WO2021081133A1 - Engineered natural killer cells and methods for using the same in immunotherapy and autophagy inhibition techniques - Google Patents

Engineered natural killer cells and methods for using the same in immunotherapy and autophagy inhibition techniques Download PDF

Info

Publication number
WO2021081133A1
WO2021081133A1 PCT/US2020/056723 US2020056723W WO2021081133A1 WO 2021081133 A1 WO2021081133 A1 WO 2021081133A1 US 2020056723 W US2020056723 W US 2020056723W WO 2021081133 A1 WO2021081133 A1 WO 2021081133A1
Authority
WO
WIPO (PCT)
Prior art keywords
cells
cell
binding domain
fragment
gbm
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/056723
Other languages
English (en)
French (fr)
Inventor
Sandro MATOSEVIC
Jiao Wang
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Purdue Research Foundation
Original Assignee
Purdue Research Foundation
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Purdue Research Foundation filed Critical Purdue Research Foundation
Priority to AU2020371628A priority Critical patent/AU2020371628A1/en
Priority to CA3155246A priority patent/CA3155246A1/en
Priority to EP20879537.7A priority patent/EP4048292A4/en
Priority to JP2022523383A priority patent/JP2022553292A/ja
Priority to US17/770,585 priority patent/US20220362299A1/en
Publication of WO2021081133A1 publication Critical patent/WO2021081133A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/15Natural-killer [NK] cells; Natural-killer T [NKT] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4224Molecules with a "CD" designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4256Tumor associated carbohydrates
    • A61K40/4258Gangliosides, e.g. GM2, GD2 or GD3
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2207/00Modified animals
    • A01K2207/12Animals modified by administration of exogenous cells
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2227/00Animals characterised by species
    • A01K2227/10Mammal
    • A01K2227/105Murine
    • AHUMAN NECESSITIES
    • A01AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01KANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
    • A01K2267/00Animals characterised by purpose
    • A01K2267/03Animal model, e.g. for test or diseases
    • A01K2267/0331Animal model for proliferative diseases
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/27Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
    • A61K2239/28Expressing multiple CARs, TCRs or antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/47Brain; Nervous system
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • This disclosure relates in general to the field of cancer therapies and treatments and, more particularly, to multifunctional immunotherapies that utilize natural killer (NK) cells engineered to bear multiple anti-tumor functions and address key drivers of cancer resistance, and in particular glioblastoma resistance, to therapies.
  • NK natural killer
  • GBM Glioblastoma
  • GBM patients tend to be poorly responsive to traditional treatments and GBM has the worst prognosis of any central nervous system malignancy.
  • survival rates have only modestly improved over the past several decades, with a median survival of approximately one year. Indeed, of the conventional treatments tested to date, all have failed to improve GBM patient overall survival in phase III clinical trials and a cure for GBM does not exist. Reasons for this failure are multifactorial.
  • GBM is highly infiltrative and invasive by nature, and therapy for GBM is difficult due to its biological location in the brain, the blood brain barrier, and neural parenchyma. Further, the heterogeneity of GBM, along with the complex interactions among different cells within as well as cells surround the tumor, have been appointed as one of the main causes of therapeutic resistance and malignant relapse.
  • GBM subtypes classical, mesenchymal, neural and proneural
  • GSCs glioma stem-like cells
  • a subpopulation of GMB cells also contribute to treatment resistance.
  • GSCs are capable of demonstrating self-renewal capacity, multi-potency, and induction of tumorigenesis, and are increasingly being recognized as a driving force supporting glioma genesis, resistance to therapy and aggressive recurrence. This is at least in part due to the failure of conventional therapies to eliminate specific GSC subpopulations.
  • these cells are poorly recapitulated by conventional GBM model cell lines (including U87MG) which hinders the study of GMB.
  • GBM progression is also promoted by autophagy - a highly controlled catabolic regulator of cellular energetic balance.
  • cells utilize basal levels of autophagy to aid in the maintenance of biological function, homeostasis, quality -control of cell contents, and elimination of old proteins and damaged organelles.
  • authophagy can facilitate tumorigenesis by promoting cancer-cell proliferation and tumor growth.
  • autophagy can support GBM metabolism, survival in hypoxia, progression and resistance to therapy.
  • Beclin-1 encoded by the BECN1 gene, has a central role in the promotion of autophagy.
  • GBM expresses multiple immune checkpoints which can either participate in antigen evasion or drive immunosuppression.
  • One of these is ecto-5'-nucleotidase (CD73), a surface enzyme expressed on multiple cells (including both infiltrating immune cells and tumor cells) that mediates the gradual hydrolysis of ATP and ADP to anti-inflammatory adenosine and is upregulated in GBM.
  • CD73 in association with CD39, induces the production of extracellular adenosine from adenosine 5'-triphosphate (ATP).
  • Adenosine in turn, binds to adenosine receptors on natural killer (NK) cells, resulting in significant immunometabolic dysregulation of NK cell activity.
  • NK natural killer
  • hypoxic tumor microenvironment TME
  • TME hypoxic tumor microenvironment
  • ATP adenine nucleotides
  • ADP adenosine diphosphate
  • intratumoral extracellular ATP concentrations can be up to 1 ,000 times higher than those in normal tissues of the same origin cell. These conditions contribute to the dysregulation of NK cells and, thus, suppression of NK cell anti-tumor surveillance and immunity which fuels the tumor’s invasiveness.
  • NK cells are unique and play pivotal functions in cancer immunity surveillance. Unlike T cells that only detect major histocompatibility complex (MHC) presented on infected cell surfaces, NK cell function is driven by a balance of activating and inhibitory receptors through which they interact with pathogens and recognize MHC class I molecules on cancer cells. NK cells can eliminate a variety of abnormal or stressed cells without prior sensitization and even preferentially kill stem-like cells or cancer stem cells. Upon forming immune synapses with target cells, NK cells release cytokines that induce cell lysis. However, GBM employs various tactics to delay, alter, or even stop immune suppressive pathways to prevent the malignant cells from being recognized as dangerous or foreign. These mechanisms prevent the cancer from being eliminated by the immune system, leading to failures in the control of tumor growth and allowing for disease to progress from a very early stage to a lethal state.
