 32(5):1015-1027 (2014), incorporated herein by reference).
- a ribozyme naturally folds into an inactive state and is only activated in the presence of a defined target nucleic acid molecule (e.g., an RNA molecule).
- a circRNA of a Gene Writing system comprises a nucleic acid-responsive ribozyme that is activated in the presence of a defined target nucleic acid, e.g., an RNA, e.g., an mRNA, miRNA, guide RNA, gRNA, sgRNA, ncRNA, lncRNA, tRNA, snRNA, or mtRNA.
- the nucleic acid that triggers linearization is present at higher levels in on-target cells than off-target cells.
- a Gene Writing system incorporates one or more ribozymes with inducible specificity to a target tissue or target cell of interest, e.g., a ribozyme that is activated by a ligand or nucleic acid present at higher levels in a target tissue or target cell of interest.
- the Gene Writing system incorporates a ribozyme with inducible specificity to a subcellular compartment, e.g., the nucleus, nucleolus, cytoplasm, or mitochondria.
- an RNA component of a Gene Writing system is provided as circRNA, e.g., that is activated by linearization.
- linearization of a circRNA encoding a Gene Writing polypeptide activates the molecule for translation.
- a signal that activates a circRNA component of a Gene Writing system is present at higher levels in on-target cells or tissues, e.g., such that the system is specifically activated in these cells.
- an RNA component of a Gene Writing system is provided as a circRNA that is inactivated by linearization.
- a circRNA encoding the Gene Writer polypeptide is inactivated by cleavage and degradation.
- a circRNA encoding the Gene Writing polypeptide is inactivated by cleavage that separates a translation signal from the coding sequence of the polypeptide.
- a signal that inactivates a circRNA component of a Gene Writing system is present at higher levels in off- target cells or tissues, such that the system is specifically inactivated in these cells.
- compositions and methods for the assembly of full or partial template RNA molecules e.g., Gene Writing template RNA molecules optionally comprising a gRNA, or separate gRNA molecules).
- RNA molecules may be assembled by the connection of two or more (e.g., two, three, four, five, six, seven, eight, nine, ten, or more) RNA segments with each other.
- the disclosure provides methods for producing nucleic acid molecules, the methods comprising contacting two or more linear RNA segments with each other under conditions that allow for the 5′ terminus of a first RNA segment to be covalently linked with the 3′ terminus of a second RNA segment.
- the joined molecule may be contacted with a third RNA segment under conditions that allow for the 5’ terminus of the joined molecule to be covalently linked with the 3’ terminus of the third RNA segment.
- the method further comprises joining a fourth, fifth, or additional RNA segments to the elongated molecule.
- This form of assembly may, in some instances, allow for rapid and efficient assembly of RNA molecules.
- the present disclosure also provides compositions and methods for the connection (e.g., covalent connection) of crRNA molecules and tracrRNA molecules.
- guide RNA molecules with specificity for different target sites can be generated using a single tracrRNA molecule/segment connected to a target site specific crRNA molecule/segment (e.g., as shown in FIG.10 of US20160102322A1; incorporated herein by reference in its entirety).
- FIG.10 of US20160102322A1 shows four tubes with different crRNA molecules with crRNA molecule 3 being connected to a tracrRNA molecule to form a guide RNA molecule, thereby depicting an exemplary connection of two RNA segments to form a product RNA molecule.
- the disclosure also provides compositions and methods for the production of template RNA molecules with specificity for a Gene Writer polypeptide and/or a genomic target site.
- the method comprises: (1) identification of the target site and desired modification thereto, (2) production of RNA segments including an upstream homology segment, a heterologous object sequence segment, a Gene Writer polypeptide binding motif, and a gRNA segment, and/or (3) connection of the four or more segments into at least one molecule, e.g., into a single RNA molecule.
- some or all of the template RNA segments comprised in (2) are assembled into a template RNA molecule, e.g., one, two, three, or four of the listed components.
- the segments comprised in (2) may be produced in further segmented molecules, e.g., split into at least 2, at least 3, at least 4, or at least 5 or more sub-segments, e.g., that are subsequently assembled, e.g., by one or more methods described herein.
- RNA segments may be produced by chemical synthesis.
- RNA segments may be produced by in vitro transcription of a nucleic acid template, e.g., by providing an RNA polymerase to act on a cognate promoter of a DNA template to produce an RNA transcript.
- in vitro transcription is performed using, e.g., a T7, T3, or SP6 RNA polymerase, or a derivative thereof, acting on a DNA, e.g., dsDNA, ssDNA, linear DNA, plasmid DNA, linear DNA amplicon, linearized plasmid DNA, e.g., encoding the RNA segment, e.g., under transcriptional control of a cognate promoter, e.g., a T7, T3, or SP6 promoter.
- a combination of chemical synthesis and in vitro transcription is used to generate the RNA segments for assembly.
- the gRNA, upstream target homology, and Gene Writer polypeptide binding segments are produced by chemical synthesis and the heterologous object sequence segment is produced by in vitro transcription.
- in vitro transcription may be better suited for the production of longer RNA molecules.
- reaction temperature for in vitro transcription may be lowered, e.g., be less than 37°C (e.g., between 0-10C, 10-20C, or 20- 30C), to result in a higher proportion of full-length transcripts (Krieg Nucleic Acids Res 18:6463 (1990)).
- a protocol for improved synthesis of long transcripts is employed to synthesize a long template RNA, e.g., a template RNA greater than 5 kb, such as the use of e.g., T7 RiboMAX Express, which can generate 27 kb transcripts in vitro (Thiel et al. J Gen Virol 82(6):1273-1281 (2001)).
- modifications to RNA molecules as described herein may be incorporated during synthesis of RNA segments (e.g., through the inclusion of modified nucleotides or alternative binding chemistries), following synthesis of RNA segments through chemical or enzymatic processes, following assembly of one or more RNA segments, or a combination thereof.
- an mRNA of the system e.g., an mRNA encoding a Gene Writer polypeptide
- a Gene Writer polypeptide is synthesized in vitro using T7 polymerase-mediated DNA-dependent RNA transcription from a linearized DNA template, where UTP is optionally substituted with 1- methylpseudoUTP.
- the transcript incorporates 5′ and 3′ UTRs, e.g., GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACC and UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCUCCCCCC AGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGA, or functional fragments or variants thereof, and optionally includes a poly-A tail, which can be encoded in the DNA template or added enzymatically following transcription.
- UTRs e.g., GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACC and UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCUCCCCCCCC
- AGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGA or functional fragments or variants thereof, and optionally includes a
- a donor methyl group e.g., S-adenosylmethionine
- a donor methyl group is added to a methylated capped RNA with cap 0 structure to yield a cap 1 structure that increases mRNA translation efficiency (Richner et al. Cell 168(6): P1114-1125 (2017)).
- the transcript from a T7 promoter starts with a GGG motif. In some embodiments, a transcript from a T7 promoter does not start with a GGG motif.
- RNA segments may be connected to each other by covalent coupling.
- an RNA ligase e.g., T4 RNA ligase
- T4 RNA ligase may be used to connect two or more RNA segments to each other.
- a reagent such as an RNA ligase
- a 5′ terminus is typically linked to a 3′ terminus.
- there are two possible linear constructs that can be formed i.e., (1) 5′-Segment 1-Segment 2-3′ and (2) 5′-Segment 2-Segment 1-3′).
- intramolecular circularization can also occur.
- compositions and methods for the covalent connection of two nucleic acid (e.g., RNA) segments are disclosed, for example, in US20160102322A1 (incorporated herein by reference in its entirety), along with methods including the use of an RNA ligase to directionally ligate two single-stranded RNA segments to each other.
- RNA ligase One example of an end blocker that may be used in conjunction with, for example, T4 RNA ligase, is a dideoxy terminator.
- T4 RNA ligase typically catalyzes the ATP- dependent ligation of phosphodiester bonds between 5′-phosphate and 3′-hydroxyl termini.
- T4 RNA ligase when T4 RNA ligase is used, suitable termini must be present on the termini being ligated.
- One means for blocking T4 RNA ligase on a terminus comprises failing to have the correct terminus format.
- termini of RNA segments with a 5-hydroxyl or a 3′- phosphate will not act as substrates for T4 RNA ligase.
- Additional exemplary methods that may be used to connect RNA segments is by click chemistry (e.g., as described in U.S. Patent Nos.7,375,234 and 7,070,941, and US Patent Publication No.2013/0046084, the entire disclosures of which are incorporated herein by reference).
- one exemplary click chemistry reaction is between an alkyne group and an azide group (see FIG.11 of US20160102322A1, which is incorporated herein by reference in its entirety).
- Any click reaction may potentially be used to link RNA segments (e.g., Cu-azide- alkyne, strain-promoted-azide-alkyne, staudinger ligation, tetrazine ligation, photo-induced tetrazole-alkene, thiol-ene, NHS esters, epoxides, isocyanates, and aldehyde-aminooxy).
- RNA segments e.g., Cu-azide- alkyne, strain-promoted-azide-alkyne, staudinger ligation, tetrazine ligation, photo-induced tetrazole-alkene, thiol-ene, NHS esters, epoxides, isocyanates, and
- RNA segments may be connected using an Azide-Alkyne Huisgen Cycloaddition. reaction, which is typically a 1,3-dipolar cycloaddition between an azide and a terminal or internal alkyne to give a 1,2,3-triazole for the ligation of RNA segments.
- Azide-Alkyne Huisgen Cycloaddition. reaction which is typically a 1,3-dipolar cycloaddition between an azide and a terminal or internal alkyne to give a 1,2,3-triazole for the ligation of RNA segments.
- this ligation method may be that this reaction can initiated by the addition of required Cu(I) ions.
- halogens F—, Br—, I—
- one RNA molecule may be modified with thiol at 3′ (using disulfide amidite and universal support or disulfide modified support), and the other RNA molecule may be modified with acrydite at 5′ (using acrylic phosphoramidite), then the two RNA molecules can be connected by a Michael addition reaction.
- This strategy can also be applied to connecting multiple RNA molecules stepwise.
- RNA molecules are also provided.
- this may be useful when a desired RNA molecule is longer than about 40 nucleotides, e.g., such that chemical synthesis efficiency degrades, e.g., as noted in US20160102322A1 (incorporated herein by reference in its entirety).
- a tracrRNA is typically around 80 nucleotides in length.
- Such RNA molecules may be produced, for example, by processes such as in vitro transcription or chemical synthesis.
- RNA segments 1 and 2 when chemical synthesis is used to produce such RNA molecules, they may be produced as a single synthesis product or by linking two or more synthesized RNA segments to each other. In embodiments, when three or more RNA segments are connected to each other, different methods may be used to link the individual segments together. Also, the RNA segments may be connected to each other in one pot (e.g., a container, vessel, well, tube, plate, or other receptacle), all at the same time, or in one pot at different times or in different pots at different times. In a non-limiting example, to assemble RNA Segments 1, 2 and 3 in numerical order, RNA Segments 1 and 2 may first be connected, 5′ to 3′, to each other.
- a container, vessel, well, tube, plate, or other receptacle e.g., a container, vessel, well, tube, plate, or other receptacle
- RNA Segment 1 (about 30 nucleotides) is the target locus recognition sequence of a crRNA and a portion of Hairpin Region 1.
- RNA Segment 2 (about 35 nucleotides) contains the remainder of Hairpin Region 1 and some of the linear tracrRNA between Hairpin Region 1 and Hairpin Region 2.
- RNA Segment 3 (about 35 nucleotides) contains the remainder of the linear tracrRNA between Hairpin Region 1 and Hairpin Region 2 and all of Hairpin Region 2.
- RNA Segments 2 and 3 are linked, 5′ to 3′, using click chemistry. Further, the 5′ and 3′ end termini of the reaction product are both phosphorylated.
- the reaction product is then contacted with RNA Segment 1, having a 3′ terminal hydroxyl group, and T4 RNA ligase to produce a guide RNA molecule.
- a number of additional linking chemistries may be used to connect RNA segments according to method of the invention. Some of these chemistries are set out in Table 6 of US20160102322A1, which is incorporated herein by reference in its entirety.
- DNA binding domain In certain aspects, the DNA-binding domain of a Gene Writer polypeptide described herein is selected, designed, or constructed for binding to a desired host DNA target sequence. In certain embodiments, the DNA-binding domain of the engineered retrotransposon is a heterologous DNA-binding protein or domain relative to a native retrotransposon sequence. In some embodiments, the heterologous DNA binding element is a zinc-finger element or a TAL effector element, e.g., a zinc-finger or TAL polypeptide or functional fragment thereof.
- the heterologous DNA binding element is a sequence-guided DNA binding element, such as Cas9, Cpf1, or other CRISPR-related protein that has been altered to have no endonuclease activity.
- the heterologous DNA binding element retains endonuclease activity.
- the heterologous DNA binding element replaces the endonuclease element of the polypeptide.
- the heterologous DNA- binding domain can be any one or more of Cas9 (e.g., Cas9, Cas9 nickase, dCas9), TAL domain, zinc finger (ZF) domain, Myb domain, combinations thereof, or multiples thereof.
- the heterologous DNA-binding domain is a DNA binding domain of a retrotransposon described in Table X, Table Z1, Table Z2, or Table 3A or 3B.
- DNA binding domains can be identified based upon homology to other known DNA binding domains using tools as Basic Local Alignment Search Tool (BLAST).
- BLAST Basic Local Alignment Search Tool
- DNA-binding domains are modified, for example by site-specific mutation, increasing or decreasing DNA-binding elements (for example, number and/or specificity of zinc fingers), etc., to alter DNA-binding specificity and affinity.
- the DNA binding domain is altered from its natural sequence to have altered codon usage, e.g. improved for human cells.
- the DNA binding domain comprises a meganuclease domain (e.g., as described herein, e.g., in the endonuclease domain section), or a functional fragment thereof.
- the meganuclease domain possesses endonuclease activity, e.g., double- strand cleavage and/or nickase activity.
- the meganuclease domain has reduced activity, e.g., lacks endonuclease activity, e.g., the meganuclease is catalytically inactive.
- a catalytically inactive meganuclease is used as a DNA binding domain, e.g., as described in Fonfara et al. Nucleic Acids Res 40(2):847-860 (2012), incorporated herein by reference in its entirety.
- the DNA binding domain comprises one or more modifications relative to a wild-type DNA binding domain, e.g., a modification via directed evolution, e.g., phage-assisted continuous evolution (PACE).
- PACE phage-assisted continuous evolution
- the host DNA-binding site integrated into by the Gene Writer system can be in a gene, in an intron, in an exon, an ORF, outside of a coding region of any gene, in a regulatory region of a gene, or outside of a regulatory region of a gene.
- the engineered retrotransposon may bind to one or more than one host DNA sequence.
- the engineered retrotransposon may have low sequence specificity, e.g., bind to multiple sequences or lack sequence preference.
- a Gene Writing system is used to edit a target locus in multiple alleles.
- a Gene Writing system is designed to edit a specific allele.
- a Gene Writing polypeptide may be directed to a specific sequence that is only present on one allele, e.g., comprises a template RNA with homology to a target allele, e.g., a gRNA or annealing domain, but not to a second cognate allele.
- a Gene Writing system can alter a haplotype-specific allele.
- a Gene Writing system that targets a specific allele preferentially targets that allele, e.g., has at least a 2, 4, 6, 8, or 10-fold preference for a target allele.
- a Gene WriterTM gene editor system RNA further comprises an intracellular localization sequence, e.g., a nuclear localization sequence.
- the nuclear localization sequence may be an RNA sequence that promotes the import of the RNA into the nucleus.
- the nuclear localization signal is located on the template RNA.
- the retrotransposase polypeptide is encoded on a first RNA, and the template RNA is a second, separate, RNA, and the nuclear localization signal is located on the template RNA and not on an RNA encoding the retrotransposase polypeptide.
- the RNA encoding the retrotransposase is targeted primarily to the cytoplasm to promote its translation, while the template RNA is targeted primarily to the nucleus to promote its retrotransposition into the genome.
- the nuclear localization signal is at the 3’ end, 5’ end, or in an internal region of the template RNA. In some embodiments the nuclear localization signal is 3’ of the heterologous sequence (e.g., is directly 3’ of the heterologous sequence) or is 5’ of the heterologous sequence (e.g., is directly 5’ of the heterologous sequence). In some embodiments the nuclear localization signal is placed outside of the 5’ UTR or outside of the 3’ UTR of the template RNA.
- the nuclear localization signal is placed between the 5’ UTR and the 3’ UTR, wherein optionally the nuclear localization signal is not transcribed with the transgene (e.g., the nuclear localization signal is an anti-sense orientation or is downstream of a transcriptional termination signal or polyadenylation signal).
- the nuclear localization sequence is situated inside of an intron.
- a plurality of the same or different nuclear localization signals are in the RNA, e.g., in the template RNA.
- the nuclear localization signal is less than 5, 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900 or 1000 bp in legnth.
- RNA nuclear localization sequences can be used. For example, Lubelsky and Ulitsky, Nature 555 (107-111), 2018 describe RNA sequences which drive RNA localization into the nucleus.
- the nuclear localization signal is a SINE-derived nuclear RNA localization (SIRLOIN) signal.
- the nuclear localization signal binds a nuclear-enriched protein.
- the nuclear localization signal binds the HNRNPK protein.
- the nuclear localization signal is rich in pyrimidines, e.g., is a C/T rich, C/U rich, C rich, T rich, or U rich region.
- the nuclear localization signal is derived from a long non-coding RNA.
- the nuclear localization signal is derived from MALAT1 long non-coding RNA or is the 600 nucleotide M region of MALAT1 (described in Miyagawa et al., RNA 18, (738-751), 2012).
- the nuclear localization signal is derived from BORG long non-coding RNA or is a AGCCC motif (described in Zhang et al., Molecular and Cellular Biology 34, 2318-2329 (2014).
- the nuclear localization sequence is described in Shukla et al., The EMBO Journal e98452 (2016).
- the nuclear localization signal is derived from a non-LTR retrotransposon, an LTR retrotransposon, retrovirus, or an endogenous retrovirus.
- a polypeptide described herein comprises one or more (e.g., 2, 3, 4, 5) nuclear targeting sequences, for example, a nuclear localization sequence (NLS), e.g., as described above.
- NLS nuclear localization sequence
- the NLS is a bipartite NLS.
- an NLS facilitates the import of a protein comprising an NLS into the cell nucleus.
- the NLS is fused to the N-terminus of a Gene Writer described herein.
- the NLS is fused to the C-terminus of the Gene Writer. In some embodiments, the NLS is fused to the N-terminus or the C-terminus of a Cas domain. In some embodiments, a linker sequence is disposed between the NLS and theneighboring domain of the Gene Writer.
- an NLS comprises the amino acid sequence MDSLLMNRRKFLYQFKNVRWAKGRRETYLC, PKKRKVEGADKRTADGSEFESPKKKRKV, RKSGKIAAIWKRPRKPKKKRKV KRTADGSEFESPKKKRKV, KKTELQTTNAENKTKKL, or KRGINDRNFWRGENGRKTR, KRPAATKKAGQAKKKK, or a functional fragment or variant thereof.
- Exemplary NLS sequences are also described in PCT/EP2000/011690, the contents of which are incorporated herein by reference for their disclosure of exemplary nuclear localization sequences.
- an NLS comprises an amino acid sequence as disclosed in Table 8.
- An NLS of this table may be utilized with one or more copies in a polypeptide in one or more locations in a polypeptide, e.g., 1, 2, 3 or more copies of an NLS in an N-terminal domain, between peptide domains, in a C-terminal domain, or in a combination of locations, in order to improve subcellular localization to the nucleus.
- Multiple unique sequences may be used within a single polypeptide. Sequences may be naturally monopartite or bipartite, e.g., having one or two stretches of basic amino acids, or may be used as chimeric bipartite sequences.
- the NLS is a bipartite NLS.
- a bipartite NLS typically comprises two basic amino acid clusters separated by a spacer sequence (which may be, e.g., about 10 amino acids in length).
- a monopartite NLS typically lacks a spacer.
- An example of a bipartite NLS is the nucleoplasmin NLS, having the sequence KR[PAATKKAGQA]KKKK, wherein the spacer is bracketed.
- Another exemplary bipartite NLS has the sequence PKKKRKVEGADKRTADGSEFESPKKKRKV.
- Exemplary NLSs are described in International Application WO2020051561, which is herein incorporated by reference in its entirety, including for its disclosures regarding nuclear localization sequences.
- a Gene WriterTM gene editor system polypeptide further comprises an intracellular localization sequence, e.g., a nuclear localization sequence and/or a nucleolar localization sequence.
- the nuclear localization sequence and/or nucleolar localization sequence may be amino acid sequences that promote the import of the protein into the nucleus and/or nucleolus, where it can promote integration of heterologous sequyence into the genome.
- a Gene Writer gene editor system polypeptide e.g., a retrotransposase, e.g., a polypeptide according to any of Tables 1, 2, 3A, or 3B herein
- the retrotransposase polypeptide is encoded on a first RNA
- the template RNA is a second, separate, RNA
- the nucleolar localization signal is encoded on the RNA encoding the retrotransposase polypeptide and not on the template RNA.
- the nucleolar localization signal is located at the N- terminus, C-terminus, or in an internal region of the polypeptide.
- a plurality of the same or different nucleolar localization signals are used.
- the nuclear localization signal is less than 5, 10, 25, 50, 75, or 100 amino acids in length.
- Various polypeptide nucleolar localization signals can be used.
- the nucleolar localization signal may also be a nuclear localization signal.
- the nucleolar localization signal may overlap with a nuclear localization signal.
- the nucleolar localization signal may comprise a stretch of basic residues.
- the nucleolar localization signal may be rich in arginine and lysine residues.
- the nucleolar localization signal may be derived from a protein that is enriched in the nucleolus.
- the nucleolar localization signal may be derived from a protein enriched at ribosomal RNA loci. In some embodiments, the nucleolar localization signal may be derived from a protein that binds rRNA. In some embodiments, the nucleolar localization signal may be derived from MSP58. In some embodiments, the nucleolar localization signal may be a monopartite motif. In some embodiments, the nucleolar localization signal may be a bipartite motif. In some embodiments, the nucleolar localization signal may consist of a multiple monopartite or bipartite motifs. In some embodiments, the nucleolar localization signal may consist of a mix of monopartite and bipartite motifs.
- the nucleolar localization signal may be a dual bipartite motif.
- the nucleolar localization motif may be a KRASSQALGTIPKRRSSSRFIKRKK (SEQ ID NO: 1530).
- the nucleolar localization signal may be derived from nuclear factor- ⁇ B-inducing kinase.
- the nucleolar localization signal may be an RKKRKKK motif (SEQ ID NO: 1531) (described in Birbach et al., Journal of Cell Science, 117 (3615-3624), 2004).
- a nucleic acid described herein (e.g., an RNA encoding a GeneWriter polypeptide, or a DNA encoding the RNA) comprises a microRNA binding site.
- the microRNA binding site is used to increase the target-cell specificity of a GeneWriter system.
- the microRNA binding site can be chosen on the basis that is is recognized by a miRNA that is present in a non-target cell type, but that is not present (or is present at a reduced level relative to the non-target cell) in a target cell type.
- RNA encoding the GeneWriter polypeptide when the RNA encoding the GeneWriter polypeptide is present in a non-target cell, it would be bound by the miRNA, and when the RNA encoding the GeneWriter polypeptide is present in a target cell, it would not be bound by the miRNA (or bound but at reduced levels relative to the non-target cell). While not wishing to be bound by theory, binding of the miRNA to the RNA encoding the GeneWriter polypeptide may reduce production of the GeneWriter polypeptide, e.g., by degrading the mRNA encoding the polypeptide or by interfering with translation. Accordingly, the heterologous object sequence would be inserted into the genome of target cells more efficiently than into the genome of non-target cells.
- a system having a microRNA binding site in the RNA encoding the GeneWriter polypeptide (or encoded in the DNA encoding the RNA) may also be used in combination with a template RNA that is regulated by a second microRNA binding site, e.g., as described herein in the section entitled “Template RNA component of Gene WriterTM gene editor system.”
- a second microRNA binding site e.g., as described herein in the section entitled “Template RNA component of Gene WriterTM gene editor system.”
- the nucleic acid and corresponding polypeptide sequences of each retrotransposon and domains thereof can be determined, e.g., by using routine sequence analysis tools as Basic Local Alignment Search Tool (BLAST) or CD-Search for conserved domain analysis.
- BLAST Basic Local Alignment Search Tool
- CD-Search conserved domain analysis.
- sequence analysis tools are known and can be found, e.g., at https://molbiol-tools.ca, for example, at https://molbiol- tools.ca/Motifs.htm.
- SEQ ID NOs 113-1015 align with the first 903 rows of Table 2.
- Tables X, 3A, and 3B herein provide the sequences of exemplary transposons, including the amino acid sequence of the retrotransposase, and sequences of 5’ and 3’ untranslated regions to allow the retrotransposase to bind the template RNA.
- a 5’ UTR of any of Table X, Z1, Z2, 3A, or 3B allows the retrotransposase to bind the template RNA.
- a 3’ UTR of any of Tables X, 3A, and 3B allows the retrotransposase to bind the template RNA.
- a polypeptide for use in any of the systems described herein can be a polypeptide of any of Tables X, 3A, and 3B herein, or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto.
- the system further comprises one or both of a 5’ or 3’ untranslated region of any of Tables X, 3A, and 3B herein (or a sequence having at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereto), e.g., from the same retrotransposon as the polypeptide referred to in the preceding sentence, as indicated in the same row of the same table.
- the system comprises one or both of a 5’ or 3’ untranslated region of any of Tables X, 3A, and 3B herein, e.g., a segment of the full retrotransposon sequence that encodes an RNA that is capable of binding a retrotransposase, and/or the sub-sequence provided in the column entitled Predicted 5’ UTR or Predicted 3’ UTR.
- a polypeptide for use in any of the systems described herein can be a molecular reconstruction or ancestral reconstruction based upon the aligned polypeptide sequence of multiple retrotransposons.
- a 5’ or 3’ untranslated region for use in any of the systems described herein can be a molecular reconstruction based upon the aligned 5’ or 3’ untranslated region of multiple retrotransposons.
- polypeptides or nucleic acid sequences can be aligned, e.g., by using routine sequence analysis tools as Basic Local Alignment Search Tool (BLAST) or CD-Search for conserved domain analysis.
- BLAST Basic Local Alignment Search Tool
- CD-Search conserved domain analysis.
- Molecular reconstructions can be created based upon sequence consensus, e.g. using approaches described in Ivics et al., Cell 1997, 501 – 510 ; Wagstaff et al., Molecular Biology and Evolution 2013, 88-99.
- the retrotransposon from which the 5’ or 3’ untranslated region or polypeptide is derived is a young or a recently active mobile element, as assessed via phylogenetic methods such as those described in Boissinot et al., Molecular Biology and Evolution 2000, 915-928.
- Table Z1 Exemplary reverse transcriptase domains from different types of sources. Sources include Group II intron, non-LTR retrotransposon, retrovirus, LTR retrotransposon, diversity-generating retroelement, retron, telomerase, retroplasmid, and evolved DNA polymerase. Also included are the associated RT signatures from the InterPro, pfam, and cd databases. Although the evolved polymerase RTX can perform RNA-dependent DNA polymerization, no RT signatures were identified by InterProScan, so polymerase signatures are included instead.
- Table Z2 InterPro descriptions of signatures present in reverse transcriptases in Table Z1, as of March 4, 2020.
- Tables 3A and 3B show exemplary Gene Writer proteins and associated sequences from a variety of retrotransposases, identified using data mining. Column 1 indicates the family to which the retrotransposon belongs. Column 2 lists the element name. Column 3 indicates an accession number, if any. Column 4 lists an organism in which the retrotransposase is found. Column 5 lists the predicted 5’ untranslated region, and column 6 lists the predicted 3’ untranslated region; both are segments that are predicted to allow the template RNA to bind the retrotransposase of column 7.
- column 7 lists the predicted retrotransposase amino acid sequence.
- column 8 lists the predicted RT domain present based on sequence analysis
- column 9 lists the start codon position
- column 10 lists the stop codon position.
- A9 A7 A2 A1 A AOA N ADA I AQT ET S A ( T AC AAAT AA AAA G : AOAA N G T G T A T C AT D I GT GAGAGAT AAT T T C T GAAAA A T AAAA TAQ AA GT T ATT GT T T T AGT T C T AC T T T AT ATT AGGT T AGT C AT AAAAT ES AT GCT T GAC AAT AAC ( ) A 6 T T T ACT GT A AT GT T T C
- AAC TAT AC C CGG GTGAGGT CAGCTG CAGTC C CC C GGGGGAGAGCT TC GGACT G G GC C
- CAGCSAGGAC GC AG GGGCGAC GT AGAAGAC A C AGT GS GTC T T GT CGGC C AAGA C G G
- N G ROW N T I DT I FAQS ES V ( NSC T P I KS GGWY I D L I F G A L GMWKTYDAA V L RSKDYAG V D I YVD K L YVKP V I SFKK Q L QRQSD A E L D K L E S ) HH9 RP 5 S I A L 41 CC GCGC TGC CAATC C AC ATAT GT C GT GGC C ATC GGGGC GTAAATC GC T GTGTC CT A A GGGAT TT CC A ACGC GTAC GA A GGT C T GT G I GG T GT CC AGC GT AGAT AC GC C Q T GGT T GAC GC AC GGC C T GGT AAGE AGTT GAGGGAT AT GGGAT AT C AGC S AAT AC T AA AC C C AGGC CC GGG ( T ) TT AGC GGGT GT T GC AAT T AGAAAT 4 GACT T GCC C GGAGGC GAT GGT G12 AT A
- IPSC YCDTHFRPV R L CGS D I QRTHHEHVD P T GC AAT TT C G T T A
- C A T C A s i a r i l h s s a e l p n u a l d p o s u o a o x I c s r m D i s 82 2 9 8 8 3 2 4 0 0 0 0 _ _ F 2 A 1 .
- AACTAACTAACTAACAA A A A GC T G T GT T C AT GT G C A A G AT C i a c i s a c a s f e a f u e x u e q n x q l u i C u s e l n i q u s t u C u q u t 19 1 0 9 2 0 0 2 0 0 0 0 _ 0 FC 1 . _F 5 C 1 . G 8 G58 Q Q C_ C_ 6- 3 B -E 2 L T R
- a AAAGCATGTC G T C A AGC AG C G T T C AA C GGT T AA AC A C G G A A AG T G s s u l i p a o i c n p e o X r t 1400000_FC 4 .
- CAGTATGTTTTGTTTCGC AACACATCAACC A C C CC AC C GAGC CC GC GGAAT ACC AAT ACC CC CT GAAGT AC AC T GGAAG AG C A AC C A G A G AA T T C A AC T AC C A C G G A G A A AA C AT C A A G GA T A A GA T A
- GGC AAGAGAGT G AGGACC A C GGGGG C G GG T GGT C AC GA AA AC A AGGAGGAGT CT C AT AG C C C CC GAC C C C AC GC C AT CC GG A AGC C AT T T GAG AC T GAGT T ACC AC G T C TC C GC C GT GG G C GGCT AC AT C AC AT AT A AGC AG T GGGTT G AGA GGG AGC GT C GAA T C GT AA G C GC AGAAAGAA C GG GC G T AT G G T AT GT G AC T AGC T CT A GC T CGAT C C T GT GAAAC T GC AAAAAT AC AAA C C C AAAG T AGGGC GGAC AGC AGC CT C A T GG T C T GC C GGG GC T C T CCA GG C AGAT AGC C GC GGC A AC AC C A C GCAGC GGAT GAC G GGAG C AC C AT AGC AAAACT AAAT
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Plant Pathology (AREA)
- Biophysics (AREA)
- Physics & Mathematics (AREA)
- Crystallography & Structural Chemistry (AREA)
- Mycology (AREA)
- Cell Biology (AREA)
- Enzymes And Modification Thereof (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Compositions Of Macromolecular Compounds (AREA)
- Peptides Or Proteins (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Cosmetics (AREA)
- Toys (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IL296095A IL296095A (en) | 2020-03-04 | 2021-03-04 | Improved methods and compositions for genome modulation |
| EP21764647.0A EP4114941A4 (en) | 2020-03-04 | 2021-03-04 | IMPROVED METHODS AND COMPOSITIONS FOR MODULATING A GENOME |
| BR112022017736A BR112022017736A2 (pt) | 2020-03-04 | 2021-03-04 | Métodos e composições aprimorados para modular um genoma |
| CN202180035530.8A CN116209770A (zh) | 2020-03-04 | 2021-03-04 | 用于调控基因组的改善的方法和组合物 |
| JP2022552817A JP2023517294A (ja) | 2020-03-04 | 2021-03-04 | ゲノムを調節するための改善された方法及び組成物 |
| KR1020227034440A KR20230053735A (ko) | 2020-03-04 | 2021-03-04 | 게놈의 조정을 위한 개선된 방법 및 조성물 |
| CA3174483A CA3174483A1 (en) | 2020-03-04 | 2021-03-04 | Improved methods and compositions for modulating a genome |
| AU2021230545A AU2021230545A1 (en) | 2020-03-04 | 2021-03-04 | Improved methods and compositions for modulating a genome |
| US17/929,455 US12565666B2 (en) | 2020-03-04 | 2022-09-02 | Methods and compositions for modulating a genome |
| US18/467,392 US12065669B2 (en) | 2020-03-04 | 2023-09-14 | Methods and compositions for modulating a genome |
| US18/467,428 US12037602B2 (en) | 2020-03-04 | 2023-09-14 | Methods and compositions for modulating a genome |
| JP2025141096A JP2025172847A (ja) | 2020-03-04 | 2025-08-27 | ゲノムを調節するための改善された方法及び組成物 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US202062985264P | 2020-03-04 | 2020-03-04 | |
| US62/985,264 | 2020-03-04 | ||
| US202063035674P | 2020-06-05 | 2020-06-05 | |
| US63/035,674 | 2020-06-05 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/929,455 Continuation US12565666B2 (en) | 2020-03-04 | 2022-09-02 | Methods and compositions for modulating a genome |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2021178717A2 true WO2021178717A2 (en) | 2021-09-10 |
| WO2021178717A9 WO2021178717A9 (en) | 2022-03-17 |
Family
ID=77613826
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2021/020943 Ceased WO2021178717A2 (en) | 2020-03-04 | 2021-03-04 | Improved methods and compositions for modulating a genome |
Country Status (10)
| Country | Link |
|---|---|
| US (3) | US12565666B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4114941A4 (cg-RX-API-DMAC7.html) |
| JP (2) | JP2023517294A (cg-RX-API-DMAC7.html) |
| KR (1) | KR20230053735A (cg-RX-API-DMAC7.html) |
| CN (1) | CN116209770A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2021230545A1 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112022017736A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3174483A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL296095A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2021178717A2 (cg-RX-API-DMAC7.html) |
Cited By (30)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN113755627A (zh) * | 2021-09-24 | 2021-12-07 | 广西大学 | 一种基于顺式调控元件的引物及其设计方法和在分子标记中的应用 |
| CN114277119A (zh) * | 2021-12-09 | 2022-04-05 | 浙江大学医学院附属邵逸夫医院 | 一种环状RNA circ-Arsb在制备防治骨质疏松产品中的应用 |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| CN116064797A (zh) * | 2022-08-29 | 2023-05-05 | 广州达健生物科技有限公司 | 一种子宫内膜癌基因甲基化水平检测试剂及其应用 |
| CN116179513A (zh) * | 2023-03-10 | 2023-05-30 | 之江实验室 | 一种Cpf1蛋白及其在基因编辑中的应用 |
| US11672874B2 (en) | 2019-09-03 | 2023-06-13 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| CN116334141A (zh) * | 2022-08-04 | 2023-06-27 | 北京中因科技有限公司 | 基于基因编辑的RHO-R135W-adRP基因编辑药物 |
| CN116523902A (zh) * | 2023-06-21 | 2023-08-01 | 湖南盛鼎科技发展有限责任公司 | 基于改进yolov5的电子粉涂敷均匀检测方法及设备 |
| WO2023212724A3 (en) * | 2022-04-28 | 2023-11-30 | Flagship Pioneering Innovations Vi, Llc | Compositions and methods for modulating a genome in t cells, induced pluripotent stem cells, and respiratory epithelial cells |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US11932884B2 (en) | 2017-08-30 | 2024-03-19 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| WO2024131786A1 (zh) * | 2022-12-19 | 2024-06-27 | 北京干细胞与再生医学研究院 | 一种在基因组插入大片段dna的系统 |
| US12031129B2 (en) | 2018-08-28 | 2024-07-09 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12037602B2 (en) | 2020-03-04 | 2024-07-16 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12043852B2 (en) | 2015-10-23 | 2024-07-23 | President And Fellows Of Harvard College | Evolved Cas9 proteins for gene editing |
| WO2024137990A3 (en) * | 2022-12-21 | 2024-08-02 | Trustees Of Boston University | Compositions and methods for controlled mrna translation and stability |
| WO2024086669A3 (en) * | 2022-10-19 | 2024-09-12 | Metagenomi, Inc. | Gene editing systems comprising reverse transcriptases |
| WO2024220741A1 (en) | 2023-04-19 | 2024-10-24 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for the production of libraries |
| WO2025006419A1 (en) | 2023-06-26 | 2025-01-02 | Flagship Pioneering Innovations Vii, Llc | Engineered plasmodia and related methods |
| WO2024196963A3 (en) * | 2023-03-21 | 2025-02-06 | The Regents Of The University Of California | Compositions and methods for genome editing |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12319925B2 (en) | 2021-05-11 | 2025-06-03 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| EP4519424A4 (en) * | 2022-05-02 | 2025-09-24 | Univ California | MULTI-COMPONENT SYSTEMS FOR SITE-SPECIFIC GENOME MODIFICATIONS |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US12529041B2 (en) | 2018-09-07 | 2026-01-20 | Beam Therapeutics Inc. | Compositions and methods for delivering a nucleobase editing system |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN116209756A (zh) | 2020-03-04 | 2023-06-02 | 旗舰先锋创新Vi有限责任公司 | 调控基因组的方法和组合物 |
| CA3231712A1 (en) | 2021-09-08 | 2023-03-16 | Flagship Pioneering Innovations Vi, Llc | Pah-modulating compositions and methods |
| AU2022343268A1 (en) | 2021-09-08 | 2024-03-28 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| WO2023108153A2 (en) | 2021-12-10 | 2023-06-15 | Flagship Pioneering Innovations Vi, Llc | Cftr-modulating compositions and methods |
| CN119286819A (zh) * | 2023-07-10 | 2025-01-10 | 北京干细胞与再生医学研究院 | 工程化的哺乳动物基因写入系统 |
Family Cites Families (79)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20030121063A1 (en) | 1995-11-16 | 2003-06-26 | The Trustees Of The University Of Pennsylvania | Compositions and methods of use of mammalian retrotransposons |
| US6693086B1 (en) | 1998-06-25 | 2004-02-17 | National Jewish Medical And Research Center | Systemic immune activation method using nucleic acid-lipid complexes |
| US20060183226A1 (en) | 2002-01-31 | 2006-08-17 | Haruhiko Fujiwara | Methods for retrotransposing long interspersed elements (lines) |
| WO2004072290A1 (en) | 2003-02-07 | 2004-08-26 | The Administrators Of The Tulane Educational Fund | Mammalian retrotransposable elements |
| JPWO2005054463A1 (ja) | 2003-11-21 | 2007-12-06 | 財団法人大阪産業振興機構 | レトロトランスポゾンを用いた哺乳動物のゲノム改変技術の開発 |
| US20110171729A1 (en) | 2006-05-04 | 2011-07-14 | Ab Maxis Inc. | Method for Producing Stable Mammalian Cell Lines Producing High Levels of Recombinant Proteins |
| EP2055784A1 (en) | 2007-10-31 | 2009-05-06 | Bundesrepublik Deutschland, letztvertreten durch den Präsidenten des Paul-Ehrlich-Instituts Prof. Dr. Johannes Löwer | Controlled activation of non-LTR retrotransposons in mammals |
| US8889394B2 (en) | 2009-09-07 | 2014-11-18 | Empire Technology Development Llc | Multiple domain proteins |
| US20140113375A1 (en) | 2012-10-21 | 2014-04-24 | Lixin Liu | Transient Expression And Reverse Transcription Aided Genome Alteration System |
| US20140186843A1 (en) | 2012-12-12 | 2014-07-03 | Massachusetts Institute Of Technology | Methods, systems, and apparatus for identifying target sequences for cas enzymes or crispr-cas systems for target sequences and conveying results thereof |
| CN113355357B (zh) | 2012-12-12 | 2024-12-03 | 布罗德研究所有限公司 | 对用于序列操纵的改进的系统、方法和酶组合物进行的工程化和优化 |
| RU2662932C2 (ru) | 2013-03-14 | 2018-07-31 | Карибо Биосайенсиз, Инк. | Композиции и способы с участием нуклеиновых кислот, нацеленных на нуклеиновые кислоты |
| US20140349400A1 (en) | 2013-03-15 | 2014-11-27 | Massachusetts Institute Of Technology | Programmable Modification of DNA |
| US9228207B2 (en) | 2013-09-06 | 2016-01-05 | President And Fellows Of Harvard College | Switchable gRNAs comprising aptamers |
| CN106459995B (zh) | 2013-11-07 | 2020-02-21 | 爱迪塔斯医药有限公司 | 使用统治型gRNA的CRISPR相关方法和组合物 |
| EP3155116A4 (en) | 2014-06-10 | 2017-12-27 | Massachusetts Institute Of Technology | Method for gene editing |
| EP3183358B1 (en) | 2014-08-19 | 2020-10-07 | President and Fellows of Harvard College | Rna-guided systems for probing and mapping of nucleic acids |
| EP3188763B1 (en) | 2014-09-02 | 2020-05-13 | The Regents of The University of California | Methods and compositions for rna-directed target dna modification |
| WO2016065364A1 (en) | 2014-10-24 | 2016-04-28 | Life Technologies Corporation | Compositions and methods for enhancing homologous recombination |
| CN108026526B (zh) | 2015-06-09 | 2023-05-12 | 爱迪塔斯医药公司 | 用于改善移植的crispr/cas相关方法和组合物 |
| WO2016205728A1 (en) | 2015-06-17 | 2016-12-22 | Massachusetts Institute Of Technology | Crispr mediated recording of cellular events |
| EP3356520B1 (en) | 2015-10-02 | 2022-03-23 | The U.S.A. as represented by the Secretary, Department of Health and Human Services | Lentiviral protein delivery system for rna-guided genome editing |
| US11427837B2 (en) | 2016-01-12 | 2022-08-30 | The Regents Of The University Of California | Compositions and methods for enhanced genome editing |
| US20170275665A1 (en) * | 2016-02-24 | 2017-09-28 | Board Of Regents, The University Of Texas System | Direct crispr spacer acquisition from rna by a reverse-transcriptase-cas1 fusion protein |
| US11447768B2 (en) | 2016-03-01 | 2022-09-20 | University Of Florida Research Foundation, Incorporated | Molecular cell diary system |
| WO2017173004A1 (en) | 2016-03-30 | 2017-10-05 | Mikuni Takayasu | A method for in vivo precise genome editing |
| EP3443088B1 (en) | 2016-04-13 | 2024-09-18 | Editas Medicine, Inc. | Grna fusion molecules, gene editing systems, and methods of use thereof |
| EP4166660A1 (en) | 2016-04-29 | 2023-04-19 | BASF Plant Science Company GmbH | Improved methods for modification of target nucleic acids using fused guide rna - donor molecules |
| US20190345483A1 (en) | 2016-05-12 | 2019-11-14 | President And Fellows Of Harvard College | AAV Split Cas9 Genome Editing and Transcriptional Regulation |
| CN110214183A (zh) | 2016-08-03 | 2019-09-06 | 哈佛大学的校长及成员们 | 腺苷核碱基编辑器及其用途 |
| WO2018045321A1 (en) | 2016-09-02 | 2018-03-08 | North Carolina State University | Methods and compositions for modification of plastid genomes |
| ES2985812T3 (es) | 2016-09-09 | 2024-11-07 | The Board Of Trustees Of The Leland Stanfordjunior Univ | Edición genómica de precisión de alto rendimiento |
| US20190330620A1 (en) | 2016-10-14 | 2019-10-31 | Emendobio Inc. | Rna compositions for genome editing |
| EP4545649A3 (en) | 2016-11-11 | 2025-06-04 | Bio-Rad Laboratories, Inc. | Methods for processing nucleic acid samples |
| US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
| KR20240116572A (ko) | 2017-03-23 | 2024-07-29 | 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 | 핵산 프로그램가능한 dna 결합 단백질을 포함하는 핵염기 편집제 |
| EP3630849A4 (en) | 2017-05-25 | 2021-01-13 | The General Hospital Corporation | BIPARTITE BASIC EDITOR (BBE) AND TYPE II-C-CAS9 ZINC FINGER EDITOR ARCHITECTURES |
| US11649442B2 (en) | 2017-09-08 | 2023-05-16 | The Regents Of The University Of California | RNA-guided endonuclease fusion polypeptides and methods of use thereof |
| JP2021530212A (ja) | 2018-07-13 | 2021-11-11 | ザ リージェンツ オブ ザ ユニバーシティ オブ カリフォルニアThe Regents Of The University Of California | レトロトランスポゾンベースの送達媒体及びその使用方法 |
| EP3844272A1 (en) | 2018-08-28 | 2021-07-07 | Flagship Pioneering Innovations VI, LLC | Methods and compositions for modulating a genome |
| JP7658579B2 (ja) | 2018-10-19 | 2025-04-08 | ボード オブ リージェンツ,ザ ユニバーシティ オブ テキサス システム | 操作された長鎖散在反復エレメント(line)トランスポゾンおよびそれらの使用方法 |
| WO2020186262A1 (en) | 2019-03-14 | 2020-09-17 | Cornell University | Compositions and methods for gene targeting using crispr-cas and transposons |
| WO2020191233A1 (en) | 2019-03-19 | 2020-09-24 | The Broad Institute, Inc. | Methods and compositions for editing nucleotide sequences |
| US20220298495A1 (en) | 2019-06-12 | 2022-09-22 | Emendobio Inc. | Novel genome editing tool |
| JP7759311B2 (ja) | 2019-07-19 | 2025-10-23 | フラッグシップ パイオニアリング イノベーションズ シックス,エルエルシー | リコンビナーゼ組成物及び使用方法 |
| EP4034659A4 (en) | 2019-09-27 | 2024-10-16 | The Broad Institute, Inc. | PROGRAMMABLE POLYNUCLEOTIDE EDITORS FOR AMPLIFIED HOMOLOGOUS RECOMBINATION |
| US20220411768A1 (en) | 2019-10-21 | 2022-12-29 | The Trustees Of Columbia University In The City Of New York | Methods of performing rna templated genome editing |
| CA3162499A1 (en) | 2019-11-22 | 2021-05-27 | Flagship Pioneering Innovations Vi, Llc | Recombinase compositions and methods of use |
| EP4085141A4 (en) | 2019-12-30 | 2024-03-06 | The Broad Institute, Inc. | GENOME EDITING USING REVERSE TRANSCRIPTASE FOR FULLY ACTIVE CRISPR COMPLEXES |
| CN116209756A (zh) | 2020-03-04 | 2023-06-02 | 旗舰先锋创新Vi有限责任公司 | 调控基因组的方法和组合物 |
| US20230348939A1 (en) | 2020-03-04 | 2023-11-02 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| BR112022017713A2 (pt) | 2020-03-04 | 2022-11-16 | Flagship Pioneering Innovations Vi Llc | Métodos e composições para modular um genoma |
| KR20230053735A (ko) | 2020-03-04 | 2023-04-21 | 플래그쉽 파이어니어링 이노베이션스 브이아이, 엘엘씨 | 게놈의 조정을 위한 개선된 방법 및 조성물 |
| CA3174553A1 (en) | 2020-03-05 | 2021-09-10 | Flagship Pioneering Innovations Vi, Llc | Host defense suppressing methods and compositions for modulating a genome |
| IL297761A (en) | 2020-05-08 | 2022-12-01 | Broad Inst Inc | Methods and compositions for simultaneously editing two helices of a designated double-helix nucleotide sequence |
| WO2021248102A1 (en) | 2020-06-05 | 2021-12-09 | Flagship Pioneering Innovations Vi, Llc | Template guide rna molecules |
| EP4274894A2 (en) | 2021-01-11 | 2023-11-15 | The Broad Institute, Inc. | Prime editor variants, constructs, and methods for enhancing prime editing efficiency and precision |
| US20240132916A1 (en) | 2021-02-09 | 2024-04-25 | The Broad Institute, Inc. | Nuclease-guided non-ltr retrotransposons and uses thereof |
| WO2022183210A1 (en) | 2021-02-26 | 2022-09-01 | Flagship Pioneering Innovations Vi, Llc | Tissue-specific methods and compositions for modulating a genome |
| AU2022240747A1 (en) | 2021-03-19 | 2023-10-05 | Flagship Pioneering Innovations Vi, Llc | Ltr transposon compositions and methods |
| EP4314257A4 (en) | 2021-04-01 | 2025-07-09 | Prime Medicine Inc | METHODS AND COMPOSITIONS FOR EDITING NUCLEOTIDE SEQUENCES |
| EP4347859A4 (en) | 2021-05-26 | 2025-07-02 | Flagship Pioneering Innovations Vi Llc | INTEGRASE COMPOSITIONS AND METHODS |
| EP4352230A4 (en) | 2021-06-03 | 2025-06-11 | Prime Medicine, Inc. | Genome editing compositions and methods for treating Wilson's disease |
| WO2023283092A1 (en) | 2021-07-06 | 2023-01-12 | Prime Medicine, Inc. | Compositions and methods for efficient genome editing |
| EP4373939A4 (en) | 2021-07-23 | 2025-11-19 | Prime Medicine Inc | Genome editing compositions and treatment methods for chronic granulomatous disease |
| WO2023015318A2 (en) | 2021-08-05 | 2023-02-09 | Prime Medicine, Inc. | Genome editing compositions and methods for treatment of cystic fibrosis |
| AU2022343268A1 (en) | 2021-09-08 | 2024-03-28 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| IL311219A (en) | 2021-09-08 | 2024-05-01 | Flagship Pioneering Innovations Vi Llc | Methods and compositions for genome modulation |
| MX2024002988A (es) | 2021-09-08 | 2024-06-11 | Flagship Pioneering Innovations Vi Llc | Composiciones y metodos moduladores de la serpina. |
| CA3231712A1 (en) | 2021-09-08 | 2023-03-16 | Flagship Pioneering Innovations Vi, Llc | Pah-modulating compositions and methods |
| CA3231679A1 (en) | 2021-09-08 | 2023-03-16 | Flagship Pioneering Innovations Vi, Llc | Hbb-modulating compositions and methods |
| EP4419688A2 (en) | 2021-10-21 | 2024-08-28 | Prime Medicine, Inc. | Genome editing compositions and methods for treatment of usher syndrome type 3 |
| EP4430185A1 (en) | 2021-11-09 | 2024-09-18 | Prime Medicine, Inc. | Genome editing compositions and methods for treatment of fuchs endothelial corneal dystrophy |
| EP4430188A1 (en) | 2021-11-09 | 2024-09-18 | Prime Medicine, Inc. | Genome editing compositions and methods for treatment of amyotrophic lateral sclerosis |
| EP4430189A1 (en) | 2021-11-11 | 2024-09-18 | Prime Medicine, Inc. | Genome editing compositions and methods for treatment of fragile x syndrome |
| IL313027A (en) | 2021-11-24 | 2024-07-01 | Prime Medicine Inc | Modified prime editing guide rnas |
| EP4437106A2 (en) | 2021-11-24 | 2024-10-02 | Prime Medicine, Inc. | Methods and compositions for inhibiting mismatch repair |
| WO2023108153A2 (en) | 2021-12-10 | 2023-06-15 | Flagship Pioneering Innovations Vi, Llc | Cftr-modulating compositions and methods |
| EP4504921A4 (en) | 2022-04-01 | 2026-04-15 | Prime Medicine Inc | METHODS AND COMPOSITIONS FOR EDITING NUCLEOTID SEQUENCES |
-
2021
- 2021-03-04 KR KR1020227034440A patent/KR20230053735A/ko active Pending
- 2021-03-04 CN CN202180035530.8A patent/CN116209770A/zh active Pending
- 2021-03-04 IL IL296095A patent/IL296095A/en unknown
- 2021-03-04 BR BR112022017736A patent/BR112022017736A2/pt unknown
- 2021-03-04 CA CA3174483A patent/CA3174483A1/en active Pending
- 2021-03-04 WO PCT/US2021/020943 patent/WO2021178717A2/en not_active Ceased
- 2021-03-04 JP JP2022552817A patent/JP2023517294A/ja active Pending
- 2021-03-04 AU AU2021230545A patent/AU2021230545A1/en active Pending
- 2021-03-04 EP EP21764647.0A patent/EP4114941A4/en active Pending
-
2022
- 2022-09-02 US US17/929,455 patent/US12565666B2/en active Active
-
2023
- 2023-09-14 US US18/467,392 patent/US12065669B2/en active Active
- 2023-09-14 US US18/467,428 patent/US12037602B2/en active Active
-
2025
- 2025-08-27 JP JP2025141096A patent/JP2025172847A/ja active Pending
Cited By (46)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12473573B2 (en) | 2013-09-06 | 2025-11-18 | President And Fellows Of Harvard College | Switchable Cas9 nucleases and uses thereof |
| US12043852B2 (en) | 2015-10-23 | 2024-07-23 | President And Fellows Of Harvard College | Evolved Cas9 proteins for gene editing |
| US12516308B2 (en) | 2017-03-09 | 2026-01-06 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
| US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
| US11932884B2 (en) | 2017-08-30 | 2024-03-19 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
| US12398392B2 (en) | 2018-08-28 | 2025-08-26 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12031129B2 (en) | 2018-08-28 | 2024-07-09 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12529041B2 (en) | 2018-09-07 | 2026-01-20 | Beam Therapeutics Inc. | Compositions and methods for delivering a nucleobase editing system |
| US12281338B2 (en) | 2018-10-29 | 2025-04-22 | The Broad Institute, Inc. | Nucleobase editors comprising GeoCas9 and uses thereof |
| US12351837B2 (en) | 2019-01-23 | 2025-07-08 | The Broad Institute, Inc. | Supernegatively charged proteins and uses thereof |
| US11643652B2 (en) | 2019-03-19 | 2023-05-09 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11795452B2 (en) | 2019-03-19 | 2023-10-24 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12281303B2 (en) | 2019-03-19 | 2025-04-22 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12509680B2 (en) | 2019-03-19 | 2025-12-30 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US11447770B1 (en) | 2019-03-19 | 2022-09-20 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12570972B2 (en) | 2019-03-19 | 2026-03-10 | The Broad Institute, Inc. | Methods and compositions for prime editing nucleotide sequences |
| US12473543B2 (en) | 2019-04-17 | 2025-11-18 | The Broad Institute, Inc. | Adenine base editors with reduced off-target effects |
| US11672874B2 (en) | 2019-09-03 | 2023-06-13 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| US12435330B2 (en) | 2019-10-10 | 2025-10-07 | The Broad Institute, Inc. | Methods and compositions for prime editing RNA |
| US12037602B2 (en) | 2020-03-04 | 2024-07-16 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12565666B2 (en) | 2020-03-04 | 2026-03-03 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12065669B2 (en) | 2020-03-04 | 2024-08-20 | Flagship Pioneering Innovations Vi, Llc | Methods and compositions for modulating a genome |
| US12031126B2 (en) | 2020-05-08 | 2024-07-09 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US11912985B2 (en) | 2020-05-08 | 2024-02-27 | The Broad Institute, Inc. | Methods and compositions for simultaneous editing of both strands of a target double-stranded nucleotide sequence |
| US12319925B2 (en) | 2021-05-11 | 2025-06-03 | Myeloid Therapeutics, Inc. | Methods and compositions for genomic integration |
| CN113755627A (zh) * | 2021-09-24 | 2021-12-07 | 广西大学 | 一种基于顺式调控元件的引物及其设计方法和在分子标记中的应用 |
| CN113755627B (zh) * | 2021-09-24 | 2023-06-16 | 广西大学 | 一种基于顺式调控元件的引物及其设计方法和在分子标记中的应用 |
| CN114277119A (zh) * | 2021-12-09 | 2022-04-05 | 浙江大学医学院附属邵逸夫医院 | 一种环状RNA circ-Arsb在制备防治骨质疏松产品中的应用 |
| WO2023212724A3 (en) * | 2022-04-28 | 2023-11-30 | Flagship Pioneering Innovations Vi, Llc | Compositions and methods for modulating a genome in t cells, induced pluripotent stem cells, and respiratory epithelial cells |
| EP4519424A4 (en) * | 2022-05-02 | 2025-09-24 | Univ California | MULTI-COMPONENT SYSTEMS FOR SITE-SPECIFIC GENOME MODIFICATIONS |
| CN116334141A (zh) * | 2022-08-04 | 2023-06-27 | 北京中因科技有限公司 | 基于基因编辑的RHO-R135W-adRP基因编辑药物 |
| CN116064797B (zh) * | 2022-08-29 | 2023-10-20 | 广州达健生物科技有限公司 | 一种子宫内膜癌基因甲基化水平检测试剂及其应用 |
| CN116064797A (zh) * | 2022-08-29 | 2023-05-05 | 广州达健生物科技有限公司 | 一种子宫内膜癌基因甲基化水平检测试剂及其应用 |
| WO2024086669A3 (en) * | 2022-10-19 | 2024-09-12 | Metagenomi, Inc. | Gene editing systems comprising reverse transcriptases |
| WO2024131786A1 (zh) * | 2022-12-19 | 2024-06-27 | 北京干细胞与再生医学研究院 | 一种在基因组插入大片段dna的系统 |
| US12565665B2 (en) | 2022-12-21 | 2026-03-03 | Trustees Of Boston University | Compositions and methods for controlled mRNA translation and stability |
| WO2024137990A3 (en) * | 2022-12-21 | 2024-08-02 | Trustees Of Boston University | Compositions and methods for controlled mrna translation and stability |
| CN116179513A (zh) * | 2023-03-10 | 2023-05-30 | 之江实验室 | 一种Cpf1蛋白及其在基因编辑中的应用 |
| CN116179513B (zh) * | 2023-03-10 | 2023-12-22 | 之江实验室 | 一种Cpf1蛋白及其在基因编辑中的应用 |
| US12351840B2 (en) | 2023-03-10 | 2025-07-08 | Hangzhou Luca Intelligent Technology Co., Ltd. | CPF1 protein and its use in gene editing |
| WO2024196963A3 (en) * | 2023-03-21 | 2025-02-06 | The Regents Of The University Of California | Compositions and methods for genome editing |
| WO2024220741A1 (en) | 2023-04-19 | 2024-10-24 | Flagship Pioneering Innovations Vii, Llc | Compositions and methods for the production of libraries |
| CN116523902A (zh) * | 2023-06-21 | 2023-08-01 | 湖南盛鼎科技发展有限责任公司 | 基于改进yolov5的电子粉涂敷均匀检测方法及设备 |
| CN116523902B (zh) * | 2023-06-21 | 2023-09-26 | 湖南盛鼎科技发展有限责任公司 | 基于改进yolov5的电子粉涂敷均匀检测方法及设备 |
| WO2025006419A1 (en) | 2023-06-26 | 2025-01-02 | Flagship Pioneering Innovations Vii, Llc | Engineered plasmodia and related methods |
Also Published As
| Publication number | Publication date |
|---|---|
| CN116209770A (zh) | 2023-06-02 |
| CA3174483A1 (en) | 2021-09-10 |
| EP4114941A4 (en) | 2024-10-16 |
| AU2021230545A1 (en) | 2022-09-29 |
| JP2025172847A (ja) | 2025-11-26 |
| BR112022017736A2 (pt) | 2022-11-29 |
| IL296095A (en) | 2022-11-01 |
| US12565666B2 (en) | 2026-03-03 |
| US20240076698A1 (en) | 2024-03-07 |
| US20240018551A1 (en) | 2024-01-18 |
| JP2023517294A (ja) | 2023-04-25 |
| KR20230053735A (ko) | 2023-04-21 |
| US12037602B2 (en) | 2024-07-16 |
| US20240084333A1 (en) | 2024-03-14 |
| US12065669B2 (en) | 2024-08-20 |
| WO2021178717A9 (en) | 2022-03-17 |
| EP4114941A2 (en) | 2023-01-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12037602B2 (en) | Methods and compositions for modulating a genome | |
| US12157898B2 (en) | Methods and compositions for modulating a genome | |
| US20230242899A1 (en) | Methods and compositions for modulating a genome | |
| US12031162B2 (en) | Methods and compositions for modulating a genome | |
| US20240252682A1 (en) | Hbb-modulating compositions and methods | |
| US12544458B2 (en) | PAH-modulating compositions and methods | |
| US20230348939A1 (en) | Methods and compositions for modulating a genome | |
| US20240200104A1 (en) | Ltr transposon compositions and methods | |
| US20240374759A1 (en) | Methods and compositions for modulating a genome | |
| US20250312376A1 (en) | Compositions and methods for modulating a genome in t cells, induced pluripotent stem cells, and respiratory epithelial cells | |
| US20250305002A1 (en) | Recruitment in trans of gene editing system components | |
| EA051108B1 (ru) | Улучшенные способы и композиции для модулирования генома |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 21764647 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 3174483 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022552817 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022017736 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2021230545 Country of ref document: AU Date of ref document: 20210304 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 202217056827 Country of ref document: IN |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2021764647 Country of ref document: EP Effective date: 20221004 |
|
| ENP | Entry into the national phase |
Ref document number: 112022017736 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220902 |