WO2021113824A1 - Stabilization of retromer for the treatment of alzheimer's disease and other neurodegenerative disorders - Google Patents
Stabilization of retromer for the treatment of alzheimer's disease and other neurodegenerative disorders Download PDFInfo
- Publication number
- WO2021113824A1 WO2021113824A1 PCT/US2020/063627 US2020063627W WO2021113824A1 WO 2021113824 A1 WO2021113824 A1 WO 2021113824A1 US 2020063627 W US2020063627 W US 2020063627W WO 2021113824 A1 WO2021113824 A1 WO 2021113824A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- retromer
- transgene
- core protein
- vps26b
- vps26a
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/005—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/86—Viral vectors
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
- C12N2750/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/008—Vector systems having a special element relevant for transcription cell type or tissue specific enhancer/promoter combination
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/40—Vector systems having a special element relevant for transcription being an insulator
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2830/00—Vector systems having a special element relevant for transcription
- C12N2830/50—Vector systems having a special element relevant for transcription regulating RNA stability, not being an intron, e.g. poly A signal
Definitions
- the present disclosure relates to methods and compositions for elevating and stabilizing retromer for treating and/or preventing Alzheimer’ s disease and other neurodegenerative disorders.
- AD Alzheimer’ s disease
- AD therapeutics however aimed at amyloid, tau, cholinesterase inhibitors, anti-inflammatory compounds, and alternative therapies such as memantine and nutritional supplements have failed, and the disease remains a major source of mortality, morbidity and financial burden. Failure of AD clinical trials have forced researchers to investigate further the causality of the disease. Numerous preclinical studies have examined novel AD associated genes, intracellular protein homeostasis pathways, interaction of neurons with their microenvironment and with glial cells. Several investigations are still ongoing.
- AD Alzheimer’s disease
- PD Parkinson’s disease
- TSE transmissible spongiform encephalopathies
- NCL Neuronal Ceroid Lipofuscinosis
- Retromer is a protein complex associated with endosomal organelles and controls trafficking of certain cellular cargo molecules within tubular vesicular carriers to the trans Golgi network. Defects in this trafficking have been linked to various neurodegenerative diseases (Small and Petsko 2015; Anderson et al. 2014). Neurodegeneration is the umbrella term for the progressive loss of structure or function of neurons, including death of neurons. Many neurodegenerative diseases including amyotrophic lateral sclerosis (ALS), Parkinson's Disease (PD), Alzheimer's Disease (AD), and Huntington's occur as a result of neurodegenerative processes.
- ALS amyotrophic lateral sclerosis
- PD Parkinson's Disease
- AD Alzheimer's Disease
- Huntington's occur as a result of neurodegenerative processes.
- compositions and methods that can be used to treat a subject (e.g., a mammalian subject, such as a human subject) that has, or is at risk of developing, a neurodegenerative disease, including but not limited to Alzheimer’s disease (AD), Parkin on’s disease (PD), neuronal ceroid lipofuscinosis (NCL), transmissible spongiform encephalopathies (TSEs or prion disease), Down’s syndrome, hereditary spastic paraplegia (HSP), and multiple system atrophy (MSA), as well as tauopathies such as progressive supranuclear palsy (PSP), frontotemporal lobar dementia linked to chromosome 17q21-22 and its subtypes (FTLD- 17/FTLD-Tau), Lewy Body Disease (LBD), amyotrophic lateral sclerosis (ALS), frontal-temporal degeneration (FTD), ALS-FTD, and chronic traumatic encephalopathy (CTE).
- AD Alzheimer’s disease
- a subject e.g., a mammalian subject, such as a human subject
- a composition containing a transgene encoding one or more of the retromer proteins described herein may be administered a composition containing a transgene encoding one or more of the retromer proteins described herein.
- the composition may comprise a vector, for example, a viral vector, such as an adeno-associated virus (AAV) vector.
- the subject is administered a second composition containing a transgene encoding one or more of the retromer proteins described herein.
- the second composition may comprise a vector, for example, a viral vector, such as an AAV vector.
- the subject is administered a third composition containing a transgene encoding one or more of the retromer proteins described herein.
- the third composition may comprise a vector, for example, a viral vector, such as an AAV vector.
- the disclosure features a composition containing a transgene encoding retromer core protein VPS35 and/or VPS26a and/or VPS26b.
- the transgene encodes VPS35.
- the transgene encodes VPS26a and/or VPS26b.
- the transgene encodes VPS35 and either VPS26a or VPS26b.
- the transgene encodes VPS35 and VPS26a.
- the transgene encodes VPS35 and VPS26b.
- the transgene encodes VPS26a and VPS26b.
- the composition comprises two transgenes with one of the transgenes encoding VPS 35 and the other encoding VPS26a or VPS26b. In other aspects, the composition comprises two transgenes with one of the transgenes encoding VPS26a and the other encoding VPS26b. In other aspects the composition comprises three transgenes with one of the transgenes encoding VPS35, another encoding VPS26a, and another encoding VPS26b.
- the transgene encodes retromer core protein VPS35.
- the retromer core protein VPS35 protein is human.
- the retromer core protein VPS35 encoded by the transgene may have an amino acid sequence that is at least 85% identical to the amino acid sequence of VPS35 (e.g., an amino acid sequence that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of VPS 35).
- the retromer core protein VPS 35 encoded by the transgene has an amino acid sequence that is at least 90% identical to the amino acid sequence of VPS35 (e.g., an amino acid sequence that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of VPS35). In some embodiments, the retromer core protein VPS 35 encoded by the transgene has an amino acid sequence that is at least 95% identical to the amino acid sequence of VPS35 (e.g., an amino acid sequence that is 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of VPS35).
- the retromer core protein VPS35 encoded by the transgene has an amino acid sequence that differs from VPS35 by way of one or more amino acid substitutions, insertions, and/or deletions, such as by from 1 to 10, 1 to 15, 1 to 20, 1 to 25, or more, amino acid substitutions, insertions, and/or deletions (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more, conservative amino acid substitutions).
- the retromer core protein VPS35 encoded by the transgene has an amino acid sequence that differs from VPS35 by way of one or more conservative amino acid substitutions, such as by from 1 to 10, 1 to 15, 1 to 20, 1 to 25, or more, conservative amino acid substitutions (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more, conservative amino acid substitutions).
- the transgene encoding retromer core protein VPS35 comprises human VPS35 (Gene ID 55737). In some embodiments, the transgene encoding retromer core protein VPS 35 has a nucleic acid sequence that is at least 70% identical to the nucleic acid sequence encoding VPS35 (e.g., a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence encoding VPS35).
- the transgene encoding retromer core protein VPS35 has a nucleic acid sequence that is at least 85% identical to the nucleic acid sequence encoding VPS35 (e.g., a nucleic acid sequence that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence encoding VPS35).
- the transgene encoding retromer core protein VPS35 has a nucleic acid sequence that is at least 90% identical to the nucleic acid sequence encoding VPS35 (e.g., a nucleic acid sequence that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence encoding VPS35).
- the transgene encoding retromer core protein VPS 35 has a nucleic acid sequence that is at least 95% identical to the nucleic acid sequence encoding VPS35 (e.g., a nucleic acid sequence that is 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence encoding VPS35). In some embodiments, the transgene encoding retromer core protein VPS 35 is codon optimized.
- the transgene encodes retromer core protein VPS26a.
- the retromer core protein VPS26a protein is human.
- the retromer core protein VPS26a encoded by the transgene may have an amino acid sequence that is at least 85% identical to the amino acid sequence of VPS26a (e.g., an amino acid sequence that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of VPS26a).
- the retromer core protein VPS26a encoded by the transgene has an amino acid sequence that is at least 90% identical to the amino acid sequence of VPS26a (e.g., an amino acid sequence that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of VPS26a).
- the retromer core protein VPS26a encoded by the transgene has an amino acid sequence that is at least 95% identical to the amino acid sequence of VPS26a (e.g., an amino acid sequence that is 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of VPS26a).
- the retromer core protein VPS26a encoded by the transgene has an amino acid sequence that differs from VPS26a by way of one or more amino acid substitutions, insertions, and/or deletions, such as by from 1 to 10, 1 to 15, 1 to 20, 1 to 25, or more, amino acid substitutions, insertions, and/or deletions (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more, conservative amino acid substitutions).
- the retromer core protein VPS26a has an amino acid sequence that differs from VPS26a by way of one or more conservative amino acid substitutions, such as by from 1 to 10, 1 to 15, 1 to 20, 1 to 25, or more, conservative amino acid substitutions (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more, conservative amino acid substitutions).
- conservative amino acid substitutions such as by from 1 to 10, 1 to 15, 1 to 20, 1 to 25, or more, conservative amino acid substitutions (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more, conservative amino acid substitutions).
- the transgene encoding retromer core protein VPS26a comprises human VPS26a (Gene ID 9559).
- the transgene encoding retromer core protein VPS26a has a nucleic acid sequence that is at least 70% identical to the nucleic acid sequence encoding VPS26a (e.g., a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence encoding VPS26a).
- the transgene encoding retromer core protein VPS26a has a nucleic acid sequence that is at least 85% identical to the nucleic acid sequence encoding VPS26a (e.g., a nucleic acid sequence that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence of encoding VPS26a).
- the transgene encoding retromer core protein VPS26a has a nucleic acid sequence that is at least 90% identical to the nucleic acid sequence encoding VPS26a (e.g., a nucleic acid sequence that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence of encoding VPS26a).
- the transgene encoding retromer core protein VPS26a has a nucleic acid sequence that is at least 95% identical to the nucleic acid sequence encoding VPS26a (e.g., a nucleic acid sequence that is 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence of encoding VPS26a).
- the transgene encoding retromer core protein VPS26a is codon optimized.
- the transgene encodes retromer core protein VPS26b.
- the retromer core protein VPS26b protein is human.
- the retromer core protein VPS26b encoded by the transgene may have an amino acid sequence that is at least 85% identical to the amino acid sequence of VPS26b (e.g., an amino acid sequence that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of VPS26b).
- the retromer core protein VPS26b encoded by the transgene has an amino acid sequence that is at least 90% identical to the amino acid sequence of VPS26b (e.g., an amino acid sequence that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of VPS26b).
- the retromer core protein VPS26b encoded by the transgene has an amino acid sequence that is at least 95% identical to the amino acid sequence of VPS26b (e.g., an amino acid sequence that is 95%, 96%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of VPS26b).
- the retromer core protein VPS26b encoded by the transgene has an amino acid sequence that differs from VPS26b by way of one or more amino acid substitutions, insertions, and/or deletions, such as by from 1 to 10, 1 to 15, 1 to 20, 1 to 25, or more, amino acid substitutions, insertions, and/or deletions (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more, conservative amino acid substitutions).
- the retromer core protein VPS26b encoded by the transgene has an amino acid sequence that differs from VPS26b by way of one or more conservative amino acid substitutions, such as by from 1 to 10, 1 to 15, 1 to 20, 1 to 25, or more, conservative amino acid substitutions (e.g., by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more, conservative amino acid substitutions).
- the transgene encoding retromer core protein VPS26b comprises human VPS26b (Gene ID 112936).
- the transgene encoding the retromer core protein VPS26b has a nucleic acid sequence that is at least 70% identical to the nucleic acid sequence encoding VPS26b (e.g., a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence encoding VPS26b).
- the transgene encoding the retromer core protein VPS26b has a nucleic acid sequence that is at least 85% identical to the nucleic acid sequence encoding VPS26b (e.g., a nucleic acid sequence that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence encoding VPS26b).
- the transgene encoding the retromer core protein VPS26b has a nucleic acid sequence that is at least 90% identical to the nucleic acid sequence encoding VPS26b (e.g ., a nucleic acid sequence that is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence of encoding VPS26b).
- the transgene encoding the retromer core protein VPS26b has a nucleic acid sequence that is at least 95% identical to the nucleic acid sequence encoding VPS26b (e.g., a nucleic acid sequence that is 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence encoding VPS26b).
- the transgene encoding the retromer VPS26b core protein is codon optimized.
- the composition comprises a vector, such as a viral vector.
- the viral vector may be, for example, an AAV vector, adenovirus vector, lentivirus vector, retrovirus vector, poxvirus vector, baculovirus vector, herpes simplex virus vector, vaccinia virus vector, or a synthetic virus vector (e.g., a chimeric virus, mosaic virus, or pseudotyped virus, and/or a virus that contains a foreign protein, synthetic polymer, nanoparticle, or small molecule).
- the viral vector is an AAV vector, such as an AAV1 (i.e., an AAV containing AAV1 inverted terminal repeats (ITRs) and AAV1 capsid proteins), AAV2 (i.e., an AAV containing AAV2 ITRs and AAV2 capsid proteins), AAV3 (i.e., an AAV containing AAV3 ITRs and AAV3 capsid proteins), AAV4 (i.e., an AAV containing AAV4 ITRs and AAV4 capsid proteins), AAV5 (i.e., an AAV containing AAV5 ITRs and AAV5 capsid proteins), AAV6 (i.e., an AAV containing AAV6 ITRs and AAV6 capsid proteins), AAV7 (i.e., an AAV containing AAV7 ITRs and AAV7 capsid proteins), AAV8 (i.e., an AAV containing AAV8 ITRs and AAV
- AAV1 i.e
- the viral vector is a pseudotyped AAV vector, containing ITRs from one AAV serotype and capsid proteins from a different AAV serotype.
- the pseudotyped AAV is AAV2/9 (i.e., an AAV containing AAV2 ITRs and AAV9 capsid proteins).
- the pseudotyped AAV is AAV2/10 (i.e., an AAV containing AAV2 ITRs and AAV10 capsid proteins).
- the AAV vector contains a recombinant capsid protein, such as a capsid protein containing a chimera of one or more of capsid proteins from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, AAVrh74, AAVrh.8, or AAVrh.10.
- the capsid is a variant AAV capsid such as the AAV2 variant rAAV2-retro (SEQ ID NO:44 from WO 2017/218842, incorporated herein by reference).
- the viral vector is AAV10.
- the composition may comprise AAV10 comprising a nucleic acid sequence comprising a transgene encoding retromer core protein VPS35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b.
- the viral vector is AAV9.
- the composition may comprise AAV9 comprising a nucleic acid sequence comprising a transgene encoding retromer core protein VPS35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b.
- the viral vector is AAV2/10.
- the composition may comprise AAV2/10 comprising a nucleic acid sequence comprising a transgene encoding retromer core protein VPS35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b.
- the viral vector is AAV2/9.
- the composition may comprise AAV2/9 comprising a nucleic acid sequence comprising a transgene encoding retromer core protein VPS35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b.
- the viral vector is an AAV vector and the transgene encodes VPS35 retromer core protein.
- the composition may comprise a recombinant AAV (rAAV), such as AAV 10, comprising a nucleic acid sequence comprising a transgene encoding a functional VPS35 retromer core protein.
- the composition may comprise a recombinant AAV (rAAV), such as AAV9, comprising a nucleic acid sequence comprising a transgene encoding a functional VPS 35 retromer core protein.
- the composition may comprise a recombinant AAV (rAAV), such as AAV2/9 or AAV2/10, comprising a nucleic acid sequence comprising a transgene encoding a functional VPS35 retromer core protein.
- the viral vector is an AAV vector and the transgene encodes retromer core protein VPS26a.
- the composition may comprise a recombinant AAV (rAAV), such as AAV 10, comprising a nucleic acid sequence comprising a transgene encoding a functional VPS26a retromer core protein.
- the composition may comprise a recombinant AAV (rAAV), such as AAV9, comprising a nucleic acid sequence comprising a transgene encoding a functional retromer core protein VPS26a.
- the composition may comprise a recombinant AAV (rAAV), such as AAV2/9 or AAV2/10, comprising a nucleic acid sequence comprising a transgene encoding a functional retromer core protein VPS26a.
- rAAV recombinant AAV
- the viral vector is an AAV vector and the transgene encodes retromer core protein VPS26b.
- the composition may comprise a recombinant AAV (rAAV), such as AAV 10, comprising a nucleic acid sequence comprising a transgene encoding a functional VPS26b retromer core protein.
- the composition may comprise a recombinant AAV (rAAV), such as AAV9, comprising a nucleic acid sequence comprising a transgene encoding a functional retromer core protein VPS26b.
- the composition may comprise a recombinant AAV (rAAV), such as AAV2/9 or AAV2/10, comprising a nucleic acid sequence comprising a transgene encoding a functional retromer core protein VPS26b.
- rAAV recombinant AAV
- the composition comprises a liposome, vesicle, synthetic vesicle, exosome, synthetic exosome, dendrimer, or nanoparticle.
- the transgene is operably linked to a promoter that induces expression of the transgene in a neuron.
- the promoter may be, for example, a chicken beta actin promoter, cytomegalovirus (CMV) promoter, myosin light chain-2 promoter, alpha actin promoter, troponin 1 promoter, Na+/Ca2+ exchanger promoter, dystrophin promoter, creatine kinase promoter, alpha7 integrin promoter, brain natriuretic peptide promoter, alpha B-crystallin/small heat shock protein promoter, alpha myosin heavy chain promoter, or atrial natriuretic factor promoter.
- CMV cytomegalovirus
- the transgene is operably linked to an enhancer that induces expression of the transgene in a neuron.
- enhancers that may be used in conjunction with the compositions and methods of the disclosure are a CMV enhancer, a myocyte enhancer factor 2 (MEF2) enhancer, and a MyoD enhancer.
- the disclosure features a method for treating a degenerative disease or disorder in a subject in need thereof by administering one or more compositions comprising one or more viral vectors according to the proceeding embodiments.
- the composition is administered to the subject as soon as, or immediately after, the subject is diagnosed as having a degenerative disease or disorder.
- the degenerative disease or disorder is a neurodegenerative disease, such as Alzheimer’s disease (AD), Parkinson’s disease, neuronal ceroid lipofuscinosis (NCL), transmissible spongiform encephalopathies (TSEs or prion disease), multiple system atrophy (MSA), Down’s syndrome, and hereditary spastic paraplegia (HSP), as well as tauopathies such as progressive supranuclear palsy (PSP), frontotemporal lobar dementia linked to chromosome 17q21-22 and its subtypes (FTLD-17/FTLD-Tau), Lewy Body Disease (LBD), amyotrophic lateral sclerosis (ALS), frontal-temporal degeneration (FTD), ALS-FTD, and chronic traumatic encephalopathy (CTE).
- AD Alzheimer’s disease
- NCL neuronal ceroid lipofuscinosis
- TSEs or prion disease multiple system atrophy
- MSA multiple system atrophy
- HSP hereditary spastic para
- the disclosure features a method for treating a degenerative disease or disorder in a subject in need thereof by administering one or more compositions comprising a transgene encoding retromer core protein VPS35 and/or VPS26a and/or VPS26b, as described in the foregoing paragraphs.
- the composition comprises a transgene encoding VPS35 and a transgene encoding VPS26a.
- the composition comprises a transgene encoding VPS35 and a transgene encoding VPS26b.
- the composition comprises a transgene encoding VPS26a and a transgene encoding VPS26b.
- the composition comprises a transgene encoding VPS35, a transgene encoding VPS26a, and a transgene encoding VPS26b.
- the composition is administered to the subject as soon as, or immediately after, the subject is diagnosed as having a degenerative disease or disorder.
- the degenerative disease or disorder is a neurodegenerative disease, such as Alzheimer’s disease (AD), Parkinson’s disease, neuronal ceroid lipofuscinosis (NCL), transmissible spongiform encephalopathies (TSEs or prion disease), Down’ s syndrome, hereditary spastic paraplegia (HSP), and multiple system atrophy (MSA), as well as tauopathies such as progressive supranuclear palsy (PSP), frontotemporal lobar dementia linked to chromosome 17q21-22 and its subtypes (FTLD-17/FTLD-Tau), Lewy Body Disease (LBD), amyotrophic lateral sclerosis (ALS), frontal-temporal degeneration (FTD), ALS-FTD, and chronic traumatic encephalopathy (CTE).
- AD Alzheimer’s disease
- Parkinson’s disease neuronal ceroid lipofuscinosis
- TSEs or prion disease transmissible spongiform encephalopathies
- HSP hereditary
- the method includes administering to the subject a therapeutically effective amount of a first composition containing a transgene encoding retromer core protein VPS35 and/or VPS26a and/or VPS26b, as described in the foregoing paragraphs. In some embodiments, the method further includes administering to the subject a therapeutically effective amount of a second composition containing a transgene encoding retromer core protein VPS35 and/or VPS26a and/or VPS26b, as described in the foregoing paragraphs. In embodiments, the method comprises administering a first composition comprising a transgene encoding VPS35 and administering a second composition comprising a transgene encoding VPS26a or VPS26b.
- the method comprises administering a first composition comprising a transgene encoding VPS26a or VPS26b and administering a second composition comprising a transgene encoding VPS35. In embodiments, the method comprises administering a first composition comprising a transgene encoding VPS26a and administering a second compositions composition comprising a transgene encoding VPS26b. In embodiments, the method comprises administering a first composition comprising a transgene encoding VPS26b and administering a second compositions composition comprising a transgene encoding VPS26a.
- the method further includes administering to the subject a therapeutically effective amount of a third composition containing a transgene encoding retromer core protein VPS35 and/or VPS26a and/or VPS26b, as described in the foregoing paragraphs.
- the first, second and third compositions comprise a transgene encoding VPS35, VPS26a, or VPS26b, respectively.
- the first and second compositions are administered to the subject at the same time. In some embodiments, the first, second and third compositions are administered to the subject at the same time.
- the second composition is administered to the subject after administration of the first composition to the subject.
- the second composition may be administered to the subject, for example, within one or more days or weeks of administration of the first composition to the subject.
- the second composition is administered to the subject at least one month after administration of the first composition to the subject.
- administration of the first composition continues while the second composition is administered to the subject.
- the third composition is administered to the subject after administration of the first and second composition to the subject.
- the third composition may be administered to the subject, for example, within one or more days or weeks of administration of the first and second composition to the subject.
- the third composition is administered to the subject at least one month after administration of the first and second composition to the subject.
- administration of the first and second composition continues while the third composition is administered to the subject.
- the first composition is administered to the subject by way of intravenous, intrathecal, intradermal, transdermal, parenteral, intramuscular, intranasal, subcutaneous, percutaneous, intratracheal, intraperitoneal, intraarterial, intravascular, inhalation, perfusion, lavage, and/or oral administration.
- the second composition is administered to the subject by way of intravenous, intrathecal, intradermal, transdermal, parenteral, intramuscular, intranasal, subcutaneous, percutaneous, intratracheal, intraperitoneal, intraarterial, intravascular, inhalation, perfusion, lavage, and/or oral administration.
- the third composition is administered to the subject by way of intravenous, intrathecal, intradermal, transdermal, parenteral, intramuscular, intranasal, subcutaneous, percutaneous, intratracheal, intraperitoneal, intraarterial, intravascular, inhalation, perfusion, lavage, and/or oral administration.
- the disclosure features a method of treating, preventing, and/or curing a neurodegenerative disease or disorder in a subject in need thereof.
- the method includes administering to the subject a therapeutically effective amount of a composition or compositions containing a transgene encoding retromer core protein VPS 35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b.
- the disclosure features a method of alleviating one or more symptoms associated with a neurodegenerative disease or disorder in a subject in need thereof.
- the method includes administering to the subject a therapeutically effective amount of a composition or compositions containing a transgene encoding retromer core protein VPS35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b.
- the disclosure also provides one or more compositions as described herein for use in a method as described herein.
- the disclosure also provides the use of one or more compositions as described herein for the manufacture of one or more medicaments for a method as described herein.
- the transgene may encode retromer core protein VPS35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b.
- the disclosure therefore also provides a composition containing one or more transgenes encoding retromer core protein VPS 35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b for use in treating, preventing, and/or curing a neurodegenerative disease or disorder. Furthermore provided is one or more compositions containing one or more transgenes encoding retro mer core protein VPS 35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b for use in alleviating one or more symptoms associated with a neurodegenerative disease or disorder.
- the disclosure also provides the use of one or more compositions containing one or more transgenes encoding retromer core protein VPS 35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b for the manufacture of one or more medicaments for treating, preventing, and/or curing a neurodegenerative disease or disorder. Furthermore provided is the use of one or more compositions containing one or more transgenes encoding retromer core protein VPS35 and/or retromer core protein VPS26a and/or a retromer core protein VPS26b for the manufacture of one or more medicaments for alleviating one or more symptoms associated with a neurodegenerative disease or disorder.
- the disease or disorder is a neurodegenerative disease or disorder.
- the disease or disorder is Alzheimer’s disease (AD).
- the disease or disorder is Parkinson’s disease.
- the disease or disorder is neuronal ceroid lipofuscinosis (NCL).
- the disease or disorder is transmissible spongiform encephalopathies (TSEs or prion disease).
- the disease or disorder is multiple system atrophy (MSA).
- the disease or disorder is progressive supranuclear palsy (PSP).
- the disease or disorder is frontotemporal lobar dementia linked to chromosome 17q21-22 and its subtypes (FTLD-17/FTLD-Tau).
- the disease or disorder is chronic traumatic encephalopathy (CTE).
- the disease or disorder is Down’s syndrome.
- the disease or disorder is HSP.
- the disease or disorder is LBD.
- the disease or disorder is AES.
- the disease or disorder is FTD or ALS-FTD.
- the disclosure features a kit containing the composition of the preceding aspect.
- the kit may further contain a package insert, such as a package insert instructing a user of the kit to administer the composition to a subject in accordance with the method of any of the above aspects or embodiments of the disclosure.
- Figure 1 shows a backbone rendering (PyMOL, Schroedinger, Inc.) of the three- dimensional structure of retromer’s cargo recognition core highlighting the interaction of VPS 35 (orange) with VPS29 (red) and VPS26a (green).
- Vps26b binds to Vps35 in a virtually identical fashion (Collins et al. 2008; Shi el al. 2006).
- Figure 2 shows VPS35 expression alone is insufficient to elevate retromer’s trimer and function.
- Figure 2A are representative immunoblots showing retromer and Sorll expression levels following AAV9-VPS35-HA.
- AAV9-GFP and AAV9-EV empty vector were used as controls.
- Figure 3 shows the maps of the plasmids used in the Examples.
- Figure 3 A shows the empty chassis control plasmid map.
- Figure 3B shows the GFP control plasmid map.
- Figure 3C shows the VPS35 plasmid map.
- Figure 3D shows the VPS26a plasmid map.
- Figure 3E shows VPS26b plasmid map.
- Figure 4 shows the optimization of the combined VPS35 and VPS26 expression in neuroblastoma cells.
- Figure 4A are representative immunoblots showing retromer expression levels following transfection with plasmids containing VPS35, VPS26a, and VPS26b alone or dual transfection of VPS35 along with VPS26a or VPS26b.
- GFP or empty backbone plasmids were used as controls.
- a control plasmid (GFP or empty backbone) was included whenever only one component of retromer was transfected.
- VPS29 shows two distinct bands, which represent two different isoforms of this protein in these N2a cells.
- Figures 4B through 4E are graphs of the mean levels of retromer core protein (VPS35, VPS26a, VPS26b, VPS29) in neuroblastoma cells, normalized to actin, transfected with viral vectors containing empty vector (EV) and GFP as a control (EV + GFP), VPS 35 alone, VPS26a alone, VPS26b alone, VPS 35 vector + VPS26a vector, and VPS35 vector + VPS26b vector.
- Figure 4B shows VPS35.
- Figure 4C shows VPS26a.
- Figure 4D shows VPS26b.
- Figure 4E shows VPS29.
- Figure 5 shows that combined VPS35 and VPS26 expression synergizes retromer function in neurons.
- Figure 5A are representative immunoblots showing retromer expression levels following transduction with AAV9 vectors containing VPS35, VPS26a, and VPS26b.
- AAV9-GFP and AAV9-EV AAV9 containing empty backbone plasmid were used as controls.
- the experimental AAV9 vectors were expressed in neurons in all possible combinations: Single protein expression (VPS35 alone, VPS26a alone, VPS26b alone); double protein expression (VPS35+VPS26a, VPS35+VPS26b, VPS26b+VPS26a); and triple protein expression (VPS35+VPS26a+VPS26b).
- FIGS 5B through 5E are bar graphs of the mean levels of retromer core protein (VPS35, VPS26a, VPS26b) in neuroblastoma cells, nor alized to actin, transfected with one or more of five viral vectors (AAV9) containing empty vector (EV), GFP, VPS35, VPS26a, or VPS26b.
- retromer core protein VPS35, VPS26a, VPS26b
- AAV9 empty vector
- Results are shown for empty vector (EV) + GFP as a control, VPS35 vector alone, VPS26a vector alone, VPS26b vector alone, VPS35 vector + VPS26a vector, VPS35 vector + VPS26b vector, VPS35 vector + VPS26a vector + VPS26b vector, and VPS26a vector + VPS26b vector.
- Figure 5B shows VPS35.
- Figure 5C shows VPS29.
- Figure 5D shows VPS26a.
- Figure 5E shows VPS26b.
- ***P ⁇ 0.001, **P ⁇ 0.01, *P ⁇ 0.05, ns not significant.
- Figure 6 shows that the combined VPS35 and VPS26 expression synergizes retromer function in neurons.
- Figure 6A are representative immunoblots showing Sorll expression levels following transduction with AAV9 vectors containing VPS35, VPS26a, and VPS26b.
- AAV9-GFP and AAV9-EV AAV9 containing empty backbone plasmid were used as controls.
- the experimental AAV9 vectors were expressed in neurons in all possible combinations: Single protein expression (VPS35 alone, VPS26a alone, VPS26b alone); double protein expression (VPS35+VPS26a, VPS35+VPS26b, VPS26b+VPS26a); and triple protein expression (VPS35+VPS26a+VPS26b).
- FIG. 6B is a bar graph of the levels of Sorll in neurons, normalized to actin, transfected with one or more of five viral vectors (AAV9) containing empty vector (EV), GFP, VPS35, VPS26a, or VPS26b.
- AAV9 empty vector
- Results are shown for empty vector (EV) + GFP as a control, VPS35 vector alone, VPS26a vector alone, VPS26b vector alone, VPS35 vector + VPS26a vector, VPS35 vector + VPS26b vector, VPS35 vector + VPS26a vector + VPS26b vector, and VPS26a vector + VPS26b vector.
- Figure 6C shows VPS26a.
- Figure 6D shows VPS26b.
- “about” can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value.
- the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.
- subject refers to animals in need of therapeutic or prophylactic treatment.
- Subjects include mammals, such as canines, felines, rodents, bovine, equines, porcines, ovines, and primates.
- the compositions and methods can be used in veterinary medicine, e.g., to treat companion animals, farm animals, laboratory animals in zoological parks, and animals in the wild.
- the compositions and methods disclosed herein are particularly desirable for human medical applications.
- the term “patient” as used in this application means a human subject.
- the “patient” is known or suspected of having a neurodegenerative disease or disorder including but not limited to Alzheimer’s disease (AD), Parkinson’s disease, neuronal ceroid lipofuscinosis (NCL), transmissible spongiform encephalopathies (TSEs or prion disease), multiple system atrophy, Down’s syndrome, and hereditary spastic paraplegia (HSP), (MSA), as well as tauopathies such as progressive supranuclear palsy (PSP), frontotemporal lobar dementia linked to chromosome 17q21-22 and its subtypes (FTLD-17/FTLD-Tau), Lewy Body Disease (LBD), amyotrophic lateral sclerosis (ALS), frontal-temporal degeneration (FTD), ALS-FTD, and chronic traumatic encephalopathy (CTE).
- the “patient” is known or suspected of having a disorder or disease that is associated with endosom
- terapéuticaally effective amount is used herein to mean an amount sufficient to cause an improvement in a clinically significant condition in the subject, or delays or minimizes or mitigates one or more symptoms associated with the disease or disorder, or results in a desired beneficial change of physiology in the subject.
- treat refers to a means to slow down, relieve, ameliorate or alleviate at least one of the symptoms of the disease or disorder, or reverse the disease or disorder after its onset.
- prevent refers to acting prior to overt disease or disorder onset, to prevent the disease or disorder from developing or minimize the extent of the disease or disorder, or slow its course of development.
- cur and the like means to heal, to make well, or to restore to good health or to allow a time without recurrence of disease so that the risk of recurrence is small.
- the term “in need thereof’ would be a subject known or suspected of having or being at risk of having a neurodegenerative disease or disorder including but not limited to Alzheimer’ s disease (AD), Parkinson’s disease, neuronal ceroid lipofuscinosis (NCL), transmissible spongiform encephalopathies (TSEs or prion disease), multiple system atrophy, Down’s syndrome, and hereditary spastic paraplegia (HSP), (MSA), as well as tauopathies such as progressive supranuclear palsy (PSP), frontotemporal lobar dementia linked to chromosome 17q21-22 and its subtypes (FTLD-17/FTLD-Tau), Lewy Body Disease (LBD), amyotrophic lateral sclerosis (ALS), frontal-temporal degeneration (FTD), ALS-FTD, and chronic traumatic encephalopathy (CTE).
- AD Alzheimer’ s disease
- NCL neuronal ceroid lipofuscinosis
- TSEs or prion disease
- agent means a substance that produces or is capable of producing an effect and would include, but is not limited to, vectors, chemicals, pharmaceuticals, biologies, small organic molecules, antibodies, nucleic acids, peptides, and proteins.
- carrier refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered, and includes any and all solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like.
- solvents dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like.
- pharmaceutically acceptable refers to molecular entities and compositions that do not produce an allergic or similar untoward reaction when administered to a host, such as gastric upset, dizziness and the like, when administered to a human, and approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
- isolated nucleic acid molecule means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature or is linked to a polynucleotide to which it is not linked in nature.
- a nucleic acid molecule comprising a particular nucleotide sequence does not encompass intact chromosomes.
- Isolated nucleic acid molecules "comprising" specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty or more other proteins or portions or fragments thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences.
- control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
- the control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
- Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.
- a nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence.
- DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
- a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or
- a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
- "operably linked” means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
- the expressions "cell,” “cell line,” and “cell culture” are used interchangeably and all such designations include progeny.
- the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that not all progeny will have precisely identical DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
- the disclosure provides isolated adeno-associated viral vectors (AAVs).
- AAVs isolated adeno-associated viral vectors
- isolated refers to an AAV that has been isolated from its natural environment (e.g., from a host cell, tissue, or subject) or artificially produced. Isolated AAVs may be produced using recombinant methods. Such AAVs are referred to herein as "recombinant AAVs".
- Recombinant AAVs preferably have tissue-specific targeting capabilities, such that a transgene of the rAAV will be delivered specifically to one or more predetermined tissue(s).
- the AAV capsid is an important element in determining these tissue- specific targeting capabilities.
- the recombinant AAV may be AAV9 or AAV10 vector and capsid.
- the methods involve culturing a host cell which contains a nucleic acid sequence encoding an AAV capsid protein or fragment thereof; a functional rep gene; a recombinant AAV vector composed of AAV inverted terminal repeats (ITRs) and a transgene; and sufficient helper functions to permit packaging of the recombinant AAV vector into the AAV capsid proteins.
- a host cell which contains a nucleic acid sequence encoding an AAV capsid protein or fragment thereof; a functional rep gene; a recombinant AAV vector composed of AAV inverted terminal repeats (ITRs) and a transgene; and sufficient helper functions to permit packaging of the recombinant AAV vector into the AAV capsid proteins.
- ITRs AAV inverted terminal repeats
- the components to be cultured in the host cell to package a rAAV vector in an AAV capsid may be provided to the host cell in trans.
- any one or more of the required components e.g., recombinant AAV vector, rep sequences, cap sequences, and/or helper functions
- a stable host cell which has been engineered to contain one or more of the required components using methods known to those of skill in the art.
- a stable host cell will contain the required component(s) under the control of an inducible promoter.
- the required component(s) may be under the control of a constitutive promoter.
- a selected stable host cell may contain selected component(s) under the control of a constitutive promoter and other selected component(s) under the control of one or more inducible promoters.
- a stable host cell may be generated which is derived from 293 cells (which contain El helper functions under the control of a constitutive promoter), but which contain the rep and/or cap proteins under the control of inducible promoters.
- the recombinant AAV vector, rep sequences, cap sequences, and helper functions for producing the rAAV may be delivered to the packaging host cell using any appropriate genetic element (vector).
- the selected genetic element may be delivered by any suitable method, including those described herein. See, e.g., Fisher el al, J. Virology 70:520-532 (1993) and U.S. Patent No. 5,478,745.
- recombinant AAVs may be produced using the triple transfection method (e.g., as described in detail in U.S. Patent No. 6,001,650).
- the recombinant AAVs are produced by transfecting a host cell with a recombinant AAV vector (comprising a transgene) to be packaged into AAV particles, an AAV helper function vector, and an accessory function vector.
- An AAV helper function vector encodes the "AAV helper function" sequences (i.e., rep and cap), which function in trans for productive AAV replication and encapsidation.
- the AAV helper function vector supports efficient AAV vector production without generating any detectable wild- type AAV virions (i.e., AAV virions containing functional rep and cap genes).
- vectors suitable for use include pHLP19, described in U.S. Patent No. 6,001,650 and pRep6cap6 vector, described in U.S. Patent No. 6,156,303, the entirety of both incorporated by reference herein.
- the accessory function vector encodes nucleotide sequences for non- AAV derived viral and/or cellular functions upon which AAV is dependent for replication (i.e., "accessory functions").
- the accessor ⁇ ' functions include those functions required for AAV replication, including, without limitation, those moieties involved in activation of AAV gene transcription, stage specific AAV mRNA splicing, AAV DNA replication, synthesis of cap expression products, and AAV capsid assembly.
- Viral-based accessory functions can be derived from any of the known helper viruses such as adenovirus, herpesvirus (other than herpes simplex virus type-1), and vaccinia virus.
- AAV1 AAV2
- AAV3 AAV4
- capsid proteins capsid proteins from AAV1, AAV2, AAV3, or AAV4, respectively.
- AAV2/1 AAV2/8
- AAV2/9 AAV2/9
- transfection refers to the uptake of foreign DNA by a cell, and a cell has been "transfected” when exogenous DNA has been introduced inside the cell membrane.
- transfection techniques are generally known in the art. See, e.g., Graham et al., Virology 52:456 (1973), Sambrook et al., Molecular Cloning, a Laboratory Manual, Cold Spring Harbor Laboratories, New York (1989), Davis et al., Basic Methods in Molecular Biology, Elsevier (1986), and Chu et al., Gene 13:197 (1981).
- exogenous nucleic acids such as a nucleotide integration vector and other nucleic acid molecules
- a “host cell” refers to any cell that harbors, or is capable of harboring, a substance of interest. Often a host cell is a mammalian cell. A host cell may be used as a recipient of an AAV helper construct, an AAV minigene plasmid, an accessory function vector, or other transfer DNA associated with the production of recombinant AAV vectors. The term includes the progeny of the original cell which has been transfected. Thus, a "host cell” as used herein may refer to a cell which has been transfected with an exogenous DNA sequence. It is understood that the progeny of a single parental cell may not necessarily be completely identical in morphology or in genomic or total DNA complement as the original parent, due to natural, accidental, or deliberate mutation.
- the term “isolated” refers to a cell that has been isolated from its natural environment (e.g., from a tissue or subject).
- the term “cell line” refers to a population of cells capable of continuous or prolonged growth and division in vitro. Often, cell lines are clonal populations derived from a single progenitor cell. It is further known in the art that spontaneous or induced changes can occur in karyotype during storage or transfer of such clonal populations. Therefore, cells derived from the cell line referred to may not be precisely identical to the ancestral cells or cultures, and the cell line referred to includes such variants.
- the terms "recombinant cell” refers to a cell into which an exogenous DNA segment, such as DNA segment that leads to the transcription of a biologically-active polypeptide or production of a biologically active nucleic acid such as an RNA, has been introduced.
- vector includes any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, artificial chromosome, virus, or virion, which is capable of replication when associated with the proper control elements and which can transfer gene sequences between cells.
- the term includes cloning and expression vehicles, as well as viral vectors.
- useful vectors are contemplated to be those vectors in which the nucleic acid segment to be transcribed is positioned under the transcriptional control of a promoter.
- a “promoter” refers to a DNA sequence recognized by the synthetic machinery of the cell, or introduced synthetic machinery, required to initiate the specific transcription of a gene.
- the phrases “operatively positioned,” “operatively linked,” “under control,” or “under transcriptional control” means that the promoter is in the correct location and orientation in relation to the nucleic acid to control RNA polymerase initiation and expression of the gene.
- expression vector or “expression construct” or “construct” means any type of genetic construct containing a nucleic acid in which part or all of the nucleic acid encoding sequence is capable of being transcribed.
- expression includes transcription of the nucleic acid, for example, to generate a biologically-active polypeptide product or inhibitory RNA from a transcribed gene.
- Standard methods in molecular biology are described Sambrook, Fritsch and Maniatis Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (1982 & 1989 2nd Edition, 2001 3rd Edition); Sambrook and Russell Molecular Cloning, 3rd ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY (2001); Wu Recombinant DNA, Vol. 217, Academic Press, San Diego, CA) (1993). Standard methods also appear in Ausbel, et al. Current Protocols in Molecular Biology, Vols.1-4, John Wiley and Sons, Inc. New York, NY (2001).
- AD Alzheimer’s disease
- retromer dysfunction recapitulates AD’s cytopathology, characterized by enlarged and dysfunctional endosomes in which fragments of the amyloid precursor protein (APP) accumulate.
- APP amyloid precursor protein
- Retromer is a multiprotein complex that is a ‘master conductor’ of endosomal trafficking. Retromer’s core is a trimer of three different proteins, making it technically a heterotrimer. The proteins are all members of the ‘Vacuolar Protein Sorting’ (VPS) family of proteins. VPS35 is the trimer core’s central protein to which VPS29 and VPS26 bind. VPS26 is the only core protein that has two paralogs called VPS26a and VPS26b. Thus, neurons have two distinct retromer cores: VPS29-VPS35-VPS26a and VPS29-VPS35-VPS26b. See Figure 1.
- VPS35 levels either by pharmacological chaperones or via viral vectors, increases retromer’s function.
- VPS29 protein may exist in a surplus.
- the co-expression of both VPS35 and VPS26a or both VPS35 and VPS26b has a synergistic effect on cellular levels of VPS35 and VPS26a or VPS35 and VPS26b, respectively.
- VPS26a and VPS26b are independent of one another, and therefore appropriate choice of combinatorials allows selective increase of one retromer heterotrimer over the other.
- Described herein is a biologically based method to increase retromer levels and function in vivo: the overexpression of retromer by the use of recombinant AAV (adeno-associated adenovirus) technology.
- AAV adeno-associated adenovirus
- Establishing novel retromer-AAV tools to be used for retromer based therapeutics, will have a high impact, as this viral delivery system — recently approved for clinical applications — can bypass the obstacles that a small molecule would encounter within the organism ( i.e low absorption rates, degradation, toxicity, lack of target/organ specificity, blood brain barrier permeability).
- the compositions comprising AAV vectors and the retromer transgene(s) have many advantages including increased expression of the therapeutic agent, bypassing of strict protein autoregulation, the potential for long term expression of stabilized proteins, and increasing the half-
- Patients who would benefit from the administration of the described gene therapy include those diagnosed with a neurogenerative disease or disorder where endosomal trafficking defects are implicated including but not limited to Alzheimer’s disease (AD), Parkinson’s disease, neuronal ceroid lipofuscinosis (NCL), transmissible spongiform encephalopathies (TSEs or prion disease), multiple system atrophy (MSA), Down’s syndrome and hereditary spastic paraplegia (HSP), as well as tauopathies such as progressive supranuclear palsy (PSP), frontotemporal lobar dementia linked to chromosome 17q21-22 and its subtypes (FTLD-17/FTLD-Tau), Lewy Body Disease (LBD), amyotrophic lateral sclerosis (ALS), frontal-temporal degeneration (FTD), ALS- FTD, and chronic traumatic encephalopathy (CTE).
- AD Alzheimer’s disease
- Parkinson’s disease neuronal ceroid lipofuscinosis
- compositions containing a nucleic acid encoding one or more of the retromer core proteins may be administered to the patient.
- these compositions may be administered alone or in combination with other agents for the treatment of neurodegenerative diseases or disorders.
- the present disclosure provides methods of treating, preventing, curing, and/or reducing the severity or extent of a neurodegenerative disease or disorder, by administering to a subject in need thereof a therapeutically effective amount of a composition, or compositions, such as a viral vector (e.g., an AAV), comprising a nucleic acid encoding retromer core protein VPS35 and/or retromer core protein VPS26 and/or retromer core protein VPS26b.
- a viral vector e.g., an AAV
- the viral vector is an AAV, such as rAAV2-retro, AAV10, AAV2/10, AAV9 or an AAV2/9.
- the composition or compositions comprising a nucleic acid encoding retromer core protein VPS 35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b is administered as soon as neurodegenerative disease or disorder is diagnosed or suspected.
- the administered composition comprises a nucleic acid encoding VPS35 and either VPS26a or VPS26b.
- the method comprises administering one or more compositions comprising a nucleic acid encoding VPS35 and a nucleic acid encoding either VPS26a or VPS26b; ether simultaneously or sequentially.
- the method comprises administering one or more compositions comprising a nucleic acid encoding VPS35, a nucleic acid encoding VPS26a, and a nucleic acid encoding VPS26b; ether simultaneously or sequentially. In embodiments, the method comprises administering one or more compositions comprising a nucleic acid encoding VPS26a and a nucleic acid encoding VPS26b; ether simultaneously or sequentially.
- the amount of AAV vector comprising the transgene administered is about 4.2 x 10 11 or 4.2xl0 10 genome or vector or vector copies.
- the disclosure also provides methods of treating, preventing, curing, and/or reducing the severity or extent of neurodegenerative disease or disorder by administering to a subject in need thereof a therapeutically effective amount of a first composition (e.g ., viral vector, such as AAV) containing a nucleic acid encoding retromer core protein VPS 35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b and further comprising administering to the subject a therapeutically effective amount of a second composition (e.g ., viral vector, such as AAV) containing a nucleic acid encoding retromer core protein VPS 35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b.
- a first composition e.g ., viral vector, such as AAV
- a second composition e.g ., viral vector, such as AAV
- the method comprises administering a therapeutically effective amount of a first composition containing a nucleic acid encoding retromer core protein VPS35 and a therapeutically effective amount of a second composition containing a nucleic acid encoding a retromer core protein VPS26a or VPS26b. In embodiments, the method comprises administering a therapeutically effective amount of a first composition containing a nucleic acid encoding retromer core protein VPS26a or VPS26b and a therapeutically effective amount of a second composition containing a nucleic acid encoding a retromer core protein VPS35.
- the disclosure also provides methods of treating, preventing, curing, and/or reducing the severity or extent of neurodegenerative disease or disorder by administering to a subject in need thereof a therapeutically effective amount of a first composition (e.g., viral vector, such as AAV) containing a nucleic acid encoding retromer core protein VPS 35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b and further comprising administering to the subject a therapeutically effective amount of a second composition (e.g., viral vector, such as AAV) containing a nucleic acid encoding retromer core protein VPS 35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b and further comprising administering to the subject a therapeutically effective amount of a third composition (e.g., viral vector, such as AAV) containing a nucleic acid encoding retromer core protein VPS 35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b.
- the first and second and third AAV vectors are each independently an AAV9 vector encoding retromer core protein VPS35 and/or retromer core protein VPS26a and/or VPS26b retromer core protein.
- the first AAV vector and the second AAV vector and the third AAV vector are administered at the same time.
- the first AAV vector is administered prior to the second AAV vector.
- the second AAV vector is administered prior to the third AAV vector.
- the first composition e.g., AAV vector
- the second composition e.g., AAV vector
- the second composition is administered within hours of the first composition (e.g., AAV vector).
- the second composition e.g., AAV vector
- the second composition is administered within days of the first composition (e.g., AAV vector).
- the second composition e.g., AAV vector
- the first composition e.g., AAV vector
- the second composition e.g., AAV vector
- the second composition e.g., AAV vector
- the third composition (e.g., AAV vector) is administered at a time point after the second composition. In some embodiments, the third composition (e.g., AAV vector) is administered within hours of the second composition (e.g., AAV vector). In some embodiments, the third composition (e.g., AAV vector) is administered within days of the second composition (e.g., AAV vector). In some embodiments, the third composition (e.g., AAV vector) is administered weeks after the second composition (e.g., AAV vector).
- the first composition (e.g., AAV vector) and the second composition (e.g., AAV vector) and the third composition (e.g., AAV vector) are administered simultaneously at any given time point, including a time point when, or after, the neurodegenerative disease or disorder is diagnosed or suspected.
- the three compositions e.g., AAV vectors
- the three are present within the same larger composition, and in some embodiments, the three are separate compositions.
- one or more compositions comprising one or more nucleic acids encoding VPS35 and VPS26b are administered to a subject that has, or is at risk of developing, a disorder in which endosomal trafficking defects occur primarily in the cortex and in which VPS35 is unaffected.
- a disorder in which endosomal trafficking defects occur primarily in the cortex and in which VPS35 is unaffected include biomarker-negative sporadic AD, AD patients with SORL1 mutations, FTD, prion disease, and Down’s syndrome.
- compositions comprising one or more nucleic acids encoding VPS35 and VPS26a (which is preferentially expressed in the subcortex) are administered to a subject that has, or is at risk of developing, a disorder in which endosomal trafficking defects occur primarily in subcortical regions, such as biomarker-negative sporadic PD, HSP, prion disease, and NCL.
- compositions comprising one or more nucleic acids encoding VPS35, VPS26a, and VPS26b are administered to a subject that has, or is at risk of developing, an endosomal trafficking neurological disorder in which the disease is more diffuse, such as Lewy Body Disease (LBD), prion disease, and ALS- FTD.
- LBD Lewy Body Disease
- prion disease prion disease
- ALS- FTD ALS- FTD
- the methods and compositions described herein are used to treat, prevent, cure and/or reduce the severity of other disorders or diseases that are associated with endosomal trafficking and retromer dysfunction.
- Recombinant AAV Vectors are used to treat, prevent, cure and/or reduce the severity of other disorders or diseases that are associated with endosomal trafficking and retromer dysfunction.
- transgene vectors described herein generally include a transgene (e.g., encoding retromer core protein VPS35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b).
- the transgene is flanked by 5’- and 3’- ITRs and may be operably linked to one or more regulatory elements in a manner that permits transgene transcription, translation, and/or expression in a cell of a target tissue.
- regulatory elements may include a promoter or enhancer, such as the chicken beta actin promoter or cytomegalovirus enhancer, among others described herein.
- the recombinant AAV genome is generally encapsidated by capsid proteins (e.g., from the same AAV serotype as that from which the ITRs are derived or from a different AAV serotype from that which the ITRs are derived).
- the AAV vector may then be delivered to a selected target cell type or tissue.
- the transgene is a nucleic acid sequence, heterologous to the vector sequences, which encodes one or more of VPS35, VPS26a and/or VPS26b.
- AAV serotype or combination of AAV serotype can be used in the methods and compositions of the present disclosure. Because the methods and compositions of the present disclosure are for the treatment and cure of neurodegenerative diseases or disorders, AAV serotypes that target at least the central nervous system can be used in some embodiments and include but are not limited to AAV1, AAV2, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, and AAV10.
- AAV9 serotype which has a wide tropism, is used.
- an AAV2/9 is used.
- the AAV vectors described herein may contain cis-acting 5' and 3' ITRs (See, e.g., Carter, in "Handbook of Parvoviruses", ed., P. Tijsser, CRC Press, pp. 155 168 (1990)).
- the ITR sequences are typically about 145 bp in length. Preferably, substantially the entire sequences encoding the ITRs are used in the molecule, although some degree of minor modification of these sequences is permissible. (See, e.g., texts such as Sambrook et al, (1989) and Fisher et al., (1996)).
- AAV ITR sequences may be obtained from any known AAV, including presently identified mammalian AAV types.
- the vector may also include conventional control elements which are operably linked to the transgene in a manner which permits its transcription, translation and/or expression in a cell transfected with the plasmid vector or infected with the virus.
- "operably linked" sequences include both expression control sequences that are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest.
- Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation (poly A) signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance secretion of the encoded product.
- efficient RNA processing signals such as splicing and polyadenylation (poly A) signals
- sequences that stabilize cytoplasmic mRNA sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance secretion of the encoded product.
- a great number of expression control sequences including promoters which are native, constitutive, inducible and/or tissue-specific, are known in the art and may be utilized.
- nucleic acid sequence e.g ., coding sequence
- regulatory sequences are said to be operably linked when they are covalently linked in such a way as to place the expression or transcription of the nucleic acid sequence under the influence or control of the regulatory sequences.
- nucleic acid sequences be translated into a functional protein
- two DNA sequences are said to be operably linked if induction of a promoter in the 5' regulatory sequences results in the transcription of the coding sequence and if the nature of the linkage between the two DNA sequences does not (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the promoter region to direct the transcription of the coding sequences, or (3) interfere with the ability of the corresponding RNA transcript to be translated into a protein.
- a promoter region would be operably linked to a nucleic acid sequence if the promoter region were capable of effecting transcription of that DNA sequence such that the resulting transcript might be translated into the desired protein or polypeptide.
- operably linked coding sequences yield a fusion protein.
- operably linked coding sequences yield a functional RNA (e.g., shRNA, miRNA).
- operably linked coding sequences yield two or more separate functional proteins (e.g., VPS 35 and VPS26a or VPS26b).
- a polyadenylation sequence generally is inserted following the transgene sequences and before the 3' AAV ITR sequence.
- An rAAV construct of the present disclosure may also contain an intron, desirably located between the promoter/enhancer sequence and the transgene.
- One possible intron sequence is derived from SV-40 and is referred to as the SV-40 T intron sequence.
- IRES internal ribosome entry site
- An IRES sequence is used to produce more than one polypeptide or protein from a single transcript.
- An IRES element may be used, for example, to express VPS35 and VPS26a, VPS35 and VPS26b, or VPS26a and VPS26b from the same AAV vector.
- regulatory sequences needed for gene expression in host cells may vary between species, tissues or cell types, but shall in general include, as necessary, 5' non-transcribed and 5' non-translated sequences involved with the initiation of transcription and translation respectively, such as a TATA box, capping sequence, CAAT sequence, enhancer elements, and the like.
- 5' non-transcribed regulatory sequences will include a promoter region that includes a promoter sequence for transcriptional control of the operably joined gene.
- Regulatory sequences may also include enhancer sequences or upstream activator sequences as desired.
- the vectors may optionally include 5' leader or signal sequences.
- constitutive promoters include, without limitation, a chicken beta actin promoter, a retroviral Rous sarcoma virus (RS V) LTR promoter (optionally with a RS V enhancer), a cytomegalovirus (CMV) promoter (optionally with a CMV enhancer), a SV40 promoter, a dihydrofolate reductase promoter, a b-actin promoter, a phosphoglycerol kinase (PGK) promoter, and a human elongation factor-la (EFla) promoter (Invitrogen).
- RS V Rous sarcoma virus
- CMV cytomegalovirus
- SV40 promoter a dihydrofolate reductase promoter
- PGK phosphoglycerol kinase
- EFla human elongation factor-la
- Inducible promoters allow regulation of gene expression and can be regulated by exogenously supplied compounds, environmental factors such as temperature, or the presence of a specific physiological state, e.g., acute phase, a particular differentiation state of the cell, or in replicating cells only.
- Inducible promoters and inducible systems are available from a variety of commercial sources, including, without limitation, Invitrogen, Clontech and Ariad.
- inducible promoters regulated by exogenously supplied promoters include a zinc-inducible sheep metallothionine (MT) promoter, a dexamethasone (Dex)-inducible mouse mammary tumor virus (MMTV) promoter, a T7 polymerase promoter system (WO 98/10088); a ecdysone insect promoter (No et al., Proc. Natl. Acad. Sci. USA 93:3346-3351 (1996)), a tetracycline-repressible system (Gossen et al., Proc. Natl. Acad. Sci.
- inducible promoters which may be useful in this context are those which are regulated by a specific physiological state, e.g., temperature, acute phase, a particular differentiation state of the cell, or in replicating cells only.
- a native promoter, or fragment thereof, for the transgene will be used.
- the native promoter may be preferred when it is desired that expression of the transgene should mimic the native expression.
- the native promoter may be used when expression of the transgene must be regulated temporally or developmentally, or in a tissue-specific manner, or in response to specific transcriptional stimuli.
- other native expression control elements such as enhancer elements, polyadenylation sites or Kozak consensus sequences may also be used to mimic the native expression.
- the regulatory sequences impart tissue-specific gene expression capabilities. In some cases, the tissue-specific regulatory sequences bind tissue-specific transcription factors that induce transcription in a tissue specific manner.
- one or more bindings sites for one or more of miRNAs are incorporated in a transgene of a rAAV vector, to inhibit the expression of the transgene in one or more tissues of a subject harboring the transgenes.
- the miRNA target sites in the mRNA may be in the 5'- UTR, the 3'- UTR or in the coding region. Typically, the target site is in the 3' UTR of the mRNA.
- the transgene may be designed such that multiple miRNAs regulate the mRNA by recognizing the same or multiple sites. The presence of multiple miRNA binding sites may result in the cooperative action of multiple RISCs and provide highly efficient inhibition of expression.
- the target site sequence may comprise a total of 5-100, 10-60, or more nucleotides.
- the target site sequence may comprise at least 5 nucleotides of the sequence of a target gene binding site.
- a 3 ’-UTR site which would inhibit the expression of the transgene in the liver can be incorporated into a transgene.
- suppressing the therapeutic gene expression in liver relieves the burden from liver cells.
- the AAV vector will be modified to be a self-complementing AAV.
- a self-complementing AAV carries complementary sequence of the transgene (i.e., a double copy of the transgene). Self-complementation makes the gene more stable after it enters the cell.
- Nucleic acid sequences of transgenes described herein may be designed based on the knowledge of the specific composition (e.g., viral vector) that will express the transgene.
- one type of transgene sequence includes a reporter sequence, which upon expression produces a detectable signal.
- the transgene encodes a therapeutic protein or therapeutic functional RNA.
- the transgene encodes a protein or functional RNA that is intended to be used for research purposes, e.g., to create a somatic transgenic animal model harboring the transgene, e.g., to study the function of the transgene product.
- the transgene encodes a protein or functional RNA that is intended to be used to create an animal model of disease. Appropriate transgene coding sequences will be apparent to the skilled artisan.
- the transgenes encode a functional protein including but not limited to retromer core protein VPS35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b. In embodiments, the transgene encodes VPS35 and either VPS26a or VPS26b. In embodiments, the transgene encodes VPS35, VPS26a and VPS26b. In embodiments, the transgene encodes VPS26a and VPS26b. In embodiments, the transgene encodes just one of VPS35, VPS26a, and VPS26b.
- amino acid sequence information can be obtained from the National Center for Biotechnology Information (NCBI) and are set forth below.
- the gene encoding the human retromer core protein VPS35 (Gene ID: 55737) can be used to obtain a transgene encoding a functional retromer core protein VPS35 (SEQ ID NO: 1): MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALK HASNMLGELRTSMLSPKSYYELYMAISDELHYLEVYLTDEFAKGRKVADLYELVQYAG NIIPRLYLLITVGVVYVKSFPQSRKDILKDLVEMCRGVQHPLRGLFLRNYLLQCTRNI LPDEGEPTDEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRERERQELRIL
- the gene encoding the human retromer core protein VPS26a (Gene ID: 9559) can be used to obtain a transgene encoding a functional retromer core protein VPS26a (SEQ ID NO: 2): MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQP GKRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYE SYIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFE YNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAPV KGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVD EEDRRYFKQQEIILWRKAPE KLRKQRTNFH QRFESPESQASAEQPEM
- the gene encoding the human retromer core protein VPS26b (Gene ID: 112936) can be used to obtain a transgene encoding a functional retromer core protein VPS26b (SEQ ID NO: 3): MSFFGFGQSVEVEILLNDAESRKRAEHKTEDGKKEKYFLFYDGE T VS GKVS L ALKNPNKRLEHQGIKIEFIGQIEL Y YDRGNHHEF V S LVKDLARPGEITQS QAFDFEFTHVEKPYESYTGQNVKLRYFLRATISRRLNDVVKEMDIVVHTLSTYPELNS SIKME V GIEDCLHIEFEYNKS KYHLKD VIVGKIYFLLVRIKIKHMEIDIIKRETTGTG PNVYHENDTIAKYEIMDGAPVRGESIPIRLFLAGYELTPTMRDINKKFSVRYYLNLVL IDEEERRYFKQQEVVLWRKGDIVRKSMSHQAAIASQRF
- Codon optimization of the transgene coding sequences can increase the efficiency of the gene therapy.
- a nucleic acid that is at least 70% identical to the coding sequence of the transgene encoding the therapeutic protein e.g., a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence
- a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%,
- Codon optimization tools are known in the art.
- Exemplary codon optimized nucleic acids are as follows. mVPS35 Codon optimized (SEQ ID NO: 7)
- CCCATCTATGAGGGGCTGATCCTGTGA mVPS26a Isoform A, Codon optimized (SEQ ID NO: 8)
- the current disclosure provides rAAV vectors for use in methods of treating, preventing, and/or curing a neurodegenerative disease or disorder and/or alleviating in a subject at least one of the symptoms associated with a neurodegenerative disease and/or disorder.
- methods involve administration of a rAAV vector that encodes one or more therapeutic polypeptides or proteins, in a pharmaceutically-acceptable carrier to the subject in an amount and for a period of time sufficient to treat, prevent and/or cure the neurodegenerative disease or disorder in the subject having or suspected of having such a neurodegenerative disease or disorder.
- compositions may be delivered to a subject in compositions according to any appropriate methods known in the art.
- the rAAV vector preferably suspended in a physiologically compatible carrier (e.g ., in a composition), may be administered to a subject.
- compositions may comprise a rAAV vector alone, or in combination with one or more other vectors (e.g., a second rAAV vector having one or more different transgenes).
- a composition can comprise an rAAV9 vector comprising a nucleic acid sequence comprising a transgene encoding a functional protein including but not limited to retromer core protein VPS35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b.
- a composition can comprise an rAAV2/9 vector comprising a nucleic acid sequence comprising a transgene encoding a functional protein including but not limited to retromer core protein VPS35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b.
- a composition can comprise an rAAVIO or rAAV2/10 vector comprising a nucleic acid sequence comprising a transgene encoding a functional protein including but not limited to retromer core protein VPS35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b.
- Suitable carriers may be readily selected by one of skill in the art in view of the indication for which the rAAV is directed.
- one suitable carrier includes saline, which may be formulated with a variety of buffering solutions (e.g., phosphate buffered saline).
- Other exemplary carriers include sterile saline, lactose, sucrose, calcium phosphate, gelatin, dextran, agar, pectin, peanut oil, sesame oil, and water. The selection of the carrier is not a limitation of the presentdisclosure.
- compositions disclosed herein may contain, in addition to the rAAV and carrier(s), other conventional pharmaceutical ingredients, such as preservatives, or chemical stabilizers.
- suitable exemplary preservatives include chlorobutanol, potassium sorbate, sorbic acid, sulfur dioxide, propyl gallate, the parabens, ethyl vanillin, glycerin, phenol, and parachlorophenol.
- Suitable chemical stabilizers include gelatin and albumin.
- rAAV compositions are formulated to reduce aggregation of AAV particles in the composition, particularly where high rAAV concentrations are present (e.g., about 10 13 GC/ml or more).
- high rAAV concentrations e.g., about 10 13 GC/ml or more.
- Methods for reducing aggregation of rAAVs include, for example, addition of surfactants, pH adjustment, and salt concentration adjustment (see, e.g., Wright, et al., Molecular Therapy 12:171-178 (2005).
- the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
- Dispersions may also be prepared in glycerol, liquid polyethylene glycols, and mixtures thereof and in oils. Under ordinary conditions of storage and use, these preparations contain a preservative to prevent the growth of microorganisms. In many cases the form is sterile and fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
- the carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and/or vegetable oils.
- polyol e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
- suitable mixtures thereof e.g., vegetable oils
- vegetable oils e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
- suitable mixtures thereof e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
- vegetable oils e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like
- Proper fluidity may be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion
- isotonic agents for example, sugars or sodium chloride.
- Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
- the solution may be suitably buffered, if necessary, and the liquid diluent first rendered isotonic with sufficient saline or glucose.
- a sterile aqueous medium that can be employed will be known to those of skill in the art.
- one dosage may be dissolved in 1 ml of isotonic NaCl solution and either added to 1000 ml of hypodermoclysis fluid or injected at the proposed site of infusion. Some variation in dosage will necessarily occur depending on the condition of the host. The person responsible for administration will, in any event, determine the appropriate dose for the individual host.
- Sterile injectable solutions are prepared by incorporating the active rAAV in the required amount in the appropriate solvent with various of the other ingredients enumerated herein, as required, followed by filtered sterilization.
- dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
- the preferred methods of preparation are vacuum-drying and freeze-drying techniques which yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Sonophoresis i.e., ultrasound
- U.S. Patent No. 5,656,016 has been used and described in U.S. Patent No. 5,656,016 as a device for enhancing the rate and efficacy of drug permeation into and through the circulatory system.
- Other drug delivery alternatives contemplated are intraosseous injection (U.S. Patent No. 5,779,708), microchip devices (U.S. Patent No. 5,797,898), ophthalmic formulations, transdermal matrices (U.S. Patent Nos. 5,770,219 and 5,783,208) and feedback-controlled delivery (U.S. Patent No. 5,697,899).
- rAAVS are administered by a route of administration and in sufficient amounts to transfect the cells of a desired tissue and to provide sufficient levels of gene transfer and expression without undue adverse effects.
- routes of administration include, but are not limited to, direct delivery to the selected tissue (e.g., intracerebral administration, intrathecal administration), intravenous, oral, inhalation (including intranasal and intratracheal delivery), intraocular, intravenous, intramuscular, subcutaneous, intradermal, and other parental routes of administration. Routes of administration may be combined, if desired.
- the administration regimen depends on several factors, including the serum or tissue turnover rate of the therapeutic composition, the level of symptoms, and the accessibility of the target cells in the biological matrix.
- the administration regimen delivers sufficient therapeutic composition to effect improvement in the target disease state, while simultaneously minimizing undesired side effects. Accordingly, the amount of biologic delivered depends in part on the particular therapeutic composition and the severity of the condition being treated.
- compositions comprising rAAV virions.
- the compositions remain stable and active even when subjected to freeze/thaw cycling and when stored in containers made of various materials, including glass.
- rAAV virions e.g., human or nonhuman primate or other mammal
- age and general condition of the subject to be treated e.g., human or nonhuman primate or other mammal
- severity of the condition being treated e.g., the mode of administration of the rAAV virions, among other factors.
- An appropriate effective amount can be readily determined by one of skill in the art.
- the dose of rAAV virions required to achieve a desired effect or "therapeutic effect,” e.g., the units of dose in vector genomes/per kilogram of body weight (vg/kg) will vary based on several factors including, but not limited to: the route of rAAV administration; the level of gene or RNA expression required to achieve a therapeutic effect; the specific disease or disorder being treated; and the stability of the gene or RNA product.
- a rAAV virion dose range to treat a subject having a particular disease or disorder based on the aforementioned factors, as well as other factors that are well known in the art.
- An effective amount of the rAAV is generally in the range of from about 10 ⁇ l to about 100 ml of solution containing from about 10 9 to 10 16 genome copies per subject. Other volumes of solution may be used. The volume used will typically depend, among other things, on the size of the subject, the dose of the rAAV, and the route of administration. For example, for intrathecal or intracerebral administration a volume in range of 1 ⁇ l to 10 ⁇ l or 10 ⁇ l to 100 ⁇ l may be used.
- a volume in range of 10 ⁇ l to 100 ⁇ l, 100 ⁇ l to 1 ml, 1 ml to 10 ml, or more may be used.
- a dosage between about 10 10 to 10 12 rAAV genome copies per subject is appropriate.
- 10 12 rAAV genome copies per subject is effective to target desired tissues.
- the rAAV is administered at a dose of 10 10 , 10 11 , 10 12 , 10 13 , 10 14 , or 10 15 genome copies per subject.
- the rAAV is administered at a dose of 10 10 , 10 11 , 10 12 , 10 13 , or 10 14 genome copies per kg.
- a therapeutically effective amount will fall in a relatively broad range that can be determined through clinical trials.
- a therapeutically effective dose may be on the order of from about 10 5 to 10 16 of the rAAV virions, more preferably 10 8 to 10 14 rAAV virions.
- an effective amount of rAAV virions to be delivered to cells may be on the order of 10 5 to 10 13 , preferably 10 8 to 10 13 of the rAAV virions.
- the amount of transduced cells in the pharmaceutical compositions may be from about 10 4 to 10 10 cells, more preferably 10 5 to 10 8 cells.
- the dose depends on the efficiency of transduction, promoter strength, the stability of the message and the protein encoded thereby. Effective dosages can be readily established by one of ordinary skill in the art through routine trials establishing dose response curves.
- Dosage treatment may be a single dose schedule or a multiple dose schedule to ultimately deliver the amount specified above.
- the subject may be administered as many doses as appropriate.
- the subject may be given, e.g., 10 5 to 10 16 rAAV virions in a single dose, or two, three, four, five, six or more doses that collectively result in delivery of, e.g., 10 5 to 10 16 rAAV virions.
- One of skill in the art can readily determine an appropriate number of doses to administer.
- compositions will thus comprise sufficient genetic material to produce a therapeutically effective amount of the protein of interest, i.e., an amount sufficient to reduce or ameliorate symptoms of the disease state in question or an amount sufficient to confer the desired benefit.
- rAAV virions will be present in the subject compositions in an amount sufficient to provide a therapeutic effect when given in one or more doses.
- the rAAV virions can be provided as lyophilized preparations and diluted in the virion- stabilizing compositions for immediate or future use. Alternatively, the rAAV virions may be provided immediately after production and stored for future use.
- compositions will also contain a pharmaceutically acceptable excipient or carriers.
- excipients include any pharmaceutical agent that does not itself induce the production of antibodies harmful to the individual receiving the composition, and which may be administered without undue toxicity.
- Pharmaceutically acceptable excipients include, but are not limited to, liquids such as water, saline, glycerol and ethanol.
- Pharmaceutically acceptable salts can be included therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like.
- auxiliary substances such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
- auxiliary substances such as wetting or emulsifying agents, pH buffering substances, and the like.
- Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions.
- Toxicity and therapeutic efficacy of the therapeutic compositions, administered alone or in combination with another agent can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the population).
- the dose ratio between toxic and therapeutic effects is the therapeutic index (LD50/ ED50).
- therapeutic compositions exhibiting high therapeutic indices are desirable.
- the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in human.
- the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration.
- Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment.
- the dose may begin with an amount somewhat less than the optimum dose and it may be increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects.
- Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced.
- a biologic that will be used is derived from the same species as the animal targeted for treatment, thereby minimizing any immune response to the reagent.
- a preferred route of administration of the AAVs is intravenously.
- Other routes of administration of the rAAV vectors described herein include intracranial, intraparenchymal, intraspinal.
- a preferred dose ranges from about 1x10 10 to about 8x10 11 , from about 2xlO 10 to about 6x10 11 , from about 4xl0 10 to about 4x10 11 genome or viral copy (vc) total administration.
- a preferred dose is about 4x10 11 genome or viral copy (vc) total administration of rAAV.
- a preferred total dose of vector ranges from about 1x10 10 to about 6x10 11 , from about 2xl0 10 to about 5x10 11 , from about 1x10 10 to about 4x10 11 genome or viral copy (vc) total administration.
- a preferred dose of total vector is about 3x10 11 .
- the AAV can be administered in equal amounts, e.g., ratio of 50/50, or in or in ratios of about 5/95, 10/90, 15/85, 20/80, 25/75, 30/70, 35/65, 40/60, 45/55, 55/45, 60/40, 65/35, 70/30, 75/25, 80/20, 85/15, 90/10, and 95/5.
- Doses can be adjusted to optimize the effects in the subject. Additionally, a subject can be monitored for improvement of their condition prior to increasing the dosage. A subject’s response to the therapeutic administration of the rAAV can be monitored by observing a subject’s muscle strength and control, and mobility as well as changes in height and weight. If one or more of these parameters increase after the administration, the treatment can be continued. If one or more of these parameters stays the same or decreases, the dosage can be increased.
- kits comprising the components of the combinations disclosed herein in kit form.
- a kit of the present disclosure includes one or more components including, but not limited to, viral vectors (e.g., AAV vectors)) described herein. Kits may further include a pharmaceutically acceptable carrier, as discussed herein.
- the viral vector can be formulated as a pure composition or in combination with a pharmaceutically acceptable carrier, in a pharmaceutical composition.
- kits includes an AAV vector containing a transgene described herein in one container (e.g., in a sterile glass or plastic vial).
- a kit in some embodiments, includes an AAV vector containing a transgene described herein in one container (e.g., in a sterile glass or plastic vial) and a second AAV vector encoding a transgene described herein in another container (e.g., in a sterile glass or plastic vial) and a third AAV vector encoding a transgene described herein in another container (e.g., in a sterile glass or plastic vial).
- a kit includes an AAV vector encoding retromer core protein VPS35 and/or retromer core protein VPS26a and/or retromer core protein VPS26b, or a pharmaceutical composition thereof in one or more containers (e.g., in a sterile glass or plastic vial).
- the kit can include a device for performing such administration.
- the kit can include one or more hypodermic needles or other injection devices as discussed above.
- the kit can include a package insert including information concerning the pharmaceutical compositions and dosage forms in the kit.
- information concerning the pharmaceutical compositions and dosage forms in the kit aids patients and physicians in using the enclosed pharmaceutical compositions and dosage forms effectively and safely.
- the following information regarding a combination may be supplied in the insert: pharmacokinetics, pharmacodynamics, clinical studies, efficacy parameters, indications and usage, contraindications, warnings, precautions, adverse reactions, overdosage, proper dosage and administration, how supplied, proper storage conditions, references, manufacturer/distributor information and patent information.
- Example 1- Materials and Methods Plasmid production mRNA sequences for VPS35, VPS26a and VPS26b were acquired from the National Center for Biotechnology Information (NCBI). The sequences were codon optimized and then de novo synthesized. The synthesized construct was sub-cloned into AAV transfer plasmid with AAV2 inverted terminal repeats (ITRs) and a ubiquitous Chicken beta Actin wild type promoter. The transgene was followed by the bovine growth hormone polyadenylation signal. Empty chassis vector control was generated by deleting the VPS35 sequence. The GFP control was designed to mimic the rationale design of the target VPS -constructs. It contained an enhanced green flourescent protein, the same Bovine Growth Hormone polyA (BgH) and Chicken beta Actin wild type promoter, as the VPS constructs. The resulting plasmids are shown in Figure 3.
- AAV9 adeno-associated virus vector 9
- capsid and helper plasmid DNA from MeiraGTx.
- the transfer plasmid, rep-cap plasmid and helper plasmids were co-transfected into HEK 293 cells.
- the harvested suspension containing virus and cellular debris was clarified using millipore SHC XL150 filter (140cm 2 ).
- the clarified suspension was then purified with AVB Sepharose, 20mL column, elution in 3 column volumes. Concentration and diafiltration was performed with lOOkD mPES hollow fibre (Spectrum MicroKros cat# C02-E100-05-S). Further concentration was done with Amicon Ultra-4 Centrifugal Filter 30kD (cat# UFC8030).
- Mouse neuroblastoma (N2a) cells were cultured in 50% DMEM (high glucose) and 50% Opti-MEM + 10% FBS and Glutamine (2mM) with penicillin and streptomycin to prevent microbial contamination. Transfection
- Lipofectamine transfection protocols were used with some modifications. Briefly lipofectamine LTX was used to co-transfect Vps35 and Vps26 (Vps26a or Vps26b) plasmids into neuron like cells, Neuro2a (N2a) in a 6 well format. 100k cells were plated in each well already containing medium with DNA-lipofectamine complexes. Empty chassis and GFP as were used as control plasmids. Amount of DNA copies introduced per well was 2.81E+11. Cells were harvested 48 hours after transfection using RIPA buffer as described previously (Qureshi et al. 2019).
- VPS35 (ab57632, Abeam, 1:1k); VPS26a (ab211530, Abeam, 1:500); VPS26b (NBP1-92575, Novus, 1:500 or 15915-1-AP, Proteintech, 1:500); VPS29 (sab2501105, Sigma-Aldrich, 1:500); Sorll (611861, BD-biosciences, 1:2k and 79322, Cell Signaling, 1:500); and b-actin (ab6276, Abeam, 1:5k).
- IRDye® 800 or 680 antibodies were used as secondary with dilutions of 1 : 10k for 800CW, 1 : 15k for 680RD, and 1:25k for 680LT antibodies.
- Western blots were scanned using the Odyssey imaging system as described previously (Eaton et al. 2013).
- VPS35 overexpression has on retromer core proteins and on retromer function in a non-deficient state
- cultured wild-type mouse neurons were transduced with AAV9-VPS35-HA and used either AAV9-GFP or AAV9-empty vector (EV) as control conditions, and harvested 3 weeks later.
- VPS35 overexpression leads to a robust overexpression of VPS29, but either no or a modest increase in VPS26 paralogs, has no clear effect on retromer function, these results justify investigating the effect of VPS35 and VPS26 co-expression.
- Neuroblastoma (N2A) cells were transfected with plasmids expressing single proteins (VPS35, VPS26a, or VPS26b), or a combination of proteins (VPS35+VPS26a or VPS35+VPS26b).
- a plasmid expressing GFP or an empty plasmid were used as controls.
- VPS35 and VPS26 combinatorials were generated.
- the experimental vectors were expressed in neurons in all possible combinations: Single protein expression (VPS35 alone, VPS26a alone, VPS26b alone); double protein expression (VPS35+VPS26a, VPS35+VPS26b, VPS26b+VPS26a); and triple protein expression (VPS35+VPS26a+VPS26b).
- each viral vector was optimized in exploratory studies, and when used in the final combinatorial study, mean AAV9-VPS35 overexpression was 11% (range: 1% to 23%), mean AAV9-VPS26a was 218% (range: 154% to 354%) and mean AAV9-VPS26b was 80% (range: 50% to 107%) (Figure 5B, blue bars). This profile turned out to be particularly useful for testing for interactions.
- VPS35 and VPS26 combinatorials have a synergistic effect on retromer function, by comparing levels of Sorll measured across all conditions because loss-of- function mutations in SORL1 are causal in Alzheimer’s disease (Holstege el al. 2017), and an approximate 30% reduction in Sorll protein is found even in early stages of the sporadic disease (Sager et al. 2007); Scherzer et al. 2004; Dodson et al. 2006).
- Vps26 has an arrestin fold and binds Vps35 through its C-terminal domain. Nat Struct Mol Biol. 2006; 13(6):540-8.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biomedical Technology (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biotechnology (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- General Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Wood Science & Technology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Toxicology (AREA)
- Microbiology (AREA)
- Psychiatry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Virology (AREA)
- Physics & Mathematics (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Plant Pathology (AREA)
- Epidemiology (AREA)
- Hospice & Palliative Care (AREA)
- Marine Sciences & Fisheries (AREA)
- Immunology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020227022902A KR20220152192A (ko) | 2019-12-05 | 2020-12-07 | 알츠하이머병 및 기타 신경 퇴행성 질환의 치료를 위한 레트로머의 안정화 |
| BR112022011073A BR112022011073A2 (pt) | 2019-12-05 | 2020-12-07 | Estabilização do retromer para o tratamento da doença de alzheimer e outros doenças neurodegenerativas |
| US17/782,357 US20230021959A1 (en) | 2019-12-05 | 2020-12-07 | Stabilization of Retromer for the Treatment of Alzheimer's Disease and Other Neurodegenerative Disorders |
| MX2022006895A MX2022006895A (es) | 2019-12-05 | 2020-12-07 | Estabilizacion de retromero para el tratamiento de la enfermedad de alzheimer y otros trastornos neurodegenerativos. |
| JP2022533615A JP2023505271A (ja) | 2019-12-05 | 2020-12-07 | アルツハイマー病および他の神経変性障害の処置のためのレトロマーの安定化 |
| IL293599A IL293599A (en) | 2019-12-05 | 2020-12-07 | Retromer stabilization for the treatment of Alzheimer's disease and other neurodegenerative disorders |
| CN202080093935.2A CN115297891A (zh) | 2019-12-05 | 2020-12-07 | 用于治疗阿尔茨海默病和其他神经退行性病症的逆转运复合体的稳定化 |
| CN202510180683.1A CN120114618A (zh) | 2019-12-05 | 2020-12-07 | 用于治疗阿尔茨海默病和其他神经退行性病症的逆转运复合体的稳定化 |
| EP20896932.9A EP4069315A4 (en) | 2019-12-05 | 2020-12-07 | Stabilization of retromer for the treatment of alzheimer's disease and other neurodegenerative disorders |
| AU2020395327A AU2020395327A1 (en) | 2019-12-05 | 2020-12-07 | Stabilization of retromer for the treatment of Alzheimer's disease and other neurodegenerative disorders |
| PH1/2022/551373A PH12022551373A1 (en) | 2019-12-05 | 2020-12-07 | Stabilization of retromer for the treatment of alzheimer`s disease and other neurodegenerative disorders |
| CA3160785A CA3160785A1 (en) | 2019-12-05 | 2020-12-07 | Stabilization of retromer for the treatment of alzheimer's disease and other neurodegenerative disorders |
| JP2025125690A JP2025149978A (ja) | 2019-12-05 | 2025-07-28 | アルツハイマー病および他の神経変性障害の処置のためのレトロマーの安定化 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962943999P | 2019-12-05 | 2019-12-05 | |
| US62/943,999 | 2019-12-05 | ||
| US202063074578P | 2020-09-04 | 2020-09-04 | |
| US63/074,578 | 2020-09-04 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021113824A1 true WO2021113824A1 (en) | 2021-06-10 |
Family
ID=76222705
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/063627 Ceased WO2021113824A1 (en) | 2019-12-05 | 2020-12-07 | Stabilization of retromer for the treatment of alzheimer's disease and other neurodegenerative disorders |
Country Status (12)
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023159238A1 (en) * | 2022-02-21 | 2023-08-24 | The Scripps Research Institute | Mef2 transcriptional activators to treat neurologic conditions |
Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070099251A1 (en) * | 2005-10-17 | 2007-05-03 | Institute For Systems Biology | Tissue-and serum-derived glycoproteins and methods of their use |
| US20080214482A1 (en) * | 2005-11-15 | 2008-09-04 | Scott Small | Retromer-based assays and methods for treating alzheimer's disease |
| US20140371098A1 (en) * | 2011-12-22 | 2014-12-18 | Protagen Ag | Marker sequences for breast cancer and the use thereof |
| US20160184454A1 (en) * | 2013-01-11 | 2016-06-30 | Asa Abeliovich | Rab7l1 interacts with lrrk2 to modify intraneuronal protein sorting and parkinson's disease risk |
| US20170191999A1 (en) * | 2014-05-29 | 2017-07-06 | University Of Leicester | Senescent Cell Biomarkers |
| US20180193414A1 (en) * | 2015-09-17 | 2018-07-12 | Coda Biotherapeutics, Inc. | Compositions and methods for treating neurological disorders |
| US20190241633A1 (en) * | 2016-05-04 | 2019-08-08 | Curevac Ag | Rna encoding a therapeutic protein |
Family Cites Families (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009108274A2 (en) * | 2008-02-26 | 2009-09-03 | The University Of North Carolina At Chapel Hill | Methods and compositions for adeno-associated virus (aav) with hi loop mutations |
| MX367100B (es) * | 2012-02-17 | 2019-08-05 | The Children´S Hospital Of Philadelphia | Composiciones del vector aav y metodos para su transferencia genetica a celulas, organos y tejidos. |
| US20160250182A1 (en) * | 2013-01-11 | 2016-09-01 | The Trustees Of Columbia University In The City Of | Rab7l1 interacts with lrrk2 to modify intraneuronal protein sorting and parkinson's disease risk |
| WO2018112446A2 (en) * | 2016-12-18 | 2018-06-21 | Selonterra, Inc. | Use of apoe4 motif-mediated genes for diagnosis and treatment of alzheimer's disease |
| BR112020006661A2 (pt) * | 2017-10-03 | 2020-10-13 | Prevail Therapeutics, Inc. | terapias de genes para distúrbios lipossomais |
| US20190345516A1 (en) * | 2018-03-12 | 2019-11-14 | Musc Foundation For Research Development | Methods for treating eye disease |
-
2020
- 2020-12-07 AU AU2020395327A patent/AU2020395327A1/en active Pending
- 2020-12-07 PH PH1/2022/551373A patent/PH12022551373A1/en unknown
- 2020-12-07 CN CN202080093935.2A patent/CN115297891A/zh active Pending
- 2020-12-07 WO PCT/US2020/063627 patent/WO2021113824A1/en not_active Ceased
- 2020-12-07 CA CA3160785A patent/CA3160785A1/en active Pending
- 2020-12-07 MX MX2022006895A patent/MX2022006895A/es unknown
- 2020-12-07 IL IL293599A patent/IL293599A/en unknown
- 2020-12-07 JP JP2022533615A patent/JP2023505271A/ja not_active Withdrawn
- 2020-12-07 EP EP20896932.9A patent/EP4069315A4/en active Pending
- 2020-12-07 CN CN202510180683.1A patent/CN120114618A/zh active Pending
- 2020-12-07 US US17/782,357 patent/US20230021959A1/en active Pending
- 2020-12-07 BR BR112022011073A patent/BR112022011073A2/pt unknown
- 2020-12-07 KR KR1020227022902A patent/KR20220152192A/ko active Pending
-
2025
- 2025-07-28 JP JP2025125690A patent/JP2025149978A/ja active Pending
Patent Citations (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20070099251A1 (en) * | 2005-10-17 | 2007-05-03 | Institute For Systems Biology | Tissue-and serum-derived glycoproteins and methods of their use |
| US20080214482A1 (en) * | 2005-11-15 | 2008-09-04 | Scott Small | Retromer-based assays and methods for treating alzheimer's disease |
| US20140371098A1 (en) * | 2011-12-22 | 2014-12-18 | Protagen Ag | Marker sequences for breast cancer and the use thereof |
| US20160184454A1 (en) * | 2013-01-11 | 2016-06-30 | Asa Abeliovich | Rab7l1 interacts with lrrk2 to modify intraneuronal protein sorting and parkinson's disease risk |
| US20170191999A1 (en) * | 2014-05-29 | 2017-07-06 | University Of Leicester | Senescent Cell Biomarkers |
| US20180193414A1 (en) * | 2015-09-17 | 2018-07-12 | Coda Biotherapeutics, Inc. | Compositions and methods for treating neurological disorders |
| US20190241633A1 (en) * | 2016-05-04 | 2019-08-08 | Curevac Ag | Rna encoding a therapeutic protein |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023159238A1 (en) * | 2022-02-21 | 2023-08-24 | The Scripps Research Institute | Mef2 transcriptional activators to treat neurologic conditions |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3160785A1 (en) | 2021-06-10 |
| AU2020395327A1 (en) | 2022-07-21 |
| BR112022011073A2 (pt) | 2022-09-20 |
| MX2022006895A (es) | 2022-11-09 |
| CN120114618A (zh) | 2025-06-10 |
| EP4069315A1 (en) | 2022-10-12 |
| KR20220152192A (ko) | 2022-11-15 |
| US20230021959A1 (en) | 2023-01-26 |
| JP2025149978A (ja) | 2025-10-08 |
| PH12022551373A1 (en) | 2023-05-08 |
| IL293599A (en) | 2022-08-01 |
| EP4069315A4 (en) | 2024-03-20 |
| CN115297891A (zh) | 2022-11-04 |
| JP2023505271A (ja) | 2023-02-08 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| ES2768763T3 (es) | Vectores rAAV mejorados y métodos para la transducción de fotorreceptores y células EPR | |
| JP7384797B2 (ja) | ムコ多糖症iiib型のための遺伝子療法 | |
| US20230104357A1 (en) | Combination of Retromer Pharmacological Chaperones and Exogenous Retromer for the Treatment of Alzheimer's Disease and Other Neurodegenerative Diseases and Disorders | |
| KR20210076051A (ko) | 간-특이적 유전자 대체 요법에 의한 중증 pku 치료를 위한 개선된 인간 pah의 생성 | |
| US20230174994A1 (en) | Engineered parkin and uses thereof | |
| US20210188927A1 (en) | Compositions and methods for treating age-related macular degeneration | |
| US20210371480A1 (en) | Compositions and methods for treating age-related macular degeneration and other diseases | |
| JP2023509443A (ja) | 改善されたaav-abcd1コンストラクトならびに副腎白質ジストロフィー(ald)および/または副腎脊髄ニューロパチー(amn)の処置または予防のための使用 | |
| JP2025149978A (ja) | アルツハイマー病および他の神経変性障害の処置のためのレトロマーの安定化 | |
| JP7253274B2 (ja) | Aav適合性ラミニン-リンカー重合タンパク質 | |
| US20230151390A1 (en) | Vectors for the treatment of acid ceramidase deficiency | |
| US20230407331A1 (en) | Miniaturized dystrophins having spectrin fusion domains and uses thereof | |
| US20250186621A1 (en) | Materials and methods for the treatment of eif2b5 mutations and diseases resulting therefrom | |
| US20260022402A1 (en) | Recombinant adeno-associated viral vector for gene delivery | |
| US20250144243A1 (en) | Aav capsids for improved heart transduction and detargeting of liver | |
| US20240189452A1 (en) | Recombinant Adeno-Associated Virus Encoding Methyl-CPG Binding Protein 2 for Treating PITT Hopkins Syndrome VIA Intrathecal Delivery | |
| EP4565705A2 (en) | Compositions and methods for modifying muller glial cells | |
| WO2024259064A1 (en) | Materials and methods for the treatment of neurofibromin 1 mutations and diseases resulting therefrom | |
| CN121195072A (zh) | 用于帕金森病的基因治疗载体 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20896932 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2022533615 Country of ref document: JP Kind code of ref document: A Ref document number: 3160785 Country of ref document: CA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112022011073 Country of ref document: BR |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020896932 Country of ref document: EP Effective date: 20220705 |
|
| ENP | Entry into the national phase |
Ref document number: 2020395327 Country of ref document: AU Date of ref document: 20201207 Kind code of ref document: A |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: 112022011073 Country of ref document: BR Free format text: APRESENTE O RELATORIO DESCRITIVO E O TITULO DA LISTAGEM DE SEQUENCIAS EM LINGUA VERNACULA. |
|
| ENP | Entry into the national phase |
Ref document number: 112022011073 Country of ref document: BR Kind code of ref document: A2 Effective date: 20220606 |