  • MHC major histocompatibility complex
  • GBM Alongside GBM-induced functional inhibition of NK cell responses, the downregulation or mutation of target antigens is commonly observed in GBM and also contributes to immune evasion and resistance to treatment.
  • conventional adoptive transfer T cell therapy strategies including dual antigen-targeting or programmable, tumor-sensing chimeric antigen receptors (CARs) have been evaluated pre-clinically to combat such evasion, GBM employs mechanisms beyond antigen escape to avoid targeting.
  • Antigen escape results in decreased efficacy of cell-based antigen-specific monotherapy and is triggered by mechanisms including differential splicing, missense mutations, or lineage switch. Indeed, outgrowth of antigen escape variants has been observed in all clinical studies to date with most GBM-specific and GBM- associated antigens.
  • the present disclosure describes the development of novel immunotherapies that target multiple immune evasion mechanisms in GBM.
  • the compositions, systems, and methods hereof combine, for the first time, genetically-engineered natural killer (NK) cells designed to target two or more GBM antigens at once, while also releasing an antibody to block CD73 activity.
  • the present disclosure further combines this cell-based immunotherapy with a small molecule autography inhibitor, for example and without limitation chloroquine.
  • a small molecule autography inhibitor for example and without limitation chloroquine.
  • the use of an autography inhibitor in this context results in further GBM inhibition, as well as the secretion of chemokines that attract NK cells to further infiltrate GBM and enhance overall therapy effectiveness.
  • the compositions, systems and methods of the present disclosure can restrict GBM escape from immune surveillance and promote recruitment of NK cells to the tumor, thus resulting in sustained anti-GBM responses.
  • polynucleotide constructs are provided herein.
  • such constructs comprise: a first sequence encoding at least a first binding domain or fragment thereof operatively linked to a second sequence encoding at least a second binding domain or fragment thereof.
  • the first binding domain or fragment thereof comprises a NK activating receptor or a first protein specific for a first cancer-associated antigen
  • the second binding domain or fragment thereof is specific for an adenosine producing cell surface protein of the target cell or an adenosine- intermediary producing cell surface protein of the target cell.
  • the first domain may optionally further encode a hinge domain ( e.g and without limitation, a linker or a spacer), one or more self cleaving peptides (e.g.
  • the second binding domain/fragment further comprises a cleavable linker operably linked to the first binding domain.
  • the cleavable linker is configured to be cleavable by one or more proteases present in the target cell and/or tumor microenvironment (TME) (such proteases are widely known and understood in the art including, without limitation, lysosomal cysteine proteases, serine protease (such as trypsin), aspartate proteases, threonine proteases, and matrix metalloproteases).
  • TME tumor microenvironment
  • the second binding domain comprises an antibody fragment specific for CD73, CD39, or CD38 and, optionally, may comprise a single chain antibody fragment (scFv).
  • Exemplary embodiments of the construct further comprise a third sequence encoding at least a third binding domain or fragment thereof.
  • Such third binding domain/fragment comprises aNK activating receptor or a second protein specific for a second cancer-associated antigen.
  • the first binding domain or fragment thereof may comprise a first protein specific for a cancer-associated antigen
  • the third binding domain or fragment thereof may comprise an NK activating receptor (e.g., and without limitation, natural killer group 2 member D receptor (NKG2D), NKp30, NKp46, NKp40, or DNAM-1).
  • the first sequence encodes a first amino acid that is at least 90% identical to SEQ ID NO: 7 and the third sequence encodes a second amino acid that is at least 90% identical to SEQ ID NO: 6.
  • the cancer-associated antigens of the present disclosure may include one or more of, without limitation, isialoganglioside (GD2), ganglioside G3 (GD3), Her 2 (pl85), CD19, CD20, CD56, CD123, CD22, CD30, CD33, CD171, CS-1, C-type lectin-like molecule- 1; EpCAM, G250, proteoglycans, GD3, GD2, MHC II, TAG-72, milk mucin core protein, Lewis A antigen, tyrosine-protein kinase transmembrane receptor (ROR1), c-met, epidermal growth factor receptor (EGFR), EGFR variant III, and/or carcinoembryonic antigen (CEA).
  • the first cancer-associated antigen may comprise one type of antigen
  • the second cancer-associated antigen may comprise the same or a different type of antigen, as desired.
  • the first and/or third binding domain or fragment thereof comprises an extracellular ligand-binding domain comprising a NKG2D and the respective sequence further encodes upregulated expression of the NKG2D as compared to expression of NKG2D in a wild-type NK cell.
  • the second binding domain or fragment thereof may comprise an anti-CD73, an anti-CD39, or an anti-CD38 linked with a scFv
  • the first and/or third binding domain or fragment thereof may comprise an anti- GD2 linked with a scFv.
  • the first sequence may be expressed in a first chimeric antigen receptor (CAR) and the second sequence is expressed in a second CAR.
  • the target cell may be a cancer cell, a malignant cell in a TME and, in at least one exemplary embodiment, the target cell is a glioblastoma cell or a glioblastoma TME.
  • one or both of the first and third sequences may additionally encode one or more signaling domains for promoting cytotoxic or cytolytic activity upon activation. There, such signaling domains are activated upon the binding domain or fragment thereof operably linked thereto binding the target cell.
  • the one or more signaling domains may be selected from a group consisting of an immunoglobulin g-Fc region receptor III-A (FcyRIIIA), a cluster of differentiation 28 (CD28), a tumor necrosis factor receptor superfamily member 9 (TNFRSF9 or 4-1BB), a tumor necrosis factor receptor superfamily member 4 (TNFRSF4 or 0X40), a Fas ligand (FasL), a TNF-related apoptosis-inducing ligand (TRAIL), DNAX-activating protein 10 (DAP10), DNAX-activating protein 12 (DAP12), natural cytotoxicity receptor NKp46, natural cytotoxicity receptor NKp44, natural cytotoxicity receptor NKp30, lymphocyte function- associated antigen 1 (LFA-1), cluster of differentiation 244 (CD244), CD137, CD3 zeta (0 ⁇ 3z) and aNKG2D-DAP10 receptor complex.
  • FcyRIIIA immunoglobulin g-Fc
  • Engineered cells or engineered cell lines are also provided herein.
  • an engineered cell or engineered cell line is provided that expresses any one of the polynucleotide constructs disclosed herein.
  • the engineered cell or engineered cell line may comprise the first sequence that further encodes a hinge domain operably linked to and positioned between the first binding domain or fragment thereof and a signaling domain encoded thereby.
  • the engineered cell or cell line expresses an amino acid sequence that is at least 80%, 85% or 90% identical to SEQ ID NO: 8.
  • compositions comprising a population of the engineered cells of the present disclosure.
  • one or more signaling domains may be activated upon the binding domain or fragment thereof operably linked thereto binding the target cell, such as for example and without limitation, a cancer or glioblastoma tumor cell.
  • the pharmaceutical composition may comprise a pharmaceutically acceptable carrier and/or any pharmaceutically acceptable diluents, adjuvants, excipients, or vehicles, such as preserving agents, fillers, disintegrating agents, wetting agents, emulsifying agents, suspending agents, sweetening agents, flavoring agents, perfuming agents, antibacterial agents, antifungal agents, lubricating agents, and dispensing agents (depending on the nature of the mode of administration and dosage forms).
  • preserving agents such as preserving agents, fillers, disintegrating agents, wetting agents, emulsifying agents, suspending agents, sweetening agents, flavoring agents, perfuming agents, antibacterial agents, antifungal agents, lubricating agents, and dispensing agents (depending on the nature of the mode of administration and dosage forms).
  • Such a method comprises administering, or having administered, to a subject a therapeutically effective amount of a pharmaceutical composition comprising a population of engineered NK cells expressing a polynucleotide construct encoding at least: a first binding domain or fragment thereof comprising an NK activating receptor or a first protein specific for a first cancer-associated antigen, and a second binding domain or fragment thereof and a cleavable linker, the second binding domain specific for an adenosine-producing or adenosine-intermediary-producing cell surface protein of a target cell and the cleavable linker operably linked to the first binding domain.
  • the polynucleotide construct may further encode a third binding domain or fragment thereof comprising a NK activating receptor or a second protein specific for a second cancer-associated antigen.
  • the first binding domain or fragment thereof may comprise a first protein specific for a cancer-associated antigen and the third binding domain or fragment thereof comprises an NK activating receptor and the third binding domain or fragment thereof (or vice versa).
  • the polynucleotide construct may additionally encode one or more signaling domains operably linked to the first and/or third binding domain(s)/fragment(s) to promote cytotoxic or cytolytic activity of the engineered NK cells upon activation.
  • the step of administering (or having administered) a therapeutically effective amount of the pharmaceutical composition may be performed intravenously, intratumorally, parenterally, or via infusion. Additionally or alternatively, the step of administering, or having administered, to a subject a therapeutically effective amount of a pharmaceutical composition may comprise performing, or having performed, adoptive cell therapy. Such methods may employ a population of engineered NK cells express an amino acid sequence that is at least 80%, 85%, or 90% identical to SEQ ID NO: 8.
  • the cancer may be glioblastoma.
  • the first binding domain or fragment thereof may comprise a first protein specific for GD2
  • the third binding domain or fragment thereof may comprise an extracellular ligand-binding domain comprising a NKG2D
  • the third binding domain or fragment thereof may be specific for CD73, CD39, or CD38.
  • the method may further comprise administering, or having administered, to the subject an additional therapeutic treatment comprising an autophagy inhibitor.
  • autophagy inhibitor may be, for example and without limitation, a therapeutically effective amount of a small molecule inhibitor and/or the genetic downregulation of a gene in the autophagy pathway (such as, for example, BECN1, p62, b-actin, ATG5, ATG7, LC3B, ATG12, ATG16L1 PI3K-III, ULK1, ULK2, FIP200, and/or LAMP 2).
  • Non-limiting examples of such small molecule inhibitors may comprise chloroquine, hydroxychloroquine, spautin-1, SAR405, vertoprofm, and any other pharmaceutical autophagy inhibitor or down-regulator now known or hereinafter discovered.
  • the autophagy inhibitor comprises chloroquine which, optionally, may be administered at a concentration of between 0.01 mM and 200 mM.
  • the steps of administering (or having administered) to a subject a therapeutically effective amount of a pharmaceutical composition may be performed intravenously, intratumorally, parenterally, or via infusion, and the step of administering, or having administered, to the subject an additional therapeutic treatment may be performed via systemic injection or infusion.
  • Kits for treating a subject experiencing glioblastoma are also provided.
  • such kits may comprise a therapeutically effective amount of the pharmaceutical composition of the present disclosure; and a therapeutically effective amount of an autophagy inhibitor (whether a pharmaceutical inhibitor, such as a small molecule inhibitor or otherwise) or a composition to achieve the genetic downregulation of the autophagy pathway).
  • the autophagy inhibitor in the kit comprises a small molecule inhibitor
  • the inhibitor may be selected from a group consisting of chloroquine, hydroxychloroquine, spautin-1, SAR405, and vertoprofm.
  • Figure 1 results from the correlative analysis of gene expression in glioblastoma (GBM) patient data, surface expression of CD73, GD2, and NKG2DL in patient-derived GBM, and illustrate the design of the multifunctional NK-based GBM immunotherapy, with subpart A showing the correlation between normalized expression (FPKM) of selected genes using data from 156 GBM patients (Pearson's correlation coefficients are shown with continuous gradient colors); subpart B showing the correlation between normalized expression (FPKM) of the entire NK gene set and individual genes (correlation expressed as normalized enrichment scores (NES); subpart C showing a Venn diagram representing the number of GBM patients with high expression of at least one of the identified 4 genes: NT5E, B4GALNT1, MICA and MICB; subpart D showing a bar graph representing the patient distribution of gene expression in GBM tumors based on the four genes in identified in subpart C; subpart E showing data regarding surface expression of CD73, GD2 and NKG2DL on different types of patient-derived G
  • Figure 2 shows graphical data relating to the effects of adenosine on pNK cell viability and activating marker expression, with subpart A showing graphical data related to cell viability (%) of pNK cells after treatment with 1000 mM of adenosine for 24 h; and subpart B showing graphical data related to NKG2D expression on pNK cells after treatment with 1000 pM of adenosine for 24 h (data are shown as mean ⁇ SEM);
  • Figure 3 shows in silico modeling of the structure of certain constructs of the present disclosure, with subpart A showing a molecular model of tandem anti-GD2 and anti-CD73 scFv extracellular domains linked together via a GS spacer and a cleavable peptide linker (identified by the arrow), the model obtained based on vector sequences using RaptorX, and subpart B showing the docking of extracellular scFv domains with GD2 (indicated by the dashed circle), with docking performed using PatchDock and refined in FireDock using a model of the entire extracellular region shown in subpart A and the cleavable peptide indicated by the arrow (images generated in Chimera);
  • Figure 4 shows a schematic representation of at least one embodiment of a multifunctional construct according to at least one embodiment of the present disclosure;
  • Figure 5 shows graphical data related to the generation of multifunctional genetically- engineered NK cells of the present disclosure, with subpart A shows a schematic representation of a transgene for a NKG2D.DAP 10 ⁇ 3z- €A11 construct (Construct IB) pursuant to the present disclosure that targets NKG2D ligands (NKG2DL), and subpart B showing a schematic representation of the structure of Construct IB; subpart C shows graphical data related to cell viability (%) of NK cells engineered to express Construct IB pursuant to the present disclosure (NKG2D.CAR-NK92), or non-engineered controls (NK92), 48 hours after transfection; subpart D shows NKG2D expression determined by flow cytometry on transfected cells of subpart C; subpart E shows data related to the in vitro cytotoxicity of the cells of subpart C (NKG2D.CAR- NK92) and non-transfected NK-92 cells (NK92) against GBM43 cells at an E/T ratio of 5
  • Figure 6 shows graphical data related to studies on primary NK cells, with subparts A-D and E-H showing the data for the pNK cells isolated from two separate donors, respectively, where the characterization and expression measurements investigated as described in connection with Example 1 (data shown as mean ⁇ SEM. *p ⁇ 0.05, **p ⁇ 0.0);
  • Figure 7 shows graphical data related to in vitro effector activity of multifunctional genetically-engineered NK cells according to at least one embodiment of the present disclosure against patient-derived GBM, where subpart A shows the in vitro cytotoxicity of NK-92 (control) and CD73.mCAR-NK92 cells (expressing Construct 1) against GBM43 cells at indicated E/T ratios over 4 h; subpart B shows bar graphs representative of the degranulation of NK-92 and CD73.mCAR-NK92 cells [% CD107 and (MFI) CD107] after 4 h coculture with GBM43 cells (E/T ratio, 5:1) (NK cells were analyzed by flow cytometry for surface CD 107a expression as a marker of degranulation); subpart C shows IFN-g production by NK-92 and CD73.mCAR-NK92 cells (% IFN-g) after 4 h coculture with GBM43 cells (E/T ratio, 5:1); subpart D shows in vitro cytotoxicity of CD73.mCAR-
  • Figure 8 shows a schematic diagram of the reaction employed to detect phosphate formation by CD73 (subpart A), and a phosphate standard curve in a 96-well plate, where the OD value at 620 nm was read after a 30 min incubation (subpart B);
  • Figure 10 shows data relating to the surface expression of CD73, GD2, and NKG2DL on hCMEC/D3 and HCN-2 cells, with expression levels of the three markers on normal brain cell lines determined by flow cytometry and reported as fold-change (FC) overcontrol; data shown as mean ⁇ SEM;
  • Figure 11 shows graphical data related to the inhibition of autophagy in GBM cells either through BECN1 gene knockdown or pharmacological treatment with CQ, where subpart A shows data from GBM43 cells transfected with BECN1 shRNA (h) lentiviral particles or treated with 50 pM of CQ for 24 h and, thereafter, the cells were lysed and expression levels of BECN1, LC3B, and p62 were analyzed via flow cytometry (with b-actin used as the loading control), and subpart B shows the quantification of relative expression levels of BECN1 (BECN 1 Zb-actin), LC3B (LC3B/ - actin), and p62 (r62/b-hoRh) (noting that Beclin 1 ( BECNI ), LC3-II ( LC3B ) and p62 are the three primary markers of autophagy);
  • subpart A shows data from GBM43 cells transfected with BECN1 shRNA (h) lentiviral particles or treated with 50
  • Figure 12 shows data relating to the effects of targeting autophagy in GBM on NK cell function and homing, where subpart A represents the viability of GBM43 cells after treatment with various concentrations of CQ for 24 h in vitro, ⁇ subpart B shows cell viabilities (%)plotted versus the Log [CQ concentration (pM)] with the IC50 computed using Prism 5 (GraphPad Software Inc., California); subparts C and D show expression of CCL5 and CXCL10 mRNA in GBM43 cells transfected with BECNI shRNA lentivirus ( BECNE GBM43) or in cells treated with CQ (results reported as a fold-change (FC) compared to non-transfected controls; subparts E and F show quantification by ELISA of CCL5 and CXCL10 in the supernatant of GBM43 cells following treatment with CQ for 24 h in the presence or absence of various inhibitors, including LY294002, BAY11-7082 and SP600125; subpart
  • subpart K shows data from tumor growth being monitored and recorded on the indicated days
  • subpart M shows a quantification ofNK cells infiltrating control and BIB / tumors, with cell counts were recorded in 4 consecutive high-power fields (HPFs) at 200x magnification
  • subparts N and O graph the IHC scores of CCL5 and CXCL10 in control and BIB / tumors (Note: the data shown in subpart H is for isolated pNK cells from one representative donor in at least triplicates); data are shown as mean ⁇ SEM; *p ⁇ 0.05, **p
  • Figure 13 shows graphical data relating to chemokine expression in response to inhibition of autophagy on GBM, where expression of CCL2 and CXCL12 mRNA in BECNE GBM43 or CQ-treated GBM43 cells determined by RT-PCR, GAPDH used as the reference gene (control) and results reported as a FC over control; data shown as mean ⁇ SEM; *p ⁇ 0.05, **p ⁇ 0.01;
  • Figure 14 relates to the use of ELISA array to test concentrations of different types of chemokines in GBM43 cultured medium, with subpart A showing a schematic diagram of the whole experimental process and subpart B showing the determined concentrations of each tested chemokine;
  • subpart A shows immunohistochemical (IHC) staining of mouse (Ragl ) NK cells performed on indicated GBM43 (control) subcutaneous xenograft tumor sections
  • subpart B shows IHC staining of mouse (Ragl ) NK cells performed on indicated BECNE GBM43 subcutaneous xenograft tumor sections, with the IHC staining indicating an enhanced infiltration of NK cells into both peripheral and internal regions of the tumor tissues of BECNE GBM43 subcutaneous xenograft tumors;
  • Figure 16 is graphical data related to the sensitization of GBM cells to NK cell-mediated killing following targeting of autophagy, where subpart shows NKG2DL expression (MFI and %) on GBM43 cells after 24 h treatment with various concentrations of CQ; subpart B shows CD73 expression (MFI and %) on GBM43 cells after 24 h treatment with various concentrations of CQ; subpart C shows CD73 activity of GBM43 cells after treatment with various concentrations of CQ for 24 h; subpart D shows GD2 expression (MFI and %) on GBM43 cells after 24 h treatment with various concentrations of CQ; subpart E shows killing activity of pNK cells against GBM43 cells after treatment with different concentrations of CQ for 24 h; subpart F shows killing activity of NK92 cells and pNK cells against BECNT GBM43 cells after 4 h co-incubation at an E/T ratio of 5; all data in Figure 16 are shown in at least triplicates from one representative donor; data are shown as mean ⁇ SEM; *p
  • Figure 18 shows data relating to the generation of luciferase-expressing GBM43 (GBM43- Luc) cells, where GBM43 cells were transfected with commercial luciferase (Luc) lentiviral particles expressing a firefly luciferase 3 gene under an inducible suCMV promoter, puromycin- resistant cells were collected following transduction, and luciferase expression was detected by bioluminescence measurement using an IVIS spectrum, with subpart A showing a representative bioluminescence image indicating the ability of GBM43-Luc cells to express luciferase (signal intensity as a function of cells seeded is shown); subpart B shows graphical data representative of fluorescence intensity as a function of GBM43-Luc cell number (Total flux (photons/sec) quantified using AURA software); subpart C showing growth curves of the GBM43-Luc and parental control GBM43 cells (Data shown as mean ⁇ SEM); and
  • SEQ ID NO: 1 is an amino acid sequence of a protease-sensitive linker as follows: GGGGS GGGGS GGGGS ;
  • SEQ ID NO: 2 is an amino acid sequence of a cleavable peptide fragment as follows: LSGRSDNH;
  • SEQ ID NO: 3 is an amino acid sequence of a “self-cleaving” P2A peptide as follows:
  • SEQ ID NO: 4 is a nucleic acid sequence of a primer as follows: ACATCGCTCAGACACCATG;
  • SEQ ID NO: 5 is a nucleic acid sequence of a primer as follows: T GT AGTT GAGGT C A AT GAAGGG; and
  • SEQ ID NO: 6 is an artificial amino acid sequence of at least one embodiment of an antigen binding domain or fragment thereof of the present disclosure that comprises a natural killer group 2 member D receptor (NKG2D) (hCD3zeta-hNKG2D-P2A-hDAP 10/Flag): MRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNP QEGLYNELQKDKMAEAY SEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALP PRGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCC FIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESK NWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILS PNLLTIIEMQKG
  • SEQ ID NO: 7 is an artificial amino acid sequence of at least one embodiment of an antigen binding domain or fragment thereof of the present disclosure that specifically binds the cancer- associated antigen disialoganglioside (GD2) and comprises a scFv (anti-GD2 scFv-CD8H- hCD28-hCD3zeta):
  • SEQ ID NO: 8 is an artificial amino acid sequence of at least one embodiment of a CAR construct of the present disclosure comprising a first antigen binding domain or fragment thereof that specifically binds the cancer-associated antigen GD2 (SEQ ID NO: 7) operably linked to a second binding domain or fragment thereof specific for CD73 via a cleavable linker, and a third antigen binding domain or fragment thereof comprising NKG2D (SEQ ID NO: 6) (anti-CD73 scFv-linker-cleavable peptide-linker-GD2.CAR-NKG2D.CAR):
  • the term “about” can allow for a degree of variability in a value or range, including a range of values plus or minus 10% for percentages and plus or minus 1.0 unit for unit values, for example, about 1.0 refers to a range of values from 0.9 to 1.1, or of a stated limit of a range.
  • the term “substantially” can allow for a degree of variability in a value or range as well, for example, within 90%, within 95%, or within 99% of a stated value or of a stated limit of a range.
  • a “subject” or “patient” as the terms are used herein is a mammal, preferably a human, and is inclusive of male, female, adults, and children.
  • Nucleic acid refers to deoxyribonucleotides or ribonucleotides and polymers thereof in either single- or double-stranded form and complements thereof.
  • the term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, that are synthetic, naturally occurring, and non-naturally occurring, have similar binding properties as the reference nucleic acid, and metabolized in a manner similar to the reference nucleotides.
  • polypeptide “peptide,” and “protein” are used interchangeably herein (unless expressly stated otherwise) to refer to a polymer of amino acid residues, a polypeptide, or a fragment of a polypeptide, peptide, or fusion polypeptide.
  • the terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non- naturally occurring amino acid polymers.
  • adenosinergic means working on adenosine.
  • antibody fragment as used herein means a portion of an intact antibody, preferably the antigen-binding or variable region of the intact antibody.
  • antibody fragments include, for example, single-chain antibody molecules (scFv), nanobodies, F(ab')2, F(ab)2, Fab', Fab, Fv, or dAb.
  • scFv single-chain antibody molecules
  • an antibody fragment as used herein binds with the same antigen that is recognized by the full-length antibody.
  • antibody fragments include isolated fragments consisting of the variable regions, such as the “Fv” fragments consisting of the variable regions of the heavy and light chains or recombinant single chain polypeptide molecules in which light and heavy variable regions are connected by a peptide linker (“scFv proteins”).
  • Single-chain antibodies often abbreviated as “scFv” consist of a polypeptide chain that comprises both a VH and a VL domain which interact to form an antigen-binding site.
  • the VH and VL domains are usually linked by a peptide of 1 to 25 amino acid residues.
  • Antibody fragments also include diabodies, triabodies, and single domain antibodies (dAb). While in the present disclosure reference is made to antibodies and various properties of antibodies, the disclosure applies to functional antibody fragments as well unless expressly noted to the contrary.
  • CARs Chimeric antigen receptors
  • chimeric T cell receptors are synthetic constructs designed to be expressed in host T cells or NK cells and to induce an immune response against a specific target antigen (e.g., CD39/CD79) and cells expressing that antigen.
  • the CAR typically comprises an antibody fragment, such as a single chain antibody (scFv) or Fab fragment, incorporated in a fusion protein that also comprises additional components, such as a 0 ⁇ 3-z or CD28 transmembrane domain and selective T-cell activating moieties, including the endodomains of CD3 ⁇ , CD28, 0X40, 4-1BB, Lck, and/or ICOS.
  • additional components such as a 0 ⁇ 3-z or CD28 transmembrane domain and selective T-cell activating moieties, including the endodomains of CD3 ⁇ , CD28, 0X40, 4-1BB, Lck, and/or ICOS.
  • additional components such as a 0 ⁇ 3-z
  • CARs may also be designed to transduce activation signals via co-stimulatory domains such as those utilizing immunoreceptor activation motifs (ITAMs) present in the cytoplasmic tails.
  • ITAMs immunoreceptor activation motifs
  • Gene constructs utilizing an antigen-binding moiety afford the additional advantage of being “universal” in that they bind native antigen on the target cell surface in an human leukocyte antigen (HLA)-independent fashion and therefore do not need to be collected from a patient or a specific HLA-matched donor.
  • HLA human leukocyte antigen
  • a CAR according to the embodiments of the present disclosure can be produced by any means known in the art, though preferably it is produced using recombinant DNA techniques.
  • a nucleic acid sequence encoding the several regions of the CAR can be prepared and assembled into a complete coding sequence by standard techniques of molecular cloning (genomic library screening, PCR, primer-assisted ligation, scFv libraries from yeast and bacteria, site-directed mutagenesis, etc.).
  • the resulting coding region can be inserted into an expression vector and used to transform a suitable expression host allogeneic or autologous NK cells.
  • transduction or transfection can be performed to introduce the CAR expression constructs into NK cells, which may then be used to induce an immune response in the subject.
  • the CRISPR/Cas9 genome editing technology and the like may also be employed to knockdown particular genes. Techniques for genetic manipulation of NK cells for cancer immunotherapy are generally known in the art.
  • CAR-NK cells may contain a targeting molecule, such as a scFV or Fab, that binds to a disease associated antigen (TAA) or to a hapten on a targetable construct.
  • TAA disease associated antigen
  • the cell-targeting scFv or Fab may be linked via a transmembrane domain to one or more intracellular signaling domains to effect lymphocyte activation.
  • Signaling domains used with CAR-NK cells may include, for example, O ⁇ 3-z, CD28, and the like.
  • the CAR constructs of the present disclosure may include any such constructs known in the art. A wide variety of CAR constructs have been reported and are commercially available.
  • an “antigen binding domain or fragment thereof’ or a “binding domain or fragment thereof’ of the present disclosure “that binds” a target of interest is one that binds the antigen/target with sufficient affinity such that the protein, binding domain, or engineered cell is useful as a diagnostic and/or therapeutic agent in targeting a protein or a cell or tissue expressing the antigen.
  • the term “specific binding” or “specifically binds to” or is “specific for” a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction.
  • Specific binding can be measured, for example, by determining by competition with a control molecule that is similar to the target.
  • “specifically binds” refers to binding of the antigen binding domain to its specified adenosine-producing enzyme target receptors (e.g., CD73 or CD39) and not other specified non target receptors.
  • Nucleic acid is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
  • DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • “operably linked” means that the DNA sequences being linked are contiguous and, in the case of leader, contiguous and in a reading phase. However, enhancers do not necessarily have to be contiguous. Linking may be accomplished by ligation at convenient restriction sites. If such sites do not exist, synthetic oligonucleotide adaptors or linkers may be used in accordance with conventional practice.
  • Percent (%) amino acid sequence identity with respect to a reference to a polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieve din various ways that are within the skill of the art, for instance, using publicly available computer software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • Downregulation or “down-regulated” may be used interchangeably and refer to a decrease in the level of a marker, such as a gene, nucleic acid, metabolite, transcript, enzyme, protein, or polypeptide, as compared to an established level (e.g., that of a healthy cohort or the subject of interest).
  • Upregulation or “up-regulated” or “overexpressed” may also be used interchangeably and refer to an increase in the level of a marker, such as a gene, nucleic acid, metabolite, transcript, protein, enzyme, or polypeptide, as compared to an established level (e.g., that of a healthy control or the subject of interest).
  • CD73 may be overexpressed in a patient experiencing a solid tumor or other cancer as compared to a healthy control.
  • a NK T cell may be engineered to upregulate the expression of NKG2D of the engineered T cell.
  • a “marker” or “biomarker” as the terms are used herein may be described as being differentially expressed when the level of expression in a subject who is experiencing an active disease state is significantly different from that of a subj ect or sample taken from a healthy subj ect.
  • a differentially expressed marker may be overexpressed or underexpressed as compared to the expression level of a normal or control sample or subjects’ baseline (i.e. downregulated).
  • the increase or decrease, or quantification of the markers in a biological sample may be determined by any of the several methods known in the art for measuring the presence and/or relative abundance of a gene product or transcript.
  • the level of markers may be determined as an absolute value, or relative to a baseline value, and the level of the subject’s markers compared to a cutoff index. Alternatively, the relative abundance of the marker or markers may be determined relative to a control, which may be a clinically normal subject.
  • treatment or “therapy” as used herein (and grammatical variations thereof such as “treat, “treating,” and “therapeutic”) include curative and/or prophylactic interventions in an attempt to alter the natural course of the individual being treated. More particularly, curative treatment refers to any of the alleviation, amelioration and/or elimination, reduction and/or stabilization (e.g., failure to progress to more advanced stages) of a symptom, as well as delay in progression of a symptom of a particular disorder.
  • Prophylactic treatment refers to any of the following: halting the onset, reducing the risk of development, reducing the incidence, delaying the onset, reducing the development, and increasing the time to onset of symptoms of a particular disorder.
  • Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of a disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • compositions of the present disclosure are used to delay development of a disease and/or tumor, or to slow (or even halt) the progression of a disease and/or tumor growth.
  • anti-tumor effective amount refers to an effective amount of construct-expressing NK cells to reduce cancer cell or tumor growth or to decrease tumor volume or number of tumor cells in a subject. “An anti -tumor effective amount” can also refer to an effective amount of engineered NK cells or an engineered NK cell line to increase life expectancy or to alleviate physiological effects associated with the tumor or cancer.
  • terapéuticaally effective dose means (unless specifically stated otherwise) a quantity of a polypeptide and/or engineered cells of the present disclosure which, when administered either one time or over the course of a treatment cycle, affects the health, wellbeing or mortality of a subject (e.g., and without limitation, a diminishment or prevention of effects associated with a cancerous condition).
  • a dosage or amount of a polypeptide, engineered cells, or other compound to be administered to a subject for treating a disease, condition, or disorder will vary according to several factors including the type and severity of condition being treated, how advanced the disease pathology is, the formulation of the composition, patient response, the judgment of the prescribing physician or healthcare provider, whether one or more constructs are being administered, the route of administration, and the characteristics of the patient or subject being treated (such as general health, age, sex, body weight, and tolerance to drugs).
  • the absolute amount of engineered cells included in a given unit dosage form can vary widely, and depends upon factors such as the age, weight and physical condition of the subject, as well as the method of administration.
  • a therapeutically effective amount is also one in which any toxic or detrimental effects of the therapeutic agent are outweighed by the therapeutically beneficial effects.
  • an anti-tumor effective amount may be a therapeutically effective dose.
  • Administered dosages for the engineered cells as described herein for treating cancer, a cancerous tumor, or other disease or disorder are in accordance with dosages and scheduling regimens practiced by those of skill in the art. Typically, doses > 10 9 cells/patient are administered to patients receiving adoptive cell transfer therapy. Determining an effective amount or dose is well within the capability of those skilled in the art, especially in light of the detailed disclosure provided herein.
  • composition means a composition comprising one or more of engineered cells or engineered NK cell lines as described herein and at least one component comprising pharmaceutically acceptable carriers, diluents, adjuvants, excipients, or vehicles, such as preserving agents, fillers, disintegrating agents, wetting agents, emulsifying agents, suspending agents, sweetening agents, flavoring agents, perfuming agents, antibacterial agents, antifungal agents, lubricating agents, and dispensing agents (depending on the nature of the mode of administration and dosage forms).
  • pharmaceutically acceptable carriers such as preserving agents, fillers, disintegrating agents, wetting agents, emulsifying agents, suspending agents, sweetening agents, flavoring agents, perfuming agents, antibacterial agents, antifungal agents, lubricating agents, and dispensing agents (depending on the nature of the mode of administration and dosage forms).
  • compositions, carriers, diluents, reagents, and the like are used interchangeably and represent that the materials are capable of administration to or upon a mammal without undue toxicity, irritation, allergic response, and/or the production of undesirable physiological effects such as nausea, dizziness, gastric upset, and the like as is commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable and grammatical variations thereof, as they refer to compositions, carriers, diluents, reagents, and the like, are used interchangeably and represent that the materials are capable of administration to or upon a mammal without undue toxicity, irritation, allergic response, and/or the production of undesirable physiological effects such as nausea, dizziness, gastric upset, and the like as is commensurate with a reasonable benefit/risk ratio.
  • it is a material that is not biologically or otherwise undesirable - i.e.
  • the material may be administered to an individual along with NK cells (and/or stem cells or iPSCs) modified to express the constructs of the present disclosure without causing any undesirable biological effects or interacting in a significantly deleterious manner with any of the other components of the pharmaceutical composition in which it is contained.
  • NK cells and/or stem cells or iPSCs
  • isolated means that the material is removed from its original environment, e.g., the natural environment if it is naturally occurring.
  • a naturally occurring NK cell present within a living organism is not isolated, but the same NK cell separated from some or all of the coexisting materials in the natural system is isolated.
  • GBM glioblastoma
  • Conventional treatments for glioblastoma including without limitation surgery, radiation, and chemotherapy), have proven ineffective largely due to the severe immunosuppression characteristic of GBM.
  • GBM is a particularly challenging tumor to treat due to its intratumor heterogeneity, whereby cells with varying molecular, genetic and epigenetic characteristics contribute to its ability to evade conventional treatments.
  • GBM is characterized by antigen escape variants that resist single antigen-targeting monotherapies.
  • the highly hypoxic nature of many tumors also fuels the activity of ectonucleoside triphosphate diphosphohydrolase-1 (CD39), ecto-5'-nucleotidase (CD73) and other adenosinergic signaling variants (e.g., CD38, etc.) to produce the immunosuppressive metabolite adenosine, which leads to significant purinergic signaling- mediated impairment of NK cell activity.
  • CD39 ectonucleoside triphosphate diphosphohydrolase-1
  • CD73 ecto-5'-nucleotidase
  • other adenosinergic signaling variants e.g., CD38, etc.
  • GBM cells utilize autophagy to promote their growth, progression, and resistance to therapy.
  • GBM cells utilize autophagy to promote their growth, progression, and resistance to therapy.
  • GSCs glioma stem-like cells
  • inventive concepts of the present disclosure generally relate to methods, compositions, and engineered peptides for the treatment of cancers, particularly GBM, through multifunctional engineered NK cells that not only target one or more cancer-specific antigens, but also, in at least one embodiment, inhibit autophagy such that the GBM is sensitized for the therapeutic treatment. Furthermore, certain embodiments of the present disclosure directly inhibit adenosinergic signaling. Accordingly, the compositions, systems, and methods of the present disclosure are the first multifunctional, engineered NK cell-based therapy for GBM that simultaneously targets multiple clinically relevant pathways of GBM progression including, for example, antigen escape, immunometabolic suppression, and/or poor intratumoral NK cell presence, using the novel engineered NK cells described herein.
  • a single NK-cell construct comprises at least bifunctional constructs (e.g., CARs), namely, at least a first construct for encoding a protein specific to a cancer-associated antigen (for example, and without limitation, disialoganglioside (GD2)) and at least a second construct for targeting cognate ligands to a NK activating receptor (for example, and without limitation, the potent activating NK cell receptor natural killer group 2D (NKG2D)).
  • CARs e.g., CARs
  • NK cell which may comprise a transmembrane domain and/or an intracellular domain.
  • One or more of such constructs may be expressed in a single NK cell as desired. Use of at least two different CARs in this context avoids antigen escape of the cancer cells seen with conventional treatments.
  • At least one of the constructs may further be engineered to impair immunosuppressive purinergic/adenosinergic signaling, for example and without limitation, through the inclusion of one or more CD73-, CD39-, or CD38-blocking antibody fragments operably linked with the construct via a cleavable linker.
  • the first CAR may be coupled with anti-CD73scFv via a cleavable linker. In this manner, in operation, the antibody and/or fragment is released wholly independently of the CAR-based signaling and/or activation.
  • the released antibody/fragment then functions to inhibit the activity of the adenosine producing cell surface protein or adenosine-intermediary producing cell surface protein of the cancer cells thereby decreasing the local concentration of extracellular adenosine which, in turn, impairs immunosuppressive purinergic signaling.
  • the release of the linker is tumor-sensitive and, thus, cleavable by the activity of proteases that are upregulated in the TME. This results in the localized release of the adenosine blocking antibody fragment in the TME and, thus, avoids systemic toxicities.
  • embodiments of the present disclosure may also impair and/or disable autophagy through administration of at least one additional therapeutic treatment.
  • the additional therapeutic treatment comprises administering to the patient one or more pharmacological autophagy inhibitors such as chloroquine (CQ) and the like.
  • the at least one additional therapeutic treatment comprises targeting one or more genes of the patient associated with the autophagy pathway through generating genetic knockdown patient-derived GBM cells.
  • the additional therapeutic treatment can achieve a potent reorganization of the GBM milieu and, thus, substantially enhance NK cell infiltration through the engagement of the CCL5 and CXCL10 chemokine axes.
  • ATP is abundantly released in the extracellular space where its concentration can reach a few hundred micromole per liter, a concentration more than a thousand times higher than in healthy tissues. This phenomenon is mainly due to cell death in the tumor core and to metabolic or hypoxic stress and pro-inflammatory signals that stimulate active export of ATP.
  • extracellular ATP acts as a danger signal involved in the recruitment of innate immune cells and in the priming of anti-tumor activity; however, at the same time the extracellular ATP is degraded into immunosuppressive adenosine via the concerted enzymatic activity of at least CD39 and CD73, as well as CD38.
  • immunosuppressive adenosine via the concerted enzymatic activity of at least CD39 and CD73, as well as CD38.
  • CD39 and CD73 are ecto-nucleoside triphosphoate diphosphohydrolases, which are anchored cell surface proteins, and exhibit a catalytic site facing the extracellular space.
  • CD38 and CD157 are alternative pathways that are also surface molecules with an extracellular catalytic domain, except theirs consists of ADP ribosyl-cyclases. Expression of these ectoenzymes by solid tumors such as GBM and in the TME results in the production of extracellular adenosine.
  • CD38 and CD157 are part of the same family of NADase/ADPR cyclase enzymes.
  • CD38 is a surface glycoprotein characterized by a relatively large extracellular domain that harbors the catalytic site.
  • CD157 on the contrary, is attached to the membrane via a glycosylphosphatidylinositol anchor.
  • the extracellular domain of both molecules contains conserved critical residues. They both metabolize nicotinamide dinucleotide (NAD + ), which also affects purinergic receptors and converge on adenosine generation with profound effects generating immune effectors cells (e.g., NK cells) towards tolerance.
  • NAD + nicotinamide dinucleotide
  • extracellular NAD + can be degraded by an integrated network of ectonucleotidases, including CD38 and CD157, which generate intermediates that modulate signaling and activate immunoregulatory circuits.
  • Extracellular adenosine can be generated fromNAD+ through to the coordinated action of CD38, which generates ADP ribose (ADPR) and PC-1 (ectonucleotide pyrophosphatase/phosphodiesterase family member 1), which generates AMP.
  • ADPR ADP ribose
  • PC-1 ectonucleotide pyrophosphatase/phosphodiesterase family member 1
  • Similar CD38, CD157 generates cADPR and subsequent ADPR when incubated withNAD + .
  • both CD39 and CD73 are typically expressed on about 2-5% ofNK cells within non-malignant blood cells. As such, expression of both CD39 and CD73 is virtually absent from circulating human NK cells in healthy individuals.
  • significant expression of CD39 by human tumors and infiltrating immune cells has been widely described, which is associated with generation of adenosine that has an inhibitory role on effector anti-tumor immunity and exposure to proinflammatory cytokines, oxidative stress and hypoxia.
  • expression of CD73 remains at constitutively high levels on many types of cancer cells. High CD73 expression has been shown to be correlated with unfavorable clinical outcomes, which is consistent with the immunosuppressive role of adenosine.
  • the expression of CD38, CD73, and/or CD157 may also be upregulated, especially in a TME that is hypoxic.
  • CD39 and CD73 are overexpressed on many solid tumor cells - GBM in particular - and implicated in the promotion of cancer progression through upregulation of adenosine signaling following dephosphorylation of extracellular AMP.
  • adenosinergic signaling interferes with the trafficking and activities of NK cells due to the heterologous desensitization of chemokine receptors and reduced proinflammatory cytokines and inhibits the exocytosis of cytotoxic NK granules. This creates a pro-angiogenic niche supporting tumor development.
  • Adenosine-induced immunosuppression can be alleviated by antibody -mediated blockade of CD73 or the variants thereof; however, this alone relies on the recruitment of NK cells to hypoxic tumor niches. Conventional efforts have not targeted adenosinergic signaling in conjunction with NK-based immunotherapy.
  • NK Activity NK cells specialized effectors of the innate immune system, can respond rapidly to cancer cells due to expression of germline-encoded activating receptors capable of directly binding to pathogen-derived or stress-induced self-antigens.
  • the activity of NK cells is controlled by a balance of signals from a repertoire of activating and inhibitory receptors.
  • Activating receptors include, without limitation, natural cytotoxic receptors (NCRs), natural killer group 2 member D (NKG2D), CD16 (FcyRIIIA), FasL, TRAIL, and co-stimulatory receptors such as LFA-1, CD244 (2B4), and CD137 (41BB).
  • activating cell surface receptors have the capacity to trigger cytolytic programs, as well as cytokine and chemokine secretion via intra-cytoplasmic ITAMs such as 2B4, 4 IBB, and/or via other transmembrane signaling adaