WO2021133167A1 - Tgf-beta-rii binding proteins - Google Patents
Tgf-beta-rii binding proteins Download PDFInfo
- Publication number
- WO2021133167A1 WO2021133167A1 PCT/NL2020/050813 NL2020050813W WO2021133167A1 WO 2021133167 A1 WO2021133167 A1 WO 2021133167A1 NL 2020050813 W NL2020050813 W NL 2020050813W WO 2021133167 A1 WO2021133167 A1 WO 2021133167A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- amino acid
- acid sequence
- set forth
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/11—Paramyxoviridae (F); Pneumoviridae (F), e.g. respiratory syncytial virus [RSV]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to the field of medicine. More specifically, the present invention relates to proteins that bind transforming growth factor-beta receptor II (TGF-PRII) and their use in the treatment of humans, in particular in the treatment of cancer.
- TGF-PRII transforming growth factor-beta receptor II
- TGF-b Transforming Growth Factor-b
- TGF-b Transforming Growth Factor-b
- TGF-bI TGF-b ligands
- TGF-bI TGF-b ligands
- TGF-b signaling has a tumor-suppressive role in normal cells but is capable of having a tumor-promoting role in malignant cells. They play a role in processes such as proliferation, migration, differentiation, apoptosis, angiogenesis and epithelial-mesenchymal transition (Bierie and Moses, 2006. Siegel and Massague,
- TGF-b receptor type-2 TGF-bBII
- TGF-bBII TGF-b receptor type-2
- This heterotetrameric complex composed of two TGF ⁇ RII and two TGF ⁇ RI then recruits and phosphorylates SMAD2 and SMAD3, which in turn recruits and binds to the co- SMAD molecule SMAD4 to form the SMAD/co-SMAD complex, and translocates to the nucleus where it regulates the transcription of TGF-b target genes (Hata and Chen, 2016. Vander Ark, Cao et al., 2018).
- TGF-b may induce epithelial-mesenchymal transition which facilitates the migration and metastasis of cancer cells.
- Gene expression profiles have indicated that TGF-b signaling is a significant pathway in liver metastases of colorectal cancer (Jung, Staudacher et al., 2017). Furthermore, it has been reported that stromal- epithelial interactions play roles in cancer progression.
- CAF cancer associated fibroblast
- Tumor-derived TGF-bI induces the transdifferentiation of fibroblasts into the ‘activated’ CAFs by binding to TGFpRII, which is capable of promoting a pro-tumorigenic stromal environment.
- TGF-b signaling pathway Existing modes of targeting the TGF-b signaling pathway to inhibit aberrant TGF-b signaling characteristics of CAFs and tumors to date have had sub-optimal efficacy and/or development liabilities.
- One anti-TGF ⁇ RII monoclonal antibody is LY3022859 disclosed in W02010/053814, which was reported to block the ectodomain ofTGF ⁇ RII.
- dose escalation studies in phase I led to cytokine release syndrome and was considered unsafe in patients with advanced solid tumors.
- Another agent, disclosed in WO2012/093125 is an anti-TGF ⁇ RII single variable domain with shorter half-life and wherein the precise mechanism of action or binding domain of this molecule has not been established.
- the object of the present invention is to provide a new pharmaceutical agent for the treatment of human disease, in particular for the treatment of cancer. This object is met by the provision of an antibody or antibody fragment thereof, and particular binding domains, that specifically binds to the extracellular domain of human TGF ⁇ RII, as described and claimed herein.
- the present invention relates to an antibody or antibody fragment thereof that specifically binds to the extracellular domain of human TGF ⁇ RII, wherein the antibody or antibody fragment binds to an epitope of the extracellular domain of human TGF-PRII of which phenylalanine (F) at position 25 of isoform A of human TGF-PRII, or at position 50 of isoform B of human TGF-PRII, is a critical residue for binding.
- phenylalanine (F) at position 25 of isoform A of human TGF-PRII, or at position 50 of isoform B of human TGF-PRII is a critical residue for binding.
- such antibody or antibody fragment binds to TGF-PRII, blocks or inhibits binding of a human TGF-b to a human TGF-PRII, thereby inhibiting the signal transduction into the cell, and blocking or inhibiting heterodimerization of TGF-PRIF
- the present invention relates to a vector comprising a polynucleotide encoding either or both the heavy chain and the light chain of the antibody or antibody fragment as described herein.
- the present invention relates to a cell producing the antibody or antibody fragment as described herein.
- the present invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising the antibody or antibody fragment as described herein and a pharmaceutically acceptable carrier, diluent, or excipient.
- the present invention relates to a pharmaceutical agent for preventing, suppressing symptom progression or recurrence of, and/or treating cancer, wherein the pharmaceutical agent comprises the antibody or antibody fragment as described herein as an active ingredient.
- the present invention relates to a method of treating cancer in a subject, the method comprising administering an effective amount of the antibody or antibody fragment as described herein, or the pharmaceutical composition as described herein, to the subject.
- the present invention relates to a method of blocking binding of human TGF-b to human TGF ⁇ RII on a cell, the method comprising providing the antibody or antibody fragment as described herein to the cell and allowing the antibody or antibody fragment to bind to the human TGF ⁇ RII of the cell, to thereby block binding of human TGF-b to human TGF ⁇ RII on the cell.
- the present invention relates to a method of inhibiting signal transduction into a cell induced by binding of a human TGF-b to a human TGF ⁇ RII of the cell, the method comprising providing the antibody or antibody fragment as described herein to the cell and allowing the antibody or antibody fragment to bind to the human TGF ⁇ RII of the cell, to thereby inhibit the signal transduction into the cell.
- the present invention relates to a method of preventing or inhibiting metastasis, the method comprising administering an effective amount of the antibody or antibody fragment as described herein, or the pharmaceutical composition as described herein, to a subject.
- the present invention relates to a protein, in particular an antibody or antibody fragment thereof, that specifically binds to the extracellular domain of human TGF-PRII.
- the antibody is isolated.
- the antibody is a monoclonal antibody. More preferably, the antibody is an isolated monoclonal antibody.
- isolated monoclonal antibody refers to an antibody produced by a clonal cell.
- isolated antibodies include, but are not limited to, an antibody that has been affinity purified, an antibody that has been produced in a hybridoma or other cell line in vitro , and a human antibody derived from a transgenic non-human animal.
- antibody refers to an immunoglobulin molecule comprising four polypeptide chains: two heavy (H) chains and two light (L) chains.
- Each heavy chain comprises a heavy chain variable region (VH) and a heavy chain constant region (CH).
- the heavy chain variable region comprises three heavy chain complementarity determining regions (HCDRs) and four framework regions (FRs), and is preferably human or humanized.
- the heavy chain constant region is comprised of three domains: CHI, CH2 and CH3; and may be derived from any organism, preferably a human.
- the CHI and CH2 domains of the heavy chain constant region are connected through a flexible hinge region.
- Each light chain comprises a light chain variable region (VL) and a light chain constant region (CL).
- the light chain variable region can be of two types: kappa (K) or lambda (l) and, like the VH, comprises three light chain complementarity determining regions (LCDRs) and four framework regions.
- the light chain variable region is preferably human or humanized.
- the light chain constant region is comprised of one domain: CL; and may be derived from any organism, preferably a human.
- the two heavy chains are linked to each other by disulfide bonds between the two hinge regions, and each heavy chain pairs with a light chain by a disulfide bond between the CHI and CL regions. In a conventional antibody, the two heavy chains and the two light chains are identical, providing the antibody with two identical antigen-binding sites.
- Antibody binding has different qualities including specificity and affinity.
- the specificity determines which antigen or epitope thereof is specifically bound by an antibody binding domain.
- the affinity is a measure for the strength of binding to a particular antigen or epitope.
- a “human” antibody refers to an antibody in which all antibody domains are derived from human germline immunoglobulin sequences.
- the human antibody to be used in the present invention can be produced by a method using a mouse transformed to produce a human antibody, e.g., Humab mouse, a KM mouse, a Xeno mouse, a Tc mouse, or a MeMo® mouse (WO2009/157771).
- the human antibody can also be prepared using SCID mice into which human immune cells have been reconstructed such that a human antibody response is made upon immunization.
- a “humanized” antibody region refers to an antibody prepared by, e.g., grafting a complementarity determining region (CDR) sequence of an antibody derived from a germline of an animal other than human, such as mouse or chicken, into human framework sequences of a human antibody.
- CDR complementarity determining region
- a humanized antibody can be produced by linking nucleic acid encoding CDR regions of an antibody isolated from antibody-producing hybridoma’s to a nucleic acid encoding a framework region of the human-derived antibody using a well-known method.
- An antibody is capable of binding an antigen through its heavy chain and/or light chain variable regions, and in particular through its specific CDRs.
- the CDRs of the heavy and/or light chain variable regions of an antibody bind to an “epitope”, also referred to as “antigenic determinant”, of an antigen.
- Epitopes can be formed from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein, so-called linear and conformational epitopes, respectively. Epitopes formed from contiguous, linear amino acids are typically retained on exposure to denaturing solvents, whereas epitopes formed by tertiary folding, conformation is typically lost on treatment with denaturing solvents.
- An epitope may typically include 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in a unique spatial conformation.
- an “antigen” typically is a molecule capable of inducing an immune response in a host organism, thereby producing antibodies with specificity for the antigen.
- an antigen is characterized by its ability to be bound by the antigen binding site of an antibody.
- the antigen-binding site of an antibody is formed by its heavy and/or light chain variable regions, and in particular by its CDRs.
- An antigen comprises at least one, but often more, epitopes. Also mixtures of antigens can be regarded as an 'antigen', and the ordinary skilled person would appreciate that sometimes a lysate of tumor cells, or viral particles may be indicated as 'antigen' whereas such tumor cell lysate or viral particle preparation exists of many antigenic determinants.
- the antigen is human TGF-PRII.
- Human TGF-PRII is a transmembrane protein of which there are different isoforms. .
- the amino acid sequence of human TGF-PRII isoform A is provided as SEQ ID NO: 101; the amino acid sequence of the extracellular domain of human TGF-PRII isoform A is provided as SEQ ID NO: 102.
- Human TGF- QRII isoform B is a splice variant encoding a longer isoform due to an insertion in the extracellular domain.
- the amino acid sequence of human TGF-PRII isoform B is provided as SEQ ID NO: 103; the amino acid sequence of the extracellular domain of isoform B of human TGF-PRII is as set forth in SEQ ID NO: 104.
- TGF-PRII is a member of the serine/threonine protein kinase family and the TGFB receptor subfamily. It is known under various synonyms, including TGFBR2, AAT3, FA A3, LDS1B, LDS2, LDS2B, MFS2, RIIC, TAAD2, TGFR-2, TGFbeta-RII, transforming growth factor beta receptor 2, and TBR-ii, TBRII.
- TGF-PRII forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation.
- An antibody binds an antigen with a particular binding affinity.
- binding affinity is determined by the dissociation constant (K D ), calculated by the formula: k off /k on , and refers to the strength of the antibody-antigen interaction.
- K D dissociation constant
- an antibody can be selected based on its high and/or low k on and/or k 0ff rates.
- An “antibody fragment” includes, but is not limited to, a functional fragment of a heavy chain and/or a light chain. Such functional fragment comprises at least one CDR derived from, or synthesized based on, a CDR from an antibody heavy chain or light chain, and is capable of specifically recognizing an antigen.
- an antibody fragment can for instance be, but is not limited to, a Fab, F(ab’)2, scFv, minibody, or sdAb.
- An “antibody fragment” further refers to a proteinaceous moiety comprising a functional part of an antibody. In the present case at least the heavy chain variable region, or one or more of the HCDRs, described herein.
- the antibody fragment can be any binding agent, including, but not limited to, single chain Fvs, single chain or Tandem diabodies (TandAb®), VHHs, Anticalins®, Nanobodies®, a BiTE®, a Fab, ankyrin repeat proteins or DARPINs®, Avimers®, a DART, a TCR-like antibody, Adnectins®, Affilins®, Trans-bodies®, Affibodies®, a TrimerX®, MicroProteins, Fynomers®, Centyrins® or a KALBITOR®.
- TandAb® Tandem diabodies
- a “Fab” typically means a binding domain comprising a heavy chain variable region, a light chain variable region, a CHI and a CL region.
- a “F(ab’)2” typically means a binding domain comprising two Fab domains linked to each other by means of a hinge region.
- a “single-chain variable fragment” (scFv) typically means a binding domain comprising a VH domain and a VL domain which are connected via a linker, for example a peptide linker of, for example, from about 10 to about 25 amino acids in length.
- a “ minibody” typically means a binding domain comprising two scFv’s and a CH3 domain.
- a “single domain antibody” typically means a binding domain comprising only the VH or the VL domain of an antibody, usually fused or otherwise linked to, part of, an Fc region. Like a whole antibody, it is able to bind selectively to a specific antigen.
- Single-domain antibody fragments may be engineered from heavy- chain antibodies found in camelids; these are at times called VHH fragments (Nanobodies ® ).
- VHH fragments Non-bodies ®
- Some fishes also have heavy-chain only antibodies (IgNAR, 'immunoglobulin new antigen receptor'), from which single-domain antibody fragments called VNAR fragments can be obtained.
- An alternative approach is to split the dimeric variable domains from common immunoglobulin G (IgG) from humans or mice into monomers.
- IgG immunoglobulin G
- nanobodies derived from light chains have also been shown to be capable of binding to target epitopes. Nanobodies are therefore also encompassed by the invention.
- an “antibody fragment” also refers to at least one CDR, wherein the at least one CDR is part of a protein construct that exhibits binding specificity for an antigen.
- the at least one CDR is HCDR3.
- the protein construct comprises HCDR1, HCDR2 and HCDR3.
- the protein construct comprises HCDR1, HCDR2 , HCDR3, LCDR1, LCDR2 and LCDR3.
- the protein construct may further comprise, part of, an Fc region, including CH2 and/or CH3.
- the protein construct may also comprise a CHI region.
- the CHI, CH2 and/or CH3 regions may be engineered to obtain any desired properties with respect to antigen binding and/or effector function.
- the invention also encompasses variants of the antibody or antibody fragment of the invention.
- a “variant” of the antibody or antibody fragment of the invention comprises at least a functional part of the antibody or antibody fragment as described herein, or a derivative or analogue thereof. Such functional part, derivative or analogue comprises at least the binding domain of the antibody or antibody fragment described herein, including the heavy chain variable region and/or light chain variable region comprising the CDRs as disclosed herein.
- a variant may comprise one to five amino acid substitutions in one or more of the CDRs. For instance, an amino acid residue may be substituted with a conservative amino acid residue.
- a variant may also comprise one or more amino acid substitutions in the one or more framework regions.
- the variant comprises a VH region that has at least 80%, 85%, 90%, 92%, 94%, 96%, 97%, 98%, or 99% sequence identity to the VH amino acid sequence of the antibody or antibody fragment of the invention.
- the variant comprises a VL region that has at least 80%, 85%, 90%, 92%, 94%, 96%, 97%, 98%, or 99% sequence identity to the VL amino acid sequence of the antibody or antibody fragment of the invention.
- Percent (%) identity as referring to nucleic acid or amino acid sequences herein is defined as the percentage of residues in a candidate sequence that are identical with the residues in a selected sequence, after aligning the sequences for optimal comparison purposes. In order to optimize the alignment between the two sequences gaps may be introduced in any of the two sequences that are compared. Such alignment can be carried out over the full length of the sequences being compared. Alternatively, the alignment may be carried out over a shorter length, for example over about 20, about 50, about 100 or more nucleic acids/based or amino acids. The sequence identity is the percentage of identical matches between the two sequences over the reported aligned region. A comparison of sequences and determination of percentage of sequence identity between two sequences can be accomplished using a mathematical algorithm.
- percent sequence identity according to the invention set out herein between two nucleic acid sequences may be determined using the AlignX application of the Vector NTI Program Advance 11.5.2 software using the default settings, which employ a modified ClustalW algorithm (Thompson, J.D., Higgins, D.G., and Gibson T.J. (1994) Nuc. Acid Res. 22: 4673-4680), the swgapdnamt score matrix, a gap opening penalty of 15 and a gap extension penalty of 6.66.
- Amino acid sequences may be aligned with the AlignX application of the Vector NTI Program Advance 11.5.2 software using default settings, which employ a modified ClustalW algorithm (Thompson, J.D., Higgins, D.G., and Gibson T.J., 1994), the blosum62mt2 score matrix, a gap opening penalty of 10 and a gap extension penalty of 0.1.
- a variant maintains the binding specificity of the antibody or antibody fragment of the invention, for example the antigen specificity.
- the binding affinity of the variant may, however, be different than that of the original antibody or antibody fragment of the invention.
- the variant may, for instance, have a lower or higher K on and/or K 0ff rate than the antibody or antibody fragment as described herein.
- a functional derivative of the antibody or antibody fragment of the invention can be an antibody mimetic, a polypeptide, an aptamer or a combination thereof. These proteins or aptamers typically bind to one target. It is to be understood that any combination of these antibodies, antibody mimetics, polypeptides and aptamers can be linked together by methods known in the art.
- the antibody or antibody fragment of the invention is a conjugate or part of a fusion protein.
- An antibody mimetic is a polypeptide that, like antibodies, can specifically bind an antigen, but that is not structurally related to antibodies.
- Antibody mimetics are usually artificial peptides or proteins with a molar mass of about 3 to 20 kDa.
- Non limiting examples of antibody mimetics are affibody molecules (typically based on the Z domain of Protein A); affilins (typically based on Gamma-B crystalline or Ubiquitin); affimers (typically based on Cystatin); affitins (typically based on Sac7d from Sulfolobus acidocaldarius); alphabodies (typically based on Triple helix coiled coil); anticalins (typically based on Lipocalins); avimers (typically based on A domains of various membrane receptors); DARPins (typically based on ankyrin repeat motif); fynomers (typically based on SH3 domain of Fyn 7); kunitz domain peptides (typically based on Kunitz domains of various protease inhibitors); and monobodies (typically based on type III domain of fibronectin).
- affibody molecules typically based on the Z domain of Protein A
- Monobodies are synthetic binding proteins that are constructed using a fibronectin type III domain (FN3) as a molecular scaffold. Monobodies are an alternative to antibodies for creating target-binding proteins. Monobodies and other antibody mimetics are typically generated from combinatorial libraries in which portions of the scaffold are diversified using molecular display and directed evolution technologies such as phage display, mRNA display and yeast surface display.
- FN3 fibronectin type III domain
- Aptamers are oligonucleotide or peptide molecules that bind to a specific target molecule. Aptamers are usually created by selecting them from a large random sequence pool, but natural aptamers also exist in riboswitches. Aptamers can be used for both basic research and clinical purposes as macromolecules.
- An antibody of the invention is preferably an IgG antibody, preferably an IgGl or an IgG4 antibody. Most preferably, the antibody is an IgGl antibody.
- IgGl antibody Such full length IgG antibody is preferred because of its favorable half-life and the desire to stay as close to fully autologous (human) molecules for reasons of immunogenicity. IgGl is favored based on its long circulatory half-life in man.
- full length IgG or ‘full length antibody’ according to the invention is defined as comprising an essentially complete IgG, which however does not necessarily have all functions of an intact IgG.
- a full length IgG contains two heavy and two light chains. Each chain comprises constant (C) and variable (V) regions, which can be broken down into domains designated CHI, CH2, CH3, VH, and CL, VL.
- An IgG antibody binds to antigen via the variable region domains contained in the Fab portion, and after binding can interact with molecules and cells of the immune system through the constant domains, mostly through the Fc portion.
- Full length antibodies according to the invention encompass IgG molecules wherein mutations may be present that provide desired characteristics.
- a full length IgG may contain variations in the constant regions to modulate effector function, both increasing and mitigating such functions, including antibody- dependent cellular cytotoxicity (ADCC), or cellular dependent cytotoxicity (CDC), to increase homo- or heterodimerization for generating monospecific or multispecific antibodies from host cells comprising a nucleic acid encoding different heavy chains, and to facilitate separation of antibodies or antibody fragments produced by such host cells.
- ADCC antibody- dependent cellular cytotoxicity
- CDC cellular dependent cytotoxicity
- leucine at position 235 according to the EU numbering system may be substituted with glycine, and/or glycine at position 236 according to the EU numbering system may be substituted with arginine.
- Such modification(s) ensure that binding to an Fc receptor and/or effector function is eliminated or decreased.
- Other variations of the CH2 and Fc region are known in the art to the same effect are also encompassed within the present invention.
- Full length IgG should not have deletions of substantial portions of any of the regions.
- IgG molecules wherein one or several amino acid residues are deleted, without essentially altering the binding characteristics of the resulting IgG molecule are embraced within the term "full length IgG".
- such IgG molecules can have a deletion of between 1 and 10 amino acid residues, preferably in non-CDR regions, wherein the deleted amino acids are not essential for the binding specificity of the IgG.
- lysine at position 447 according to the EU numbering system may be deleted. Such deletion reduces the heterogeneity of the antibody.
- serine located in the hinge region at position 228 according to the EU numbering system may be substituted with proline.
- Suitable light chains for use in an antibody or antibody fragment of the invention include a light chain that is produced in response to immunization with an antigen, referred to as a cognate light chain, or a synthetically produced light chain based thereon.
- a suitable light chain also includes a common light chain (cLC), such as those that can be identified by screening for the most commonly employed light chains in existing antibody libraries (wet libraries or in silico), where the light chains do not substantially interfere with the affinity and/or selectivity of the epitope-binding domains of the heavy chains, but are also suitable to pair with an array of heavy chains.
- cLC common light chain
- a common light chain is preferably encoded by germline sequences of V- and J gene segments which are rearranged but have not, or minimally, undergone somatic hypermutation.
- a suitable light chain includes one from a transgenic non- human animal, such as MeMo® having a common light chain integrated into its genome and which can be used to generate large panels of common light chain antibodies having diversity at the heavy chain and are capable of specifically binding an antigen upon exposure to said antigen.
- the term ’’common light chain thus refers to a light chain that can be associated with two or more different heavy chains and exhibits binding ability to an antigen (see for instance WO2009/157771, WO2019/190327 and WO2014/051433).
- a preferred light chain V gene for such a common light chain is IGKV1-39.
- Preferred light chain J genes are jkl and jk5.
- the joined sequences are indicated as IGKVl-39/jkl and IGKVl-39/jk5; alternative names are IgVKl-39*01/IGJKl*01 or IgVKl- 39*01/IGJK5*01 (nomenclature according to the IMGT database worldwide web at imgt.org.
- a common light chain examples include a light chain encoded by a human k light chain IgVKl-39*01/IGJKl*01 (nomenclatures of IMGT database) germline gene (hereinafter, abbreviated as the “IGVK1-39/JK1 common light chain”), as well as IgVKl-39*01/IGJK5.
- IgVK1-39/JK1 common light chain a variety of MeMo® transgenic animals referred to above comprises the IGVK1-39/JK1 common light chain.
- a common light chain according to the invention also refers to light chains which may be identical or have some amino acid sequence differences while the binding specificity of the antibody or antibody fragment of the invention is not affected.
- Common also refers to functional equivalents of the light chain of which the amino acid sequence is not identical.
- Variants of said light chain exist wherein changes are present in comparison to the parental common light chain that do not materially influence the formation of functional binding regions. Such variants are thus also capable of binding different heavy chains and forming functional antigen binding domains. It is for instance possible within the scope of the definition of common light chains as used herein, to prepare or find variable light chains that are not identical but still functionally equivalent, e.g., by introducing and testing conservative amino acid changes, changes of amino acids in regions that do not or only partly contribute to binding specificity when paired with a cognate chain, and the like. Such variants are thus also capable of binding different cognate chains and forming functional antigen binding domains.
- common light chain refers to light chains which may be identical or have some amino acid sequence differences while retaining the binding specificity of the resulting antibody after pairing with a heavy chain.
- a combination of a certain common light chain and such functionally equivalent variants is encompassed within the term "common light chain”.
- a common light chain is used in the present invention which is a germline like light chain, more preferably a germline light chain, preferably a rearranged germline human kappa light chain, most preferably either the rearranged germline human kappa light chain IgVKl-39/Ik or IGVK3-20/JK.
- the antibody or antibody fragment can be produced, for example, from a hybridoma using a hybridoma method.
- the antibody or antibody fragment can be produced by secretion from a mammalian cell co-expressing the heavy and/or light chains, or fragments thereof.
- the antibody or antibody fragment is produced by immunizing a non-human animal.
- Antibodies can be produced from various animal species.
- the MeMo® transgenic animals referred to above comprising the IGVK1-39/JK1 common light chain can suitably be used.
- transgenic mice are immunized with the human target DNA and/or protein followed by immunization boosts, thereby generating an immune response including the production of antigen-specific antibodies.
- Serum titers from immunized mice can be determined by ELISA and FACS analysis. Spleen and draining lymphoid material of the immunized mice may then be collected and single cell suspensions generated.
- RNA can be isolated and cDNA synthesized that encode the heavy chain and/or variable regions of such antibodies.
- VH and/or VL-family specific PCR can then be performed in order to generate phage display libraries.
- Human target protein binding Fabs can then be selected using for instance the Kingfisher selection robot.
- the nucleic acid encoding the heavy chain and/or light chain variable region of the Fabs that bind the target protein can be used for the production of antibodies in host cells.
- variable regions and/or complementary determining regions may be beneficial to obtain binding domains or antibodies, including chimeric or humanized binding domains or antibodies, that contain variable regions and/or complementary determining regions (CDR), and the nucleic acids that encode said variable regions and or CDRs, that are based on, derived or obtained from a nucleic acid, of species that are evolutionarily distant to humans.
- CDR complementary determining regions
- One potential source of such variable regions may be birds, for example, domesticated birds, such as chickens, ducks or ostriches.
- Antibody repertoires generated via immunization of birds may identify unique epitopes when compared to antibodies generated via the immunization of mice or other species evolutionarily close to humans (e.g., rodents and cynomolgus).
- a primary DNA or protein immunization may be carried out followed by more booster immunizations.
- IgY antibodies can be isolated from yolk of the collected eggs or serum from the immunized birds. Spleen and/or bone marrow are removed from birds showing a significant humoral response against the target protein. RNA can subsequently be isolated and cDNA is synthesized. The generated cDNA samples are then used as a template to amplify and digest VH and/or VL genes using two primers. The PCR products are then cloned in a phagemid vector for the display of Fab fragments on phage essentially as described in de Haard et al. (J Biol Chem. (1999),
- the nucleic acids encoding the VH and/or VL regions are ligated into a vector and the resulting ligated vector transformed into cells to yield libraries. Panning selections using KingFisher Flex can then be performed to select the phages that bind the target protein. Screening can be carried out by FACS on cells expressing the human or mouse target protein. The VH and/or VL genes of all clones that specifically bind the human and/or mouse target protein are sequenced. The nucleic acid encoding the heavy chain and/or light chain variable region of the binding domain that bind the target protein can be used for the production of antibodies in host cells.
- Antibody fragments can be produced by methods known in the art.
- scFv antibodies can be produced by isolating mRNA from the hybridoma or mammalian cell, which is then reverse transcribed into cDNA for PCR amplification. This results in the production of large libraries containing a varied range of VH and VL antibody genes (Marks and Hoogenboom, Journal of Molecular Biology (1991), Vol. 222, pp. 581-597). While constructing the scFv, the domains may be ordered as VH- linker-VL or as VL-linker-VH (Hu, O’Dwyer and Wall, Journal of Biotechnology (2005), Vol. 120, pp. 38-45).
- linker may be the classical (G4S)3 linker (Huston et ak, ProcNatl Acad Sci USA (1988), Vol. 85, pp. 5879-5883).
- the DNA fragment encoding the hinge-CH3 domain can, for example, be based on the sequences of human IgGl (Kim et ak, PLOS One (2014), Vol. 9(12), el 13442).
- scFv and hinge-CH3 regions may be assembled either by ligating cohesive ends generated by Xhol and SALI, or by using PCR to bring the Xhol restriction site of the scFv product together with the hinge, to the NH2 terminus of the CH3 (Hu et ak, Cancer Research (1996), Vol. 56, pp. 3055-3061).
- the V domains of an antibody can then be recombined through in vitro recombination in plasmids or phagemids (Lilley et ak, Journal of Immunological Methods (1994), Vol. 171, pp. 211- 226. Hogrefe et ak, Gene (1993), Vol. 128, pp. 119-126).
- phage display technology relies on the fusion of the antibody fragments to the phage minor coat protein pill or its C-terminal domain (Smith, Science (1985), Vol. 228, pp. 1315-1317. Hoogenboom, Nature Biotechnology (2005), Vol. 23, pp. 1105-1116). Aside from displaying scFv fragments, phage display is now also widely used to display Fab fragments (Wieland et ak, Veterinary Immunology and Immunopathology (2006), Vol. 110, pp. 129-140).
- Fab fragments can be generated from monoclonal antibodies via enzymatic digestion using papain or pepsin. Papain digestion of antibodies produces three distinct fragments: two antigen-binding fragments called Fab fragments or regions, each with a single antigen-binding site, and one Fc region by cleaving below the CHI domain (Porter, Biochem (1959), Vol. 73, pp. 119-126). Pepsin digestion of antibodies produces two fragments: a F(ab’)2 fragment containing two antigen binding regions connected via the disulfide bridge of the hinge region and an Fc fragment (Valedkarimi et al., Human Antibodies (2016), Vol. 26, pp. 171-176).
- Fab and F(ab’)2 fragments may be purified through a combination of the following techniques: ion exchange, protein A or G affinity, antigen affinity or gel filtration chromatographies (Mage and Lamoyi. Monoclonal Antibody Production Techniques and Applications, Marcel Dekker Inc, New York, 1987, pp. 79-97).
- F(ab')n or (modified F(ab')n) may be produced in connection with the invention described herein and can be obtained using any suitable enzymatic cleavage and/or digestion techniques.
- the antibody fragment can be obtained by cleavage with the IdeS protease, an IgG-degrading enzyme of Streptococcus pyogenes that cleaves a human IgGl at a specific site below the hinge leaving intact a F(ab')n antibody fragment, wherein n is the number of antibody domains present on the IgG, wherein the heavy chain on one side of the F(ab')n is paired to the heavy chain on the other side at their respective C-terminus, wherein the pairing comprises two or more disulfide bridges.
- Methods for generation of bispecific and multispecific antibodies wherein n 2 or more have been previously described. See PCT/NL2019/050199; PCT/NL2013/050294; PCT/NL2013/050293, which are incorporated by reference.
- an antibody fragment lacking a Fc region can be obtained by use of a cysteine protease from Porphyoromonas gingivalis , that digests human IgGl at a specific site above the hinge (KSCDK / THTCPPC), generating intact Fab and Fc fragments.
- a cysteine protease from Porphyoromonas gingivalis , that digests human IgGl at a specific site above the hinge (KSCDK / THTCPPC), generating intact Fab and Fc fragments.
- An antibody fragment can be formed via this technique through the expression of a heavy chain comprising a variable domain and constant domain (e.g., CHI, CH2 and/or CH3), which is connected to an additional variable domain via a linker described herein, or paired to a light chain, which is connected to an additional variable domain via a linker described herein, and wherein a proteolytic enzyme, such as from Porphyoromonas gingivalis cleaves the constant domains of said heavy chain, leaving an intact truncated antibody binding fragment.
- a variable domain and constant domain e.g., CHI, CH2 and/or CH3
- a proteolytic enzyme such as from Porphyoromonas gingivalis cleaves the constant domains of said heavy chain, leaving an intact truncated antibody binding fragment.
- sdAbs The generation of sdAbs has been achieved through phage display and by using repertoires of naive or synthetic VH or VL dAbs based on the incorporation of solubilizing residues from camelid sdAbs into human VHs (Tanha et al., J. Biol. Chem (2001), Vol. 276, pp. 24774-24780. Davies and Riechmann, Biotechnology (1995), Vol. 13, pp. 475-479). Human sdAbs have also been attained without the need of engineering, through a selection method based on reversible unfolding and affinity criteria which resulted in a number of VHs from synthetic human VH phage display libraries (Jespers at al, Nat.
- Another phage selection method may be used to obtain exclusively non-aggregating human VH domains from a naive human VH display library (To et al., J Biol Chem (2005), Vol. 280, pp. 41395-41403). This same technique may be applied to obtained VLs (Kim et al., Austin Bioscience (2014), Vol. 6:1, pp. 219-235).
- the antibody or antibody fragment of the present invention can be used for the treatment of cancer, by administering an effective amount of the antibody or antibody fragment to a subject in need thereof.
- the terms "subject” and “patient” are used interchangeably and refer to a mammal such as a human, mouse, rat, hamster, guinea pig, rabbit, cat, dog, monkey, cow, horse, pig and the like (e.g., a patient, such as a human patient, having cancer).
- treat refers to any type of intervention or process performed on or administering an active agent or combination of active agents to a subject with the objective of curing or improving a disease or symptom thereof. This includes reversing, alleviating, ameliorating, inhibiting, or slowing down a symptom, complication, condition or biochemical indicia associated with a disease, as well as preventing the onset, progression, development, severity or recurrence of a symptom, complication, condition or biochemical indicia associated with a disease.
- an effective treatment or “positive therapeutic response” refers to a treatment producing a beneficial effect, e.g., amelioration of at least one symptom of a disease or disorder, e.g., cancer.
- a beneficial effect can take the form of an improvement over baseline, including an improvement over a measurement or observation made prior to initiation of therapy according to the method.
- a beneficial effect can take the form of slowing, stabilizing, stopping or reversing the progression of a cancer in a subject at any clinical stage, as evidenced by a decrease or elimination of a clinical or diagnostic symptom of the disease, or of a marker of cancer.
- Effective treatment may, for example, decrease in tumor size, decrease the presence of circulating tumor cells, reduce or prevent metastases of a tumor, slow or arrest tumor growth and/or prevent or delay tumor recurrence or relapse.
- a therapeutic amount refers to an amount of an agent or combination of agents that provides the desired biological, therapeutic, and/or prophylactic result. That result can be reduction, amelioration, palliation, lessening, delaying, and/or alleviation of one or more of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system.
- a therapeutic amount is an amount sufficient to delay tumor development. In some embodiments, a therapeutic amount is an amount sufficient to prevent or delay tumor recurrence.
- the therapeutic amount of the drug or composition may: (i) reduce the number of cancer cells; (ii) reduce tumor size; (iii) inhibit, retard, slow to some extent and may stop cancer cell infiltration into peripheral organs; (iv) inhibit tumor metastasis; (v) inhibit tumor growth; (vi) prevent or delay occurrence and/or recurrence of tumor; and/or (vii) relieve to some extent one or more of the symptoms associated with the cancer.
- a therapeutic amount may vary according to factors such as the disease state, age, sex, and weight of the individual to be treated, and the ability of the agent or combination of agents to elicit a desired response in the individual.
- a therapeutic amount can be administered in one or more administrations.
- a therapeutic amount also includes an amount that balances any toxic or detrimental effects of the agent or combination of agents and the therapeutically beneficial effects.
- the present invention provides an antibody or antibody fragment thereof that specifically binds to the extracellular domain of human TGF-PRII, wherein the antibody or antibody fragment binds to an epitope of the extracellular domain of human TGF-PRII of which phenylalanine (F) at position 25 is a critical residue for binding.
- antibodies have been identified that bind to a particular epitope of the extracellular domain of human TGF- pRII.
- This epitope comprises at least the amino acid residue at position 25 of the extracellular domain of isoform A of human TGF-PRII.
- the amino acid sequence of the extracellular domain of isoform A of human TGF-PRII is as set forth in SEQ ID NO: 102.
- the amino acid at position 25 of this sequence is phenylalanine (F) (bold and underlined).
- the database accession number for the human TGF-PRII protein and the gene encoding isoform A is GenBank NM_001024847.2 (protein seq reference is NP_001020018.1; SEQ ID NO: 102).
- a splice variant encoding a longer isoform due to an insertion in the extracellular domain is isoform B.
- the gene encoding isoform B is GenBank NM_003242.6 (protein seq reference is NP_003233.4; SEQ ID NO: 103 with the insertion underlined).
- the amino acid at position 25 of the extracellular domain of isoform A corresponds to the amino acid at position 50 of the extracellular domain of isoform B.
- the amino acid sequence of the extracellular domain of isoform B of human TGF-PRII is as set forth in SEQ ID NO: 104.
- the amino acid, phenylalanine (F), at position 50 of this sequence is in bold and underlined.
- accession numbers are primarily given to provide a further method of identifying the TGF-PRII protein as a target, the actual sequence of the TGF-PRII protein bound by an antibody may vary, for instance because of a mutation in the encoding gene such as those occurring in some cancers or the like.
- the amino acid residue at position 25 of the extracellular domain of human TGF-PRII was found to be a critical residue for binding of the antibodies of the invention, as determined by alanine scanning.
- alanine scanning the amino acids at each position of an antigen, in the present case TGF-PRII, are substituted one by one with alanine. If this diminishes or significantly reduces the binding of an antibody that binds the unmodified antigen, the amino acid that is substituted thus contributes to binding and is considered to be a critical residue.
- the antibody or antibody fragment thus specifically binds an epitope comprising such residue.
- an amino acid residue is considered as a critical residue if its binding activity or reactivity is reduced by more than 50%, as compared to the unmodified amino acid sequence. “Significantly reduced” thus means a binding activity or reactivity which is reduced by at least more than 50%, as compared to the unmodified amino acid sequence of the extracellular domain of human TGFpRII.
- the antibody or antibody fragment of the present invention has a binding activity or reactivity of less than 50%, preferably less than 40%, 30%, 20%, 10%, 5%, or 2%, when the phenylalanine (F) at position 25 of the amino acid sequence of the extracellular domain of human TGFpRII, the wildtype sequence of which is as set forth in SEQ ID No.102, is replaced with alanine (A), as compared to the wildtype amino acid sequence of the extracellular domain of human TGFpRII.
- F phenylalanine
- an antibody or antibody fragment of the present invention specifically binds to an epitope of human TGF-PRII comprising phenylalanine (F) at position 25 of the amino acid sequence of the extracellular domain of human TGF-PRII.
- the binding of an antibody or antibody fragment to this epitope is determined by alanine scanning, wherein an antibody or antibody fragment that binds to this epitope has a binding activity or reactivity of less than 50%, preferably less than 40%, 30%, 20%, 10%, 5%, or 2%, when alanine (A) is present at position 25 of the amino acid sequence of the extracellular domain of human TGF-PRII, as compared to when phenylalanine (F) is present at said position.
- Another way of defining an antibody or antibody fragment of the present invention is that it binds to an epitope of the extracellular domain of human TGFpRII of which a substitution of a phenylalanine (F) residue that in isoform A of human TGFpRII, the wildtype sequence of which is as set forth in SEQ ID No.102, is at position 25, for an alanine (A), reduces the binding of the antibody or antibody fragment by at least 50%, preferably by at least 60%, 70%, 80%, 90%, 95%, or 98%.
- F phenylalanine
- An antibody or antibody fragment of the present invention may also be defined as an antibody or antibody fragment that binds to an epitope in the extracellular domain of human TGF-PRII, wherein the epitope comprises a phenylalanine (F) residue that in isoform A of human TGF-PRII, the wildtype sequence of which is as set forth in SEQ ID No.102, is at position 25.
- F phenylalanine
- D aspartate
- the amino acid at position 119 of isoform A corresponds to the amino acid at position 144 of the extracellular domain of isoform B of human TGF-PRII (SEQ ID NO: 104).
- the antibody or antibody fragment of the invention preferably has a binding reactivity of less than 10%, more preferably less than 5%, 4%, 3%, or 2%, when the aspartate (D) at position 119 of the wildtype amino acid sequence of the extracellular domain of human TGF-PRII is replaced with alanine (A), as compared to the wildtype amino acid sequence of the extracellular domain of human TGF-PRII.
- the antibody or antibody fragment preferably has: a binding reactivity of less than 5%, preferably less than 3%, when the phenylalanine (F) at position 25 of the wildtype amino acid sequence of the extracellular domain of human TGF-PRII is replaced with alanine (A);
- the present invention encompasses an antibody or antibody fragment that specifically binds to an epitope of human TGF-PRII comprising phenylalanine (F) at position 25 and aspartate (D) at position 119 of the amino acid sequence of the extracellular domain of human TGF-PRII.
- the binding of an antibody or antibody fragment to this epitope is determined by alanine scanning, wherein an antibody or antibody fragment that binds to this epitope has a binding activity or reactivity of less than 50%, preferably less than 5%, or 3%, when alanine is present at position 25 of the amino acid sequence of the extracellular domain of human TGF-PRII, and a binding activity or reactivity of less than 10%, preferably less than 5%, or 3%, when alanine (A) is present at position 119 of the amino acid sequence of the extracellular domain of human TGF-PRII, as compared to when phenylalanine (F) and aspartate (D) are present at said respective positions, wherein each change is tested in isolation and not as a combination of two changes as compared to the wildtype extracellular domain.
- alanine scanning wherein an antibody or antibody fragment that binds to this epitope has a binding activity or reactivity of less than 50%, preferably less than 5%, or 3%, when
- Another way of defining an antibody or antibody fragment of the present invention is that it binds to an epitope of the extracellular domain of human TGFpRII of which - a substitution of a phenylalanine (F) residue that in isoform A of human TGFpRII, the wildtype sequence of which is as set forth in SEQ ID No.102, is at position 25, for an alanine (A), reduces the binding of the antibody or antibody fragment by at least 50%, preferably by at least 95%, or 97%; and
- An antibody or antibody fragment of the present invention may also be defined as an antibody or antibody fragment that binds to an epitope in the extracellular domain of human TGF-PRII, wherein the epitope comprises a phenylalanine (F) residue and an aspartate (D) residue that in isoform A of human TGF-PRII, the wildtype sequence of which is as set forth in SEQ ID No.102, are at positions 25 and 119 respectively.
- the antibody or antibody fragment binds to an epitope of the extracellular domain of human TGF-PRII of which threonine (T) at position 52 of the epitope of the extracellular domain of isoform A of human TGF-PRII is a further critical residue for binding.
- T threonine
- the amino acid at position 52 of isoform A corresponds to the amino acid at position 77 of isoform B of human TGF-PRII.
- the antibody or antibody fragment preferably has: a binding reactivity of less than 5%, preferably less than 2%, when the phenylalanine (F) at position 25 of wildtype amino acid sequence of the extracellular domain of human TGF-PRII is replaced with alanine (A); a binding reactivity of less than 60%, preferably less than 40% or 30%, more preferably less than 20%, when the threonine (T) at position 52 of the wildtype amino acid sequence of the extracellular domain of human TGF- pRII is replaced with alanine (A); and a binding reactivity of less than 3% when the aspartate (D) at position 119 of the wildtype amino acid sequence of the extracellular domain of human TGF-PRII is replaced with alanine (A), as compared to the wildtype amino acid sequence of the extracellular domain of human TGF-PRII.
- a binding reactivity of less than 5%, preferably less than 2% when the phenylalanine (F) at position 25 of wildtype amino
- the present invention encompasses an antibody or antibody fragment that specifically binds to an epitope of human TGF-PRII comprising phenylalanine (F) at position 25, threonine (T) at position 52, and aspartate (D) at position 119, of the amino acid sequence of the extracellular domain of human TGF-PRII.
- the binding of an antibody or antibody fragment to this epitope is determined by alanine scanning, wherein an antibody or antibody fragment that binds to this epitope has a binding activity or reactivity of less than 50%, preferably less than 5%, or 2%, when alanine (A) is present at position 25 of the amino acid sequence of the extracellular domain of human TGF-PRII, a binding activity or reactivity of less than 60%, preferably less than 40%, 30%, or 20%, when alanine (A) is present at position 52 of the amino acid sequence of the extracellular domain of human TGF-PRII, and a binding activity or reactivity of less than 10%, preferably less than 3%, when alanine (A) is present at position 119 of the amino acid sequence of the extracellular domain of human TGF- pRII, as compared to when phenylalanine (F), threonine (T) and aspartate (D) are present at said respective positions, wherein each change is tested in isolation and not as
- Another way of defining an antibody or antibody fragment of the present invention is that it binds to an epitope of the extracellular domain of human TGFpRII of which
- T threonine residue that in isoform A of human TGFpRII, the wildtype sequence of which is as set forth in SEQ ID No.102, is at position 52, for an alanine (A), reduces the binding of the antibody or antibody fragment by at least 60%, preferably by at least 70%, or 80%;
- An antibody or antibody fragment of the present invention may also be defined as an antibody or antibody fragment that binds to an epitope in the extracellular domain of human TGF-PRII, wherein the epitope comprises a phenylalanine (F) residue, a threonine (T) residue, and an aspartate (D) residue that in isoform A of human TGF- pRII, the wildtype sequence of which is as set forth in SEQ ID No.102, are at positions 25, 52 and 119 respectively.
- the antibody or antibody fragment binds to an epitope of the extracellular domain of human TGF-PRII of which isoleucine (I) at position 54 and glutamate (E) at position 120 of the epitope of the extracellular domain of isoform A of human TGF-PRII are further critical residues for binding.
- the amino acids at positions 54 and 120 of isoform A correspond to the amino acids at positions 79 and 145, respectively, of isoform B of human TGF-PRII.
- the antibody or antibody fragment preferably has: a binding reactivity of less than 10% when the phenylalanine (F) at position 25 of the wildtype amino acid sequence of the extracellular domain of human TGF-PRII is replaced with alanine (A); a binding reactivity of less than 20% when the isoleucine (I) at position 54 of the wildtype amino acid sequence of the extracellular domain of human TGF-PRII is replaced with alanine (A); a binding reactivity of less than 3%, preferably less than 2%, more preferably less than 1%, when the aspartate (D) at position 119 of the wildtype amino acid sequence of the extracellular domain of human TGF- pRII is replaced with alanine (A); and a binding reactivity of less than 80%, preferably less than 70%, 60%, 50%, 40%, more preferably less than 30%, most preferably less than 10 % or 5%, when the glutamate (E) at position 120 of the wildtype amino acid sequence of the extracellular domain
- the present invention encompasses an antibody or antibody fragment that specifically binds to an epitope of human TGF-PRII comprising phenylalanine (F) at position 25, isoleucine (I) at position 54, aspartate (D) at position 119, and glutamate (E) at position 120, of the amino acid sequence of the extracellular domain of human TGF-PRII.
- the binding of an antibody or antibody fragment to this epitope is determined by alanine scanning, wherein an antibody or antibody fragment that binds to this epitope has a binding activity or reactivity of less than 50%, preferably less than 10%, when alanine (A) is present at position 25 of the amino acid sequence of the extracellular domain of human TGF-PRII, a binding activity or reactivity of less than 20% when alanine (A) is present at position 54 of the amino acid sequence of the extracellular domain of human TGF-PRII, a binding activity or reactivity of less than 10%, preferably less than 3%, 2%, or 1%, when alanine (A) is present at position 119 of the amino acid sequence of the extracellular domain of human TGF-PRII, and a binding activity or reactivity of less than 80% preferably less than 70%, 60%, 50%, 40%, 30%, 10%, or 5%, when alanine (A) is present at position 120 of the amino acid sequence of the extracellular domain of human TGF-PRI
- Another way of defining an antibody or antibody fragment of the present invention is that it binds to an epitope of the extracellular domain of human TGFpRII of which
- An antibody or antibody fragment of the present invention may also be defined as an antibody or antibody fragment that binds to an epitope in the extracellular domain of human TGF-PRII, wherein the epitope comprises a phenylalanine (F) residue, an isoleucine (I) residue, an aspartate (D) residue, and a glutamate (E) residue that in isoform A of human TGF-PRII, the wildtype sequence of which is as set forth in SEQ ID No.102, are at positions 25, 54, 119, and 120 respectively.
- F phenylalanine
- I isoleucine
- D aspartate
- E glutamate
- the present inventors identified a number of antibodies that comprise a heavy chain variable region that specifically binds to an epitope of the extracellular TGF-PRII of which phenylalanine (F) at position 25 is critical for binding.
- a heavy chain variable region having: (a) a VH-CDRl comprising the amino acid sequence set forth in SEQ ID No. 1,
- VH-CDR2 comprising the amino acid sequence set forth in SEQ ID No. 2, and
- VH-CDR3 comprising the amino acid sequence set forth in SEQ ID No. 3, wherein one to five amino acid residue(s) may be varied with conservative amino acid(s) thereof in any one or more of the CDR(s) selected from VH-CDRl, VH- CDR2 and VH-CDR3.
- This antibody is encompassed by the present invention.
- VH heavy chain variable region
- VH-CDRl comprising the amino acid sequence set forth in SEQ ID No. 4
- VH-CDR2 comprising the amino acid sequence set forth in SEQ ID No. 5
- VH-CDR3 comprising the amino acid sequence set forth in SEQ ID No. 6, wherein one to five amino acid residue(s) may be varied with conservative amino acid(s) thereof in any one or more of the CDR(s) selected from VH-CDRl, VH- CDR2 and VH-CDR3.
- This antibody is also encompassed by the present invention.
- VH heavy chain variable region
- VH-CDR2 comprising the amino acid sequence set forth in SEQ ID No. 8, and
- VH-CDR3 comprising the amino acid sequence set forth in SEQ ID No. 9, wherein one to five amino acid residue(s) may be varied with conservative amino acid(s) thereof in any one or more of the CDR(s) selected from VH-CDR1, VH- CDR2 and VH-CDR3.
- This antibody is also encompassed by the present invention.
- the heavy chain variable region of the antibody or antibody fragment of the invention may thus comprise a CDR1 selected from the group consisting of the sequences as set forth in SEQ ID NOs: 1, 4, and 7; a CDR2 selected from the group consisting of the sequences as set forth in SEQ ID NOs: 2, 5, and 8; and/or a CDR3 selected from the group consisting of the sequences as set forth in SEQ ID NOs: 3, 6, and 9; wherein one to five amino acid residue(s) may be varied with conservative amino acid(s) thereof in any one or more of the CDR(s) selected from CDR1, CDR2 and CDR3.
- the framework regions of the heavy chain variable region may be selected from any suitable framework regions.
- suitable framework regions are the framework regions encoded by the human V genes IGHV3-15 and IGHV3-23. These germline V genes may comprise one or more somatic mutations.
- the antibody or an antibody fragment thereof comprises a VH having amino acid sequence: EVQLVESGGGLVQPGGSLRLSCAASGFTFDIYAMTWVRQAPGKGLEWVSVISG SGGTT YY AD S VKGRFTISRDN SKNTL YLQMN SLRAEDT AVYY C ARRGQ YRDIV GATDYWGQGTLVTVSS (SEQ ID NO: 10), or a VH amino acid sequence having at least 80%, preferably at least 90%, more preferably at least 95%, identity thereto.
- the antibody or an antibody fragment thereof comprises a VH having amino acid sequence:
- the antibody or an antibody fragment thereof comprises a VH having amino acid sequence:
- V S S (SEQ ID NO: 12), or a VH amino acid sequence having at least 80%, preferably at least 90%, more preferably at least 95%, identity thereto.
- the heavy chain variable region can have 0-10, preferably 0-5 amino acid variations with respect to the indicated amino acid sequence.
- the heavy chain variable region comprises 0-9, 0-8, 0-7, 0-6, 0-5, 0-4, preferably 0-3, preferably 0-2, preferably 0-1 and more preferably 0 amino acid variations, insertions, deletions, substitutions, additions with respect to the indicated amino acid sequence, or a combination thereof at positions other than the CDRs.
- a combination of an insertion, addition, deletion or substitution is a combination if aligned sequences do not differ at more than 10, preferably no more than 5 positions.
- a gap in one of the aligned sequences counts for as many amino acids as skipped in the other sequence.
- amino acid substitution if any, is preferably a conservative amino acid substitution.
- the substitutions in the heavy chain variable region may be in addition to the substitutions in the one or more CDRs as described above.
- Conservative amino acids are known in the art based on similarities of the respective functional groups based on characteristics such as charge, hydrophobicity, hydrophilicity, acidity, basic, and size.
- amino acid variation, insertion, deletion, substitution, addition or combination thereof is preferably not made in the binding interface of the heavy and light chain.
- an amino acid is changed in the interface of the H/L chain interaction, it is preferred that the corresponding amino acids in the other chain are changed to accommodate the change.
- An insertion or addition of an amino acid preferably does not entail the insertion or addition of a proline.
- the invention encompasses antibodies or antibody fragments comprising a variant of the antibody or antibody fragment as described herein.
- an antibody or antibody fragment comprising a VH having any one of SEQ ID NO: 22-91 and 93, i.e. any one of the VH sequences as shown in Figure 4.
- antibodies or antibody fragments comprising at least HCDR3, or all CDRs, of any one of SEQ ID NO: 22-91 and 93.
- Preferred antibodies or antibody fragments comprise a heavy chain variable region having, or which is derived from, an amino acid sequence set forth in SEQ ID NO: 40; 43; 46; 47; 48 or 54, which are variants of antibodies comprising a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 11.
- Other preferred antibodies or antibody fragments comprise a heavy chain variable region having, or which is derived from, an amino acid sequence set forth in SEQ ID NO: 67; 70; 75; 76; 77; 78; 83; 84; or 88, which are variants of antibodies comprising a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 12.
- Other preferred antibodies or antibody fragments comprise a heavy chain variable region having, or which is derived from, an amino acid sequence set forth in SEQ ID NO:24 or 26, which are variants of antibodies comprising a heavy chain variable region comprising an amino acid sequence set forth in SEQ ID NO: 10.
- the most preferred variants are those comprising a heavy chain variable region having an amino acid sequence set forth in SEQ ID NO: 40; 43; 46; 47; 48; 54; 67; 70; 75; 76; 77; 78; 83; 84; or 88.
- the heavy chain variable region of such variant can have 0-10, preferably 0-5 amino acid variations with respect to the indicated amino acid sequence.
- the heavy chain variable region comprises 0-9, 0-8, 0-7, 0-6, 0-5, 0-4, preferably 0-3, preferably 0-2, preferably 0-1 and more preferably 0 amino acid variations, insertions, deletions, substitutions, additions with respect to the indicated amino acid sequence, or a combination thereof at positions other than the CDRs.
- the antibody or antibody fragment, or the binding domain, of the present invention may comprise any suitable light chain, such as for instance a cognate light chain or a common light chain as defined herein.
- the light chain variable region comprises the amino acid sequence of an IgVKl-39*01 gene segment as depicted in Figure IB with 0-10, preferably 0-5 amino acid variations, insertions, deletions, substitutions, additions or a combination thereof.
- IgVKl-39 is short for Immunoglobulin Variable Kappa 1-39 Gene.
- the gene is also known as Immunoglobulin Kappa Variable 1-39; IGKV139; IGKV1- 39.
- External Ids for the gene are HGNC: 5740; Entrez Gene: 28930; Ensembl:
- FIG. 1 A A preferred amino acid sequence for IgVKl-39 is given in Figure 1 A. This lists the sequence of the V-region. The V-region can be combined with one of five J-regions.
- Figures IB and 1C describe two preferred sequences for IgVKl-39 in combination with a J-region. The joined sequences are indicated as IGKVl-39/jkl and IGKVl-39/jk5; alternative names are IgVKl-39*01/IGJKl*01 or IgVKl- 39*01/IGJK5*01 (nomenclature according to the IMGT database worldwide web at imgt.org).
- the IgVKl-39*01 comprising light chain variable region is a germline sequence. It is further preferred that the IGJK1*01 or IGJK5*01 comprising light chain variable region is a germline sequence. It is further preferred that the IGKVl-39/jkl or IGKVl-39/jk5 light chain variable regions are germline sequences. Mature B-cells that produce an antibody with a light chain often produce a light chain that has undergone one or more mutations with respect to the germline sequence, meaning the normal sequence in non-lymphoid cells of the organism. The process that is responsible for these mutations is referred to as somatic hypermutation. The resulting light chain is referred to as an affinity matured light chain.
- Such light chains when derived from a germline IgVKl-39*01 sequence are IgVKl-39*01 derived light chains.
- the phrase “IgVKl-39*01” will include IgVKl -39*01 -derived light chains.
- the mutations that are introduced into nucleic acid encoding the light chain by somatic hypermutation can also be introduced artificially in the lab. In the lab also other variations to a light chain can be introduced without affecting the properties of the light chain in kind, not necessarily in amount.
- a light chain is at least an IgVKl-39*01 light chain if it comprises a sequence as depicted in Figure 1A, Figure IB or Figure 1C with 0-10, preferably 0-5 amino acid variations, insertions, deletions, substitutions, additions or a combination thereof.
- the IgVKl-39*01 light chain is a light chain comprising a sequence as depicted in Figure 1A, Figure IB or Figure 1C with 0-9, 0-8, 0-7, 0-6, 0-5, 0-4 amino acid variations, insertions, deletions, substitutions, additions or a combination thereof, more preferably a sequence as depicted in Figure 1 A, Figure IB or Figure 1C with 0-5, preferably 0-4, 0-3, 0-2, 0-1 amino acid variations, insertions, deletions, substitutions, additions or a combination thereof, even more preferably a sequence as depicted in Figure 1 A, Figure IB or Figure 1C with 0-3 amino acid variations, insertions, deletions, substitutions, additions or a combination thereof, even more preferably a sequence as depicted in Figure 1 A Figure IB or Figure 1C with 0-2 amino acid variations, insertions, deletions, substitutions, additions or a combination thereof, even more preferably a sequence as depicted in Figure 1
- VL-CDR1 comprising the amino acid sequence set forth in SEQ ID No. 19,
- VL-CDR2 comprising the amino acid sequence set forth in SEQ ID No. 20
- VL-CDR3 comprising the amino acid sequence set forth in SEQ ID No. 21, wherein one to five amino acid residue(s) may be substituted with conservative amino acid(s) thereof in any one or more of the CDR(s) selected from VL-CDR1, VL- CDR2 and VL-CDR3.
- the light chain variable region of the antibody or antibody fragment, or binding domain, of the invention preferably comprises a CDR1, CDR2, and CDR3 region comprising the amino acid sequence CDR1 - QSISSY (SEQ ID NO: 13), CDR2 - AAS (SEQ ID NO: 14), CDR3 - QQSYSTPPT (SEQ ID NO: 15), i.e. the CDRs of IGKV1- 39 (according to IMGT), allowing for 0-5 amino acid substitutions with respect to the indicated amino acid sequence.
- the amino acid sequences are: CDR1 - RASQSISSYLN (SEQ ID NO: 19), CDR2 - AASSLQS (SEQ ID NO: 20), CDR3 - QQSYSTPPT (SEQ ID NO: 21).
- Any amino acid variations, insertions, deletions, substitutions, additions or combination thereof are preferably not in the CDR3 region of the light chain variable region, preferably not in the CDR1 or CDR2 region of the light chain variable region.
- An amino acid substitution is preferably a conservative amino acid substitution.
- the light chain variable region of the antibody or antibody fragment, or binding domain, of the invention preferably comprises the amino acid sequence
- DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQ SGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPTFGQGTKVEIK (SEQ ID NO: 16), or a VL amino acid sequence having at least 80% identity thereto. This thus, allows for 0-5 amino acid variations, insertions, deletions, substitutions, additions or a combination thereof.
- An amino acid substitution is preferably a conservative amino acid substitution.
- the antibody of the present invention may be of any isotype: IgA, IgM, IgG,
- the antibody is an IgG, in particular an IgGl or IgG4. Most preferably, the antibody is an IgGl .
- the constant region of an antibody of the present invention is preferably a human constant region, but may be of any animal. It can be a mouse or rat constant region. A mouse constant region or rat constant region may advantageously be used, depending on the host organism immunized or screening methodology employed to select the recombined antibodies generated in response to an antigen.
- the antibody or antibody fragment thereof may comprise a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID No. 17.
- the antibody or antibody fragment thereof may comprise a light chain constant region comprising the amino acid sequence set forth in SEQ ID No. 18.
- the constant region may contain one or more, preferably not more than 10, preferably not more than 5 amino acid differences with the constant region of a conventional human antibody.
- the antibody of the invention may be an IgG antibody with a variant CH2 and/or lower hinge domain such that interaction of the antibody to an Fc-gamma receptor is reduced.
- a mutant CH2 and/or lower hinge domain preferably comprises an amino variation at position 235 and/or 236 (EU numbering), preferably comprising residues at the following positions 235G and/or 236R.
- the isolated monoclonal antibody may comprise two heavy chain constant regions of an IgGl antibody, wherein lysine at position 447 according to the EU numbering system is deleted.
- a preferred antibody or antibody fragment of the present invention comprises heavy chain variable region CDR and light chain variable region CDR combinations as listed in Table 1.
- a preferred antibody or antibody fragment of the invention comprises a heavy chain having a VH comprising an amino acid sequence selected from the group consisting of SEQ ID NO: 10, 11, 12, 22-91 and 93, in particular a preferred VH as described herein, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID NO: 16.
- This antibody or antibody fragment can comprise any constant domain as described herein.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 10, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 11, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 12, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 43, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 75, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 70, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 84, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 88, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 40, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 83, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 78, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 47, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 76, and a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16.
- the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 10 and two light chain variable regions of SEQ ID NO: 16.
- the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 11 and two light chain variable regions of SEQ ID NO: 16 In another embodiment, the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 12 and two light chain variable regions of SEQ ID NO: 16.
- the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 43 and two light chain variable regions of SEQ ID NO: 16.
- the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 75 and two light chain variable regions of SEQ ID NO: 16. In one embodiment, the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 70 and two light chain variable regions of SEQ ID NO: 16.
- the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 84 and two light chain variable regions of SEQ ID NO: 16.
- the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 88 and two light chain variable regions of SEQ ID NO: 16.
- the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 40 and two light chain variable regions of SEQ ID NO: 16.
- the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 83 and two light chain variable regions of SEQ ID NO: 16. In one embodiment, the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 78 and two light chain variable regions of SEQ ID NO: 16.
- the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 47 and two light chain variable regions of SEQ ID NO: 16. In one embodiment, the antibody or antibody fragment thereof as described herein comprises two heavy chain variable regions of SEQ ID NO: 76 and two light chain variable regions of SEQ ID NO: 16.
- the antibody of the invention comprises: (A) a heavy chain having a VH comprising the amino acid sequence set forth in
- the antibody of the invention comprises:
- A a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 11, and a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID No. 17; and (B) a light chain having a VL comprising the amino acid sequence set forth in
- SEQ ID No. 16 and a light chain constant region comprising the amino acid sequence set forth in SEQ ID No. 18.
- the antibody of the invention comprises:
- the antibody of the invention comprises:
- the antibody of the invention comprises: (A) a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 75, and a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID No. 17; and
- the antibody of the invention comprises:
- the antibody of the invention comprises: (A) a heavy chain having a VH comprising the amino acid sequence set forth in
- SEQ ID No. 84 and a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID No. 17;
- the antibody of the invention comprises:
- A a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 88, and a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID No. 17; and (B) a light chain having a VL comprising the amino acid sequence set forth in
- SEQ ID No. 16 and a light chain constant region comprising the amino acid sequence set forth in SEQ ID No. 18.
- the antibody of the invention comprises:
- A a heavy chain having a VH comprising the amino acid sequence set forth in SEQ ID No. 40, and a heavy chain constant region comprising the amino acid sequence set forth in SEQ ID No. 17; and (B) a light chain having a VL comprising the amino acid sequence set forth in SEQ ID No. 16, and a light chain constant region comprising the amino acid sequence set forth in SEQ ID No. 18.
- the antibody of the invention comprises:
- the antibody of the invention comprises:
- the antibody of the invention comprises:
- the antibody of the invention comprises:
- the invention further provides a binding domain that specifically binds to human TGF-PRII, wherein the binding domain comprises: any one of the heavy chain variable regions (VH) selected from:
- VH-CDRl, VH-CDR2, and VH-CDR3 sequences are indicated in bold and underlined in the listing of sequences provided herein.
- the binding domain of the present invention comprises a VH amino acid sequence selected from SEQ ID NO: 12, 26, 30, 40, 61, 65, 70, 76, 85 and 86, or a VH amino acid sequence having at least 80% identity thereto.
- the binding domains of the present invention have shown to be useful in monovalent and multivalent form, providing for a variety of applications in monovalent molecules or bivalent molecules, or as one or more binding domains incorporated into a multispecific molecule. Said binding domains in monovalent form have superior TGF- pRII blocking capabilities as compared to a monovalent control antibody, rendering them suitable for the above applications.
- the present invention provides an antibody, preferably a multispecific antibody, comprising the binding domain of the present invention in monovalent form, which antibody has comparable receptor blocking activity at equimolar concentrations when compared to a bivalent monospecific control antibody, preferably as measured in the same assay.
- the control antibody comprises two heavy chain variable regions having an amino acid sequence as set forth in SEQ ID NO: 97 and two light chain variable regions having an amino acid sequence as set forth in SEQ ID NO: 135.
- the assay is a TGFP-reporter assay, preferably a TGFP-reporter assay as described in Example 5.
- the comparable receptor blocking activity includes a 5 to 2 fold, preferably a 3 fold, deviation, from the receptor blocking activity of the control antibody.
- the antibodies and binding domains described and claimed herein are preferably isolated antibodies or binding domains.
- they are monoclonal antibodies. More preferably, they are isolated monoclonal antibodies.
- the antibody or antibody fragment, or binding domain, of the present invention interferes with binding of ligands TGF-bI, TGF-P2, and/or TGF-P3 to TGF-PRII.
- the term “interferes with binding” means that the antibody or antibody fragment is directed to an epitope on TGF-PRII and competes with TGB-bI, TOB-b2, and/or TOB-b3 for binding to TGF ⁇ RII.
- the antibody or antibody fragment, or binding domain may diminish ligand binding, displace ligand binding when this is already bound to TGF- bEII, or may, for instance through steric hindrance, at least partially prevent ligand from binding to TGF ⁇ RII, and/or interfere or prevent TGF ⁇ RI-TGF ⁇ RII complex formation.
- the antibody or antibody fragment, or binding domain may diminish the formation of a TGF ⁇ RI and TGF ⁇ RII complex, displace such complex, when a complex is already formed, or may, for instance through steric hindrance, at least partially prevent TGF-PRI from complexing with TGF-PRII.
- the term “interferes with binding” also means that the antibody or antibody fragment, or binding domain, of the present invention blocks binding of ligands TGF-bI, TGF-P2, and/or TGF-P3 to TGF- pRIF
- the present invention further provides an expression vector comprising a polynucleotide encoding either or both the heavy chain and the light chain of the antibody or antibody fragment, or binding domain, as described herein.
- vectors include plasmids, phagemids, cosmids, viruses and phage nucleic acids or other nucleic acid molecules that are capable of replication in a prokaryotic or eukaryotic host cell, e.g. a mammalian cell.
- the vector may be an expression vector wherein the polynucleotide encoding either or both the heavy chain and the light chain of the antibody or antibody fragment of the invention is operably linked to expression control elements.
- Typical expression vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the polynucleotides.
- Antibodies are typically produced by a cell that expresses nucleic acid encoding the antibody.
- the invention therefore also provides an isolated cell, or a cell in a tissue culture, that produces and/or comprises the antibody or antibody fragment of the invention. Typically this is an in vitro, isolated or recombinant cell.
- Such cell comprises a nucleic acid encoding the antibody or antibody fragment of the invention.
- the cell is preferably an animal cell, more preferably a mammalian cell, more preferably a primate cell, most preferably a human cell.
- a suitable cell is any cell capable of comprising and preferably of producing an antibody according to the invention and/or comprising a nucleic acid according to the invention.
- the cell is a hybridoma cell, a Chinese hamster ovary (CHO) cell, an NSO cell or a PER.C6 cell. It is particularly preferred that the cell is a CHO cell.
- a cell culture, or cell line comprising a cell according to the invention.
- Cell lines developed for industrial scale production of proteins and antibodies are herein further referred to as industrial cell lines.
- the invention further provides a method for producing the antibody or antibody fragment, or binding domain, of the invention, the method comprising culturing a cell of the invention and harvesting the antibody or antibody fragment, or binding domain, from said culture.
- Said cell may be cultured in a serum free medium.
- Preferably said cell is adapted for suspension growth.
- the antibody or antibody fragment, or binding domain may be purified from the medium of the culture.
- said antibody or antibody fragment, or binding domain is affinity purified.
- the present invention further provides a pharmaceutical composition
- a pharmaceutical composition comprising an antibody or antibody fragment, or binding domain, as described herein, and a pharmaceutically acceptable carrier, diluent, or excipient.
- the injection or infusion solution may be in any form of an aqueous solution, suspension, or emulsion, or may be formulated as a solid agent together with pharmaceutically acceptable carrier such that that agent will be dissolved, suspended, or emulsified in a solvent at the time of use.
- the solvent that is used in the injection or the infusion solution for drip infusion include distilled water for injection, physiological saline, glucose solutions, and isotonic solutions (e.g., in which sodium chloride, potassium chloride, glycerin, mannitol, sorbitol, boric acid, borax, propylene glycol or the like is soluble).
- Examples of pharmaceutically acceptable carriers include stabilizers, solubilizers, suspending agents, emulsifiers, soothing agents, buffering agents, preservatives, antiseptic agents, pH adjusters, and antioxidants.
- stabilizers various amino acids, albumin, globulin, gelatin, mannitol, glucose, dextran, ethylene glycol, propylene glycol, polyethylene glycol, ascorbic acid, sodium bisulfite, sodium thiosulfate, sodium edetate, sodium citrate, dibutylhydroxytoluene, or the like, can be used.
- alcohols e.g., ethanol
- polyols e.g., propylene glycol and polyethylene glycol
- nonionic surfactants e.g., Polysorbate 20 (registered trademark), Polysorbate 80 (registered trademark) and HCO-50
- suspending agents glyceryl monostearate, aluminum monostearate, methyl cellulose, carboxymethyl cellulose, hydroxymethyl cellulose, sodium lauryl sulfate, or the like, can be used.
- emulsifiers gum arabic, sodium alginate, tragacanth, or the like, can be used.
- benzyl alcohol, chlorobutanol, sorbitol, or the like can be used.
- buffering agents phosphate buffer, acetate buffer, borate buffer, carbonate buffer, citrate buffer, Tris buffer, glutamic acid buffer, epsilon aminocaproic acid buffer, or the like, can be used.
- preservatives methyl parahydroxybenzoate, ethyl parahydroxybenzoate, propyl parahydroxybenzoate, butyl parahydroxybenzoate, chlorobutanol, benzyl alcohol, benzalkonium chloride, sodium dehydroacetate, sodium edeate, boric acid, borax, or the like, can be used.
- benzalkonium chloride parahydroxybenzoic acid, chlorobutanol, or the like
- pH adjusters hydrochloric acid, sodium hydroxide, phosphoric acid, acetic acid, or the like, can be used.
- antioxidants (1) aqueous antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabi sulfite, and sodium sulfite, (2) oil- soluble antioxidants such as ascorbyl palmitate, butylated hydroxy anisole, butylated hydroxy toluene, lecithin, propyl gallate, and a-tocopherol, or (3) metal chelating agents such as citric acid, ethylenediaminetetraacetic acid, sorbitol, tartaric acid, and phosphoric acid, can be used.
- aqueous antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabi sulfite, and sodium sulfite
- oil- soluble antioxidants such as ascorbyl palmitate, butylated hydroxy anisole, butylated hydroxy toluene, lecithin, propyl gallate, and a-tocopherol
- the injection or infusion solution for drip infusion can be produced by performing sterilization in the final process, or aseptic manipulation, e.g., sterilization by filtration with a filter and subsequently filling an aseptic container.
- the injection or infusion solution for drip infusion may be used by dissolving the vacuum dried or lyophilized aseptic powder (which may include a pharmaceutically acceptable carrier powder) in an appropriate solvent at the time of use.
- the invention further provides a method of treating cancer in a subject comprising administering an effective amount of an antibody or antibody fragment, binding domain, or a pharmaceutical composition, as described herein to the subject in need thereof.
- the invention provides an antibody or antibody fragment, or biding domain, as described herein for use in the treatment of cancer in a subject.
- the invention further provides a pharmaceutical agent for use in for preventing, suppressing symptom progression or recurrence of, and/or treating cancer, wherein the pharmaceutical agent comprises the antibody or antibody fragment thereof, or binding domain, as described herein as an active ingredient.
- Cancer patients usually have aberrant cells that are to be removed from the body.
- aberrant cells includes tumor cells, more specifically tumor cells present on any type of cancerous tissues associated with cancer-types correlated with higher than normal TGF-PRII expression.
- Aberrant cells herein further refers to those having increased signaling as a consequence of increased expression of TGF-b and/or release of TGF-b, and those forming a suppressive environment reducing effectiveness of tumor immunity due to abnormal TGF-b signaling and/or expression or higher than normal TGF-b, TGF ⁇ RI and/or TGF ⁇ RII expression, and/or higher than normal release of latent TGF-b.
- the antibody or antibody fragment, or binding domain, of the invention will be effective in the treatment of several types of cancer, including for instance cancer-types correlated with higher than normal TGF-b signaling, in particular with higher than normal TGF ⁇ RII expression.
- cancer-types correlated with higher than normal TGF-b signaling, in particular with higher than normal TGF ⁇ RII expression.
- cancer-types correlated with higher than normal TGF-b signaling, in particular with higher than normal TGF ⁇ RII expression.
- cancer-types correlated with higher than normal TGF-b signaling in particular with higher than normal TGF ⁇ RII expression.
- cancer-types correlated with higher than normal TGF-b signaling in particular with higher than normal TGF ⁇ RII expression.
- examples include, but are not limited to, breast cancer, colon cancer, colorectal cancer, gastric cancer, glioblastoma, neck cancer, hepatocellular carcinoma, non-small cell lung cancer, small cell lung cancer, melanoma, myelodysplastic syndrome
- the antibody or antibody fragment, or binding domain, of the present invention blocks binding of human TGF-b to human TGF ⁇ RII on the cell, thereby inhibiting TGF ⁇ RII signaling. This leads to decreased proliferation of deleterious or aberrant cells and/or enhanced tumor immunity and other beneficial effect.
- the invention therefore also provides a method of blocking binding of human TGF-b to human TGF ⁇ RII on a cell, the method comprising providing the antibody or antibody fragment, or binding domain, as described herein to the cell and allowing the antibody or antibody fragment to bind to the human TGF ⁇ RII of the cell, to thereby block binding of human TGF-b to human TGF ⁇ RII on the cell.
- This may be an in vitro method.
- the antibody of the present invention may have modulated effector function.
- Antibody-dependent cellular cytotoxicity also referred to as antibody-dependent cell-mediated cytotoxicity, is a mechanism of cell-mediated immune defence whereby an effector cell of the immune system actively lyses a target cell, whose membrane-surface antigens have been bound by specific antibodies.
- ADCC effector function is typically mediated by Fc receptors (FcRs). The receptors are key immune regulatory receptors connecting the antibody mediated
- FcyR immunoglobulin receptor
- FcyR FcyR
- IgE FceRI
- IgA FcpR
- IgM FcpR
- Fc5R Fc5R
- CD64 FcyRI
- CD32 FcyRIIa, FcyRIIb and FcyRIIc
- CD16 FcyRIIIa and FcyRIIIb.
- FcyRI is classed as a high affinity receptor (nanomolar range KD) while FcyRI I and FcyRIII are low to intermediate affinity (micromolar range KD).
- ADCC antibody dependent cellular cytotoxicity
- FcvRs on the surface of effector cells Natural killer cells, macrophages, monocytes and eosinophils
- a signalling pathway is triggered which results in the secretion of various substances, such as lytic enzymes, perforin, granzymes and tumour necrosis factor, which mediate in the destruction of the target cell.
- the level of ADCC effector function varies for human IgG subtypes. Although this is dependent on the allotype and specific FcvR in simple terms ADCC effector function is high for human IgGl and IgG3, and low for IgG2 and IgG4.
- CDC complement-dependent cytotoxicity
- ADCC activity can be enhanced by different techniques by slightly modifying the constant region, one of them being the removal of fucose. Removal of fucose has resulted in increased anti-tumour activity in several in vivo models (Junttila et ak, Cancer Research (2010), Vol. 70(22), pp. 4481-4489). Afucosylation technology may be applied, thereby preventing fucosylation of the N- linked carbohydrate structure in the Fc region.
- effector function can also be reduced or eliminated.
- leucine at position 235 according to the EU numbering system may be substituted with glycine, and/or glycine at position 236 according to the EU numbering system may be substituted with arginine.
- Such modification(s) ensure that binding to an Fc receptor and/or effector function is eliminated or decreased.
- Other substitutions, deletions, or insertions known in the art to the same effect are also encompassed within the present invention.
- the invention further provides a method of inhibiting signal transduction into a cell induced by binding of a human TGF-b to a human TGF-PRII of the cell, the method comprising providing the antibody or antibody fragment, or binding domain, as described herein to the cell and allowing the antibody or antibody fragment to bind to the human TGF-PRII of the cell, to thereby inhibit the signal transduction into the cell.
- This may be an in vitro method.
- the invention also provides a method of preventing or inhibiting metastasis, the method comprising administering an effective amount of the antibody or antibody fragment, binding domain, or the pharmaceutical composition, as described herein, to a subject.
- the antibody or antibody fragment, or binding domain, of the present invention may be used in the treatment of cancer as a single therapy but may also be combined with other anti-cancer agents.
- Other anti-cancer agents include, but are not limited to, therapeutic antibodies that target the same or different tumor antigens or modulate elements of the immune system, agents used in chemotherapy (e.g. cyclophosphamide), and agents used in hormone therapy, or in applications related to localized administration including an oncolytic virus.
- Treatment with the antibody or antibody fragment, or binding domain, of the present invention may also be combined with other anti-cancer treatments, such as for instance surgery or radiotherapy. Combinations of treatment can be simultaneous, separate, or sequential.
- an element may mean one element or more than one element.
- “Plurality” means two or more. Note that in the present specification, unless stated otherwise, amino acid positions assigned to CDRs and frameworks in a variable region of an antibody or antibody fragment are specified according to Rabat's numbering (see Sequences of Proteins of Immunological Interest (National Institute of Health, Bethesda, Md., 1987 and 1991)). Amino acids in the constant regions are indicated according to the EU numbering system based on Rabat's amino acid positions (see Sequences of proteins of immunological interest, NIH Publication No. 91-3242).
- Accession numbers are primarily given to provide a further method of identification of a target, the actual sequence of the protein bound may vary, for instance because of a mutation in the encoding gene such as those occurring in some cancers or the like.
- the antigen binding site binds the antigen and a variety of variants thereof, such as those expressed by some antigen positive immune or tumor cells.
- a gene When herein reference is made to a gene, a protein, the reference is preferably to the human form of the gene or protein.
- a gene or protein reference is made to the natural gene or protein and to variant forms of the gene or protein as can be detected in tumors, cancers and the like, preferably as can be detected in human tumors, cancers and the like.
- HGNC stands for the HUGO Gene nomenclature committee. The number following the abbreviation is the accession number with which information on the gene and protein encoded by the gene can be retrieved from the HGNC database. Entrez
- Gene provides the accession number or gene ID with which information on the gene or protein encoded by the gene can be retrieved from the NCBI (National Center for Biotechnology Information) database.
- Ensemble provides the accession number with which information on the gene or protein encoded by the gene can be obtained from the Ensemble database.
- Ensembl is a joint project between EMBL-EBI and the Wellcome Trust Sanger Institute to develop a software system which produces and maintains automatic annotation on selected eukaryotic genomes.
- Figure 1 presents the amino acid sequences of the IGKV1-39 light chain variable V region (Figure 1A); IGKVl-39/jkl light chain variable region ( Figure IB); and IGKVl-39/jk5 light chain variable region ( Figure 1C).
- Figure 2 presents the FACS data of antibody binding to endogenously expressed TGF-PRII on CCDI8C0 cells.
- Figure 2A shows the MFI PE of antibodies comprising heavy chain variable regions having SEQ ID NO: 92 (negative control);
- FIG. 2B shows the MFI PE of antibodies comprising heavy chain variable regions having SEQ ID NO: 92 (negative control);
- SEQ ID NO: 10 SEQ ID NO: 11; SEQ ID NO: 12; SEQ ID NO: 95; and SEQ ID NO: 96.
- Figure 3 presents the ELISA data of ligand blocking activity of antibodies comprising heavy chain variable regions having SEQ ID NO: 92 (negative control); SEQ ID NO: 93; and SEQ ID NO: 94 ( Figure 3 A), and of antibodies comprising heavy chain variable regions having SEQ ID NO: 92 (negative control); SEQ ID NO: 10; SEQ ID NO: 11; SEQ ID NO: 12; SEQ ID NO: 95; and SEQ ID NO: 96 ( Figure 3B).
- Figure 4 presents an amino acid sequence alignment generated using the AlignX application of the Vector NTI Program Advance 11.5.2 software of the heavy chains comprising heavy chain variable regions having SEQ ID NO: 10 (middle alignment); SEQ ID NO: 11 (bottom alignment); and SEQ ID NO: 12 (top alignment) with their respective affinity matured variants.
- Identical amino acids are indicated with black letters against a white background; weakly similar amino acids are indicated with white letters against a grey background; conservative changes are indicated with black letters against a grey background; and non-similar amino acids are indicated with white letters against a dark grey background.
- Figure 5 shows the binding affinity of the parental antibodies (SEQ ID NO: 10; SEQ ID NO: 11; SEQ ID NO: 12) and the affinity matured variants (SEQ ID NO:
- Figure 6 shows the data from the luciferase reporter assay of the affinity matured variants.
- the X-axis shows the concentration of antibody in pg/ml.
- the Y-axis shows the fold induction of the Smad complex as a measure of TGF-b signaling inhibition.
- Graphs A-K each compare the activity of affinity matured variants with a control antibody (SEQ ID NO: 97).
- Basal TGF-b is included as a control of TGF-b stimulation of the cells.
- Figure 7 shows the data from the alanine scan.
- Figure 7A presents an overview of how critical residues are identified and mapped.
- Figure 7B shows the mean fluorescence of SEQ ID NO: 10; SEQ ID NO: 12; and SEQ ID NO: 93, as a percentage compared to wildtype.
- Figure 7C is a table showing the binding reactivity of SEQ ID NO: 10; SEQ ID NO: 12; SEQ ID NO: 93; and SEQ ID NO: 98 (control), as a percentage compared to wildtype. Residues critical for binding are indicated with rectangles.
- Figure 7D shows the mapping of the critical residues on TORbIIII
- Figure 8 shows the results from screening a variety of bispecific antibodies comprising a TGF ⁇ RII binding domain of the invention in a TGF-b reporter assay.
- the X-axis shows the concentration of antibody in pg/ml.
- the Y-axis shows the fold induction of Smad signaling.
- Graphs A-E each compare the activity of the bispecific antibodies comprising a single TGF ⁇ RII binding domain with the positive control antibody known to block ligand binding to TGF ⁇ RII (+) as described in Example 1.
- Basal TGF-b is included as a control of TGF-b stimulation of the cells.
- A) D TGF ⁇ RII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 76; ⁇ TGF ⁇ RII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 61; ⁇ TGF ⁇ RII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 26.
- TGF ⁇ RII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 70; * TGF ⁇ RII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 70; ⁇ TGF ⁇ RII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 61; ⁇ TGF ⁇ RII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 86; D TGF ⁇ RII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 65.
- TGF-PRII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 65; o TGF-PRII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 40; ⁇ TGF-PRII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 12; ⁇ TGF-PRII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 76; D TGF-PRII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 26.
- TGF-PRII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 12; ⁇ TGF-PRII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 85.
- TGF-PRII binding domain comprising a heavy chain variable region having amino acid sequence as set forth in SEQ ID NO: 86.
- Transgenic mice comprising a common IGKV1-39 light chain (MeMo® mice) were immunized with human TGF-PRII (isoform A), thereby generating an immune response including the production of human anti-TGF-PRII specific antibodies.
- Lymphoid material of the immunized mice was collected, from which nucleic acids were extracted and used for the synthesis of cDNA encoding the heavy chain variable regions of such antibodies.
- the cDNA was used to generate phage display libraries, from which human TGF-PRII binding Fabs were selected using the Kingfisher selection robot.
- Human TGF-PRII transiently transfected HEK293T cells were used for FACS screening.
- the Fab end-concentration was between 0.5 and 5 pg/ml.
- Fabs binding TGF- pRII were detected with goat anti-kappa light chain antibodies (Ab0646; 5 pg/ml) followed by rabbit anti-goat PE (Ab0330; 1/100 dilution).
- a positive control antibody was produced based on information obtained from US 2010/0119516.
- This positive control antibody comprises two heavy chain variable regions and two light chain variable regions having the amino acid sequences of mAb TGF1 (SEQ ID NO: 97 and SEQ ID NO: 135 respectively) described therein.
- An antibody comprising these heavy and light chain variable regions is reported to block ligand binding to TGF-PRII.
- a negative control antibody against RSV was produced.
- This negative control antibody comprises two heavy chain variable regions having an amino acid sequence as set forth in SEQ ID NO: 136 and two light chain variable regions as set forth in SEQ ID NO: 16.
- VH fragments of the TGF-PRII binding Fabs identified in Example 1 were recloned into an IgG expression format to express and purify IgG from 293 T freestyle cells. Antigen binding
- Antibodies were screened for binding to endogenously expressed human TGF- PRII on CCDI8C0 cells using FACS. Results are shown in Figure 2. All antibodies tested showed similar binding to the CCDI8C0 cells.
- the Fab comprising heavy chain variable regions having an amino acid set forth in SEQ ID NO: 11, obtained from the first round of immunization, comprises the same HCDR3 sequence as Fabs obtained from the second round of immunization, for example the Fab comprising heavy chain variable regions having an amino acid sequence set forth in SEQ ID NO: 93. This indicates that the recombination of VDJ gene segments in the mice is to a great extent the same in response to this antigen.
- binding affinity The binding affinity of antibodies comprising heavy chain variable regions having an amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 93 and SEQ ID NO: 12 was determined by SPR. For this, the antibodies were reformatted as bivalent IgG’s monospecific for TGFpRII.
- Anti-TGF-PRII IgG antibodies were captured on a CM5 sensor chip surface by an immobilized anti-CHI antibody (Ab0669; BD cat.no. BD555784), followed by the addition of human recombinant TGF-PRII (R&D systems cat.no.241-R2/CF; region Ile24-Apsl95). Measurements were carried out at 25°C. Coupling was performed at pH 4.5. Results are shown in Table 2.
- Ligand blocking activity of the IgG samples was determined using an ELISA assay. An ELISA plate was coated with TGF-bI at 0.4 pg/ml. Human TGF-PRII-Fc
- Example 3 - Affinity maturation Fab phage display libraries of variant heavy chains comprising variable heavy chain regions having an amino acid sequence set forth in SEQ ID NO: 10, SEQ ID NO: 11, and SEQ ID NO: 12, that specifically bind TGF-PRII and block ligand interaction and TGF-PRII and TGF-PRI heterodimerization, were generated to evaluate whether antibodies could be produced with higher affinity.
- the library was designed to generate heavy chain variable regions with increased affinity and having typically three to four variations: one in CDR1, one in CDR2, and one or two in CDR3, with certain number of variants having more than 4 variations overall.
- An overview of the variants is provided as a sequence alignment in Figure 4.
- Variants with higher affinity were selected using two different selection methods, both with biotinylated human TGF-PRII-Fc as antigen, and both using the
- the first selection round comprised an affinity based selection as described in Example 1, using different concentrations of biotinylated TGF-PRII-Fc. Only the output from the selection with the lowest antigen concentration showing clear enrichment was subsequently further used in two separate selection methods.
- the first selection method entails two additional rounds of affinity based selections, however, this time with further decreasing concentrations of antigen as compared to the optimal antigen concentration used in the preceding selection round.
- the second selection method also entails two additional rounds of selections which are both affinity based, via decreasing concentrations of antigen, as well as off-rate based, via including a wash step in the presence of an excess of non-biotinylated antigen.
- Phage output was determined according to the spot method, wherein TGI cells were infected with serial dilutions of phage outputs and plated on LB agar amp/glu plates for counting colonies the next day.
- Phage outputs were rescued via bacterial infection to generate sufficient phages for subsequent selections, as well as to generate plates with bacterial colonies. Colonies were picked into 96-wells plates for antibody production. The generated antibodies were used for the preparation of periplasmic extracts containing soluble Fabs.
- Affinity matured variants were reformatted as bivalent IgG’s monospecific for TGFpRII. SPR analysis was performed to determine the affinity of the variants for TGF-PRII. Results are shown in Table 4 and Figure 5.
- Reporter assay of variants Affinity matured variants were reformatted to bivalent IgG format as described in Example 2. The obtained antibodies were used in a TGF-PRII luciferase based reporter assay to test the capacity of the antibodies to inhibit ligand induced activation of the receptor.
- 293F Freestyle cells were transiently transfected with the reporter CAGAo luciferase. The next day, transfected cells were plated and stimulated with 1 ng/ml of hTGF-bI in the presence/absence of a 6-point, semi-log serial dilution of anti-TGF-PRII antibody. The anti-TGF-PRII antibody was added simultaneously. The starting and highest concentration of the antibody was 10 pg/ml, and the lowest concentration was 0.03 pg/ml. The 293F Freestyle cells, hTGF-bI and anti-TGF ⁇ RII antibody mixture was incubated for 3 hours in a 37°C, 5% C02 incubator.
- Each plate a titration of a negative competition control comprising a heavy chain variable region having SEQ ID NO: 97 and one well which does not contain TGF-b.
- a read out Steady-Glo Luciferase Assay System detection reagent was added and luciferase was measured after a 5 minute incubation on the EnVision. The fold response was calculated as follows:
- Example 5 TGF-BRII blocking activity of antibodies comprising a TGF-BRII binding domain
- RSVxTGF-PRII and Antigen AxTGF-PRII antibodies were screened in a TGFP reporter assay.
- Bispecific antibodies were produced comprising a first binding domain that binds TGF-PRII comprising a VH region of a selection of antibodies as described herein and a second binding domain that binds RSV comprising a VH region having an amino acid sequence as set forth in SEQ ID NO: 136, or a second binding domain that binds an antigen expressed on the same cell as TGF-PRII (Antigen A).
- Antigen A is an arbitrarily selected antigen not reactive with TGFp or impacting the signaling cascade tested in the TGFp reporter assay. Also included were the positive control antibody and negative control antibodies as described in Example 1.
- the TGFp reporter assay uses a CAGA12 luciferase vector containing 12 copies of the CAGA box which are the SMAD3 and SMAD4 binding sequences [Dennler et al, 1998] Binding of TGFP to TGF-PRII leads to phosphorylation of TGF-PRI. Phosphorylation of TGF-PRI initiates a signaling cascade that leads to phosphorylation and activation of SMAD2 and SMAD3, which then form a complex with SMAD4. The SMAD complex then translocates to the nucleus and binds to the SMAD binding element (SBE) in the nucleus, leading to transcription and expression of TGFp/ SMAD responsive genes.
- the CAGA12 luciferase reporter can be used to monitor activation by TGFP and to screen TGF-PRII blocking antibodies after transfecting the reporter in mammalian cells.
- Cryopreserved 293FF cells stably transfected to express Antigen A were transiently transfected with the TGFp reporter.
- IgGs were tested at a final concentration of 10 pg/ml to 100 pg/ml. IgGs were added in a final volume of 25 m ⁇ (4x concentrated). Subsequently, 25 m ⁇ of hTGFpi (4x concentrated) was added with a final concentration of 1 ng/ml. 50 pL transfected cell suspension (5 x 10 4 cells) was added. 100 pL Steady- GloTM substrate was added to each well and allowed to incubate for 5 minutes. Luminescence was measured on EnVision and results analyzed using Graphpad Prism.
- results are shown in Figure 8.
- the bispecific antibody targeting TGF-PRII and RSV, which include the TGF-PRII binding domains comprising a VH region having an amino acid sequence as set out in SEQ ID NO: 76 and 70 are nearly as potent as the bivalent monospecific positive control antibody.
- Bispecific antibodies targeting TGF-PRII and Antigen A which include the TGF-PRII binding domain comprising a VH region having an amino acid sequence as set out in SEQ ID NO: 70, 61, 86, 65, 12, and 76, are more potent than the bivalent monospecific positive control antibody. Accordingly, anti- TGF-PRII binding domains of the present disclosure demonstrate comparable, equal and superior TGF-PRII blocking capability in monovalent form, providing for a variety of applications as monovalent molecules, bivalent molecules, or as a one or more valencenes as incorporated into a multispecific molecule.
- nucleic acids encoding VH regions of a selection of antibodies that were identified to bind human TGF-PRII and block interaction with its ligand were sequenced. Sequence information is provided below.
- SEQ ID NO: 1 HCDR1 according to Rabat IYAMT
- SEQ ID NO: 2 HCDR2 according to Rabat
- SEQ ID NO: 4 HCDR1 according to Rabat
- SEQ ID NO: 5 HCDR2 according to Rabat
- SEQ ID NO: 6 HCDR3 according to Rabat DLRDY
- SEQ ID NO: 7 HCDR1 according to Rabat
- SEQ ID NO: 8 HCDR2 according to Rabat
- SEQ ID NO: 12 Heavy chain variable region
- SEQ ID NO: 13 LCDR1 according to IMGT
- SEQ ID NO: 15 LCDR3 according to IMGT
- SEQ ID NO: 16 Light chain variable region DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYA
- TKVEIK SEQ ID NO: 17 Heavy chain constant region
- SEQ ID NO: 18 Light chain constant region RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQS
- SEQ ID NO: 19 LCDR1 according to Kabat RASQSISSYLN
- SEQ ID NO: 20 LCDR2 according to Kabat
- AASSLQS SEQ ID NO: 21 LCDR3 according to Kabat
- SEQ ID NO: 22 Heavy chain variable region
- SEQ ID NO: 24 Heavy chain variable region
- SEQ ID NO: 25 Heavy chain variable region
- SEQ ID NO: 26 Heavy chain variable region
- SEQ ID NO: 27 Heavy chain variable region
- SEQ ID NO: 28 Heavy chain variable region
- SEQ ID NO: 29 Heavy chain variable region EVQLVESGGGLVQPGGSLRLSCAASGFDFDIYAMTWVRQAPGKGLEWV SVISGSGGTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RRSQYRDKVGATD YWGQGTL VT VS SEQ ID NO: 30: Heavy chain variable region
- SEQ ID NO: 41 Heavy chain variable region QVQLVESGGGLVEPGGSLRLSCAASGFTFSRAWMSWVRQAPGKGLEW VGRIKTTYSGGATDFAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVY YCTLDLRK YWGQGTLVT VS
- SEQ ID NO: 42 Heavy chain variable region
- SEQ ID NO: 77 Heavy chain variable region QVQLVESGGGLVQPGGSLRLSCAVSGFSFRRYAMSWVRQAPGKGLEW V S AIS ASGDRTLNTD S VKGRF SISRDN SKNTL YLQMN SLRAEDT AVYF C AKGT AARGKNYFDPWGQGTL VT VS S SEQ ID NO: 78: Heavy chain variable region
- V S AIS ASGDRTHNTD S VKGRF SISRDN SKNTL YLQMN SLRAEDTAVYF C AKGT AARGKNYFDPWGQGTL VT VS S SEQ ID NO: 89: Heavy chain variable region QVQLVESGGGLVQPGGSLRLSCAVSGFTFRRYAMSWVRQAPGKGLEW V S AIS ASGDRTHNTD S VKGRF SISRDN SKNTL YLQMN SLRAEDT AVYF C AKGIAASGKNFFDPW GQGTL VTV S S SEQ ID NO: 90: Heavy chain variable region
- SEQ ID NO: 100 IGKVl-39/jk5 DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYA
- SEQ ID NO: 101 Isoform A human TGF-bIHI MGRGLLRGLWPLHIVLWTRIASTIPPHVOKSVNNDMIVTDNNGAVKFP
- SEQ ID NO: 102 Extracellular domain of isoform A of human TGF-pRII
- SEQ ID NO: 103 Isoform B human TGFpRII
- SEQ ID NO: 105 HCDR1 according to Rabat NAWMS
- SEQ ID NO: 106 HCDR2 according to Rabat
- SEQ ID NO: 107 HCDR3 according to Rabat
- SEQ ID NO: 108 HCDR1 according to Rabat
- SEQ ID NO: 109 HCDR2 according to Rabat
- SEQ ID NO: 110 HCDR3 according to Rabat
- SEQ ID NO: 111 HCDR1 according to Rabat
- SEQ ID NO: 113 HCDR3 according to Rabat
- SEQ ID NO: 114 HCDR1 according to Rabat
- SEQ ID NO: 116 HCDR3 according to Rabat
- SEQ ID NO: 117 HCDR1 according to Rabat
- SEQ ID NO: 118 HCDR2 according to Rabat
- SEQ ID NO: 119 HCDR3 according to Rabat
- SEQ ID NO: 120 HCDR1 according to Rabat
- SEQ ID NO: 122 HCDR3 according to Rabat
- SEQ ID NO: 123 HCDR1 according to Rabat
- SEQ ID NO: 124 HCDR2 according to Rabat
- SEQ ID NO: 125 HCDR3 according to Rabat GLAASGKNYFDP
- SEQ ID NO: 126 HCDR1 according to Rabat
- SEQ ID NO: 127 HCDR2 according to Rabat
- SEQ ID NO: 128 HCDR3 according to Rabat GIARS GKNFFDP
- SEQ ID NO: 129 HCDR1 according to Rabat
- SEQ ID NO: 130 HCDR2 according to Rabat
- SEQ ID NO: 132 HCDR1 according to Rabat
- SEQ ID NO: 133 HCDR2 according to Rabat AISASGDRTLNTDSVKG
- SEQ ID NO: 134 HCDR3 according to Rabat
- SEQ ID NO: 135 Light chain variable region EIVLTQSPATLSLSPGERATLSCRASQSVRSYLAWYQQKPGQAPRLLIYD ASNRATGIP ARE SGSGSGTDFTLTIS SLEPEDF AVYYCQQRSNWPPTFGQ GTKVEIK SEQ ID NO: 136: Heavy chain variable region
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Virology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (19)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| JP2022539245A JP7633259B2 (ja) | 2019-12-24 | 2020-12-22 | TGF-βRII結合タンパク質 |
| MX2022007919A MX2022007919A (es) | 2019-12-24 | 2020-12-22 | Proteinas de union al factor de crecimiento transformante receptor beta ii (tgf-beta-rii). |
| CN202080094188.4A CN115038497A (zh) | 2019-12-24 | 2020-12-22 | TGF-β-RII结合蛋白质 |
| CA3165605A CA3165605C (en) | 2019-12-24 | 2020-12-22 | Tgf-beta-rii binding proteins |
| EP20829233.4A EP4081306A1 (en) | 2019-12-24 | 2020-12-22 | Tgf-beta-rii binding proteins |
| BR112022012522A BR112022012522A2 (pt) | 2019-12-24 | 2020-12-22 | Proteínas de ligação de tgf-beta-rii |
| CN202211726462.2A CN116199780A (zh) | 2019-12-24 | 2020-12-22 | TGF-β-RII结合蛋白质 |
| AU2020412201A AU2020412201B2 (en) | 2019-12-24 | 2020-12-22 | TGF-beta-RII binding proteins |
| EP23189839.6A EP4269433A3 (en) | 2019-12-24 | 2020-12-22 | Tgf-beta-rii binding proteins |
| IL294181A IL294181A (en) | 2019-12-24 | 2020-12-22 | tgf-beta-rii binding proteins |
| KR1020237034290A KR20230145542A (ko) | 2019-12-24 | 2020-12-22 | Tgf-베타-rii 결합 단백질 |
| PH1/2022/551527A PH12022551527A1 (en) | 2019-12-24 | 2020-12-22 | Tgf-beta-rii binding proteins |
| US17/757,953 US12570747B2 (en) | 2019-12-24 | 2020-12-22 | TGF-beta-RII binding proteins |
| KR1020227023748A KR20220117267A (ko) | 2019-12-24 | 2020-12-22 | Tgf-베타-rii 결합 단백질 |
| CN202211726434.0A CN116375869A (zh) | 2019-12-24 | 2020-12-22 | TGF-β-RII结合蛋白质 |
| AU2023200779A AU2023200779B2 (en) | 2019-12-24 | 2023-02-13 | TGF-beta-RII binding proteins |
| JP2023060823A JP2023076596A (ja) | 2019-12-24 | 2023-04-04 | TGF-βRII結合タンパク質 |
| IL304317A IL304317A (en) | 2019-12-24 | 2023-07-09 | tgf–beta–rii binding proteins |
| JP2025018365A JP2025083342A (ja) | 2019-12-24 | 2025-02-06 | TGF-βRII結合タンパク質 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NL2024576 | 2019-12-24 | ||
| NL2024576 | 2019-12-24 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021133167A1 true WO2021133167A1 (en) | 2021-07-01 |
Family
ID=69700252
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/NL2020/050813 Ceased WO2021133167A1 (en) | 2019-12-24 | 2020-12-22 | Tgf-beta-rii binding proteins |
Country Status (13)
| Country | Link |
|---|---|
| US (1) | US12570747B2 (cg-RX-API-DMAC7.html) |
| EP (2) | EP4269433A3 (cg-RX-API-DMAC7.html) |
| JP (3) | JP7633259B2 (cg-RX-API-DMAC7.html) |
| KR (2) | KR20230145542A (cg-RX-API-DMAC7.html) |
| CN (3) | CN116199780A (cg-RX-API-DMAC7.html) |
| AR (2) | AR120914A1 (cg-RX-API-DMAC7.html) |
| AU (2) | AU2020412201B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112022012522A2 (cg-RX-API-DMAC7.html) |
| IL (2) | IL294181A (cg-RX-API-DMAC7.html) |
| MX (2) | MX2022007919A (cg-RX-API-DMAC7.html) |
| PH (1) | PH12022551527A1 (cg-RX-API-DMAC7.html) |
| TW (2) | TW202417513A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2021133167A1 (cg-RX-API-DMAC7.html) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023089083A1 (en) * | 2021-11-19 | 2023-05-25 | Merus N.V. | Multispecific binding moieties comprising pd-1 and tgf-brii binding domains |
| WO2024133330A1 (en) | 2022-12-20 | 2024-06-27 | Merus N.V. | FAP BINDING DOMAINS AND BISPECIFIC BINDING MOIETIES THAT BIND FAP AND TGF-βRII |
| US12570747B2 (en) | 2019-12-24 | 2026-03-10 | Merus N.V. | TGF-beta-RII binding proteins |
Citations (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1245676A1 (en) * | 1999-11-18 | 2002-10-02 | Japan Tobacco Inc. | Human monoclonal antibodies against tgf-beta ii receptor and medicinal use thereof |
| WO2004009618A2 (en) | 2002-07-18 | 2004-01-29 | Crucell Holland B.V. | Recombinant production of mixtures of antibodies |
| WO2009157771A2 (en) | 2008-06-27 | 2009-12-30 | Merus B.V. | Antibody producing non-human mammals |
| US20100119516A1 (en) | 2008-11-07 | 2010-05-13 | Yan Wu | Anti-tgf-beta receptor ii antibodies |
| WO2012093125A1 (en) | 2011-01-06 | 2012-07-12 | Glaxo Group Limited | Ligands that bind tgf-beta receptor ii |
| WO2014051433A1 (en) | 2012-09-27 | 2014-04-03 | Merus B.V. | BISPECIFIC IgG ANTIBODIES AS T CELL ENGAGERS |
| WO2018075304A1 (en) * | 2016-10-18 | 2018-04-26 | Eli Lilly And Company | TGFbeta RECEPTOR II ANTIBODIES |
| WO2019190327A2 (en) | 2018-03-30 | 2019-10-03 | Merus N.V. | Multivalent antibody |
Family Cites Families (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017015622A2 (en) * | 2015-07-22 | 2017-01-26 | Scholar Rock, Inc | Gdf11 binding proteins and uses thereof |
| CN116199780A (zh) * | 2019-12-24 | 2023-06-02 | 美勒斯公司 | TGF-β-RII结合蛋白质 |
-
2020
- 2020-12-22 CN CN202211726462.2A patent/CN116199780A/zh active Pending
- 2020-12-22 PH PH1/2022/551527A patent/PH12022551527A1/en unknown
- 2020-12-22 CN CN202080094188.4A patent/CN115038497A/zh active Pending
- 2020-12-22 EP EP23189839.6A patent/EP4269433A3/en active Pending
- 2020-12-22 AU AU2020412201A patent/AU2020412201B2/en active Active
- 2020-12-22 US US17/757,953 patent/US12570747B2/en active Active
- 2020-12-22 EP EP20829233.4A patent/EP4081306A1/en active Pending
- 2020-12-22 WO PCT/NL2020/050813 patent/WO2021133167A1/en not_active Ceased
- 2020-12-22 IL IL294181A patent/IL294181A/en unknown
- 2020-12-22 CN CN202211726434.0A patent/CN116375869A/zh active Pending
- 2020-12-22 MX MX2022007919A patent/MX2022007919A/es unknown
- 2020-12-22 BR BR112022012522A patent/BR112022012522A2/pt unknown
- 2020-12-22 KR KR1020237034290A patent/KR20230145542A/ko active Pending
- 2020-12-22 JP JP2022539245A patent/JP7633259B2/ja active Active
- 2020-12-22 KR KR1020227023748A patent/KR20220117267A/ko active Pending
- 2020-12-23 TW TW112150430A patent/TW202417513A/zh unknown
- 2020-12-23 AR ARP200103661A patent/AR120914A1/es unknown
- 2020-12-23 TW TW109145819A patent/TW202128747A/zh unknown
-
2022
- 2022-06-23 MX MX2024002182A patent/MX2024002182A/es unknown
-
2023
- 2023-02-13 AU AU2023200779A patent/AU2023200779B2/en active Active
- 2023-04-04 JP JP2023060823A patent/JP2023076596A/ja active Pending
- 2023-07-09 IL IL304317A patent/IL304317A/en unknown
- 2023-11-07 AR ARP230102989A patent/AR130991A2/es unknown
-
2025
- 2025-02-06 JP JP2025018365A patent/JP2025083342A/ja active Pending
Patent Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1245676A1 (en) * | 1999-11-18 | 2002-10-02 | Japan Tobacco Inc. | Human monoclonal antibodies against tgf-beta ii receptor and medicinal use thereof |
| WO2004009618A2 (en) | 2002-07-18 | 2004-01-29 | Crucell Holland B.V. | Recombinant production of mixtures of antibodies |
| WO2009157771A2 (en) | 2008-06-27 | 2009-12-30 | Merus B.V. | Antibody producing non-human mammals |
| US20100119516A1 (en) | 2008-11-07 | 2010-05-13 | Yan Wu | Anti-tgf-beta receptor ii antibodies |
| WO2010053814A1 (en) | 2008-11-07 | 2010-05-14 | Imclone Llc | Anti-tgf-beta receptor ii antibodies |
| WO2012093125A1 (en) | 2011-01-06 | 2012-07-12 | Glaxo Group Limited | Ligands that bind tgf-beta receptor ii |
| WO2014051433A1 (en) | 2012-09-27 | 2014-04-03 | Merus B.V. | BISPECIFIC IgG ANTIBODIES AS T CELL ENGAGERS |
| WO2018075304A1 (en) * | 2016-10-18 | 2018-04-26 | Eli Lilly And Company | TGFbeta RECEPTOR II ANTIBODIES |
| WO2019190327A2 (en) | 2018-03-30 | 2019-10-03 | Merus N.V. | Multivalent antibody |
Non-Patent Citations (25)
| Title |
|---|
| "GenBank", Database accession no. NM 001024847.2 |
| "Sequences of proteins of immunological interest", NIH PUBLICATION |
| DAVIESRIECHMANN, BIOTECHNOLOGY, vol. 13, 1995, pages 475 - 479 |
| GUIMOND A ET AL: "Mapping of putative binding sites on the ectodomain of the type II TGF-@b receptor by scanning-deletion mutagenesis and knowledge-based modeling", FEBS LETTERS, ELSEVIER, AMSTERDAM, NL, vol. 456, no. 1, 30 July 1999 (1999-07-30), pages 79 - 84, XP004260042, ISSN: 0014-5793, DOI: 10.1016/S0014-5793(99)00869-8 * |
| HAARD ET AL., J BIOL CHEM., vol. 274, no. 26, 1999, pages 18218 - 18230 |
| HOGREFE ET AL., GENE, vol. 128, 1993, pages 119 - 126 |
| HOOGENBOOM, NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 1105 - 1116 |
| HU ET AL., CANCER RESEARCH, vol. 56, 1996, pages 3055 - 3061 |
| HUO'DWYERWALL, JOURNAL OF BIOTECHNOLOGY, vol. 120, 2005, pages 38 - 45 |
| HUSTON ET AL., PROC NATL ACAD SCI USA, vol. 85, 1988, pages 5879 - 5883 |
| JESPERS, NAT. BIOTECHNOL, vol. 337, 2004, pages 893 - 903 |
| JUNTTILA ET AL., CANCER RESEARCH, vol. 70, no. 22, 2010, pages 4481 - 4489 |
| KIM ET AL., LANDES BIOSCIENCE, vol. 6, no. 1, 2014, pages 219 - 235 |
| KIM ET AL., PLOS ONE, vol. 9, no. 12, 2014, pages e113442 |
| KRUSKAL, J. B.: "An overview of sequence comparison", 1983, ADDISON WESLEY, article "Time warps, string edits and macromolecules: the theory and practice of sequence comparison", pages: 1 - 44 |
| LILLEY ET AL., JOURNAL OF IMMUNOLOGICAL METHODS, vol. 171, 1994, pages 211 - 226 |
| MAGELAMOYI: "Monoclonal Antibody Production Techniques and Applications", 1987, NATIONAL INSTITUTE OF HEALTH, pages: 79 - 97 |
| MARKSHOOGENBOOM, JOURNAL OF MOLECULAR BIOLOGY, vol. 222, 1991, pages 581 - 597 |
| PORTER, BIOCHEM, vol. 73, 1959, pages 119 - 126 |
| SMITH, SCIENCE, vol. 228, 1985, pages 1315 - 1317 |
| TANHA ET AL., J. BIOL. CHEM, vol. 276, 2001, pages 24774 - 24780 |
| THOMPSON, J.D.HIGGINS, D.G.GIBSON T.J., NUC. ACID RES., vol. 22, 1994, pages 4673 - 4680 |
| TO ET AL., J BIOL CHEM, vol. 280, 2005, pages 41395 - 41403 |
| VALEDKARIMI ET AL., HUMAN ANTIBODIES, vol. 26, 2018, pages 171 - 176 |
| WIELAND ET AL., VETERINARY IMMUNOLOGY AND IMMUNOPATHOLOGY, vol. 110, 2006, pages 129 - 140 |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12570747B2 (en) | 2019-12-24 | 2026-03-10 | Merus N.V. | TGF-beta-RII binding proteins |
| WO2023089083A1 (en) * | 2021-11-19 | 2023-05-25 | Merus N.V. | Multispecific binding moieties comprising pd-1 and tgf-brii binding domains |
| JP2024542879A (ja) * | 2021-11-19 | 2024-11-18 | メルス ナムローゼ フェンノートシャップ | Pd-1およびtgf-brii結合ドメインを含む多重特異性結合部位 |
| WO2024133330A1 (en) | 2022-12-20 | 2024-06-27 | Merus N.V. | FAP BINDING DOMAINS AND BISPECIFIC BINDING MOIETIES THAT BIND FAP AND TGF-βRII |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2023200779B2 (en) | 2026-02-19 |
| CN115038497A (zh) | 2022-09-09 |
| JP2023076596A (ja) | 2023-06-01 |
| BR112022012522A2 (pt) | 2022-09-06 |
| US20250270331A1 (en) | 2025-08-28 |
| IL304317A (en) | 2023-09-01 |
| JP2025083342A (ja) | 2025-05-30 |
| AU2020412201A1 (en) | 2022-07-14 |
| AR120914A1 (es) | 2022-03-30 |
| CN116375869A (zh) | 2023-07-04 |
| IL294181A (en) | 2022-08-01 |
| TW202128747A (zh) | 2021-08-01 |
| KR20230145542A (ko) | 2023-10-17 |
| CA3165605A1 (en) | 2021-07-01 |
| EP4081306A1 (en) | 2022-11-02 |
| PH12022551527A1 (en) | 2024-01-29 |
| AU2020412201B2 (en) | 2026-02-12 |
| AR130991A2 (es) | 2025-02-05 |
| US12570747B2 (en) | 2026-03-10 |
| JP7633259B2 (ja) | 2025-02-19 |
| KR20220117267A (ko) | 2022-08-23 |
| JP2023508202A (ja) | 2023-03-01 |
| AU2023200779A1 (en) | 2023-03-09 |
| TW202417513A (zh) | 2024-05-01 |
| EP4269433A3 (en) | 2024-05-22 |
| MX2022007919A (es) | 2022-07-27 |
| CN116199780A (zh) | 2023-06-02 |
| EP4269433A2 (en) | 2023-11-01 |
| MX2024002182A (es) | 2024-05-03 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN112969716B (zh) | 抗pd-1抗体、其抗原结合片段及医药用途 | |
| JP7554309B2 (ja) | 抗cd147抗体 | |
| AU2023200779B2 (en) | TGF-beta-RII binding proteins | |
| CN110606891A (zh) | 一种针对人cldn18.2的新型抗体分子, 抗原结合片段及其医药用途 | |
| JP2024530451A (ja) | 抗pvrig/抗tigit二重特異性抗体及び応用 | |
| CN110790839B (zh) | 抗pd-1抗体、其抗原结合片段及医药用途 | |
| CN118076638A (zh) | 新型抗sirpa抗体 | |
| AU2019395887B2 (en) | Anti-periostin antibodies and uses thereof | |
| WO2021013061A1 (zh) | 一种人源化抗vegfr2抗体及其应用 | |
| WO2021013080A1 (zh) | 人源化抗vegf单克隆抗体 | |
| CN113637075A (zh) | 双特异性抗原结合分子及其医药用途 | |
| CA3165605C (en) | Tgf-beta-rii binding proteins | |
| HK40094429A (en) | Tgf-beta-rii binding proteins | |
| EA051539B1 (ru) | Белки, связывающие tgf-бета-rii | |
| BR122023027661A2 (pt) | Proteínas de ligação de tgf-beta-rii | |
| RU2809746C2 (ru) | Гуманизированное моноклональное антитело против vegf | |
| TW202436350A (zh) | 抗lilrb1及/或抗lilrb2抗體及其等用途 | |
| HK40066221B (zh) | 人源化抗vegf fab抗体片段及其用途 | |
| HK40126767A (zh) | 抗cd3抗体及其用途 | |
| HK40066221A (zh) | 人源化抗vegf fab抗体片段及其用途 | |
| HK40093421A (zh) | 新颖的抗gremlin1抗体 | |
| HK40066231A (zh) | 人源化抗vegf单克隆抗体 | |
| HK40066231B (zh) | 人源化抗vegf单克隆抗体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20829233 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3165605 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022539245 Country of ref document: JP Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022012522 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20227023748 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020412201 Country of ref document: AU Date of ref document: 20201222 Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020829233 Country of ref document: EP Effective date: 20220725 |
|
| ENP | Entry into the national phase |
Ref document number: 112022012522 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220622 |
|
| WWP | Wipo information: published in national office |
Ref document number: 17757953 Country of ref document: US |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 828393 Country of ref document: NZ Ref document number: 828413 Country of ref document: NZ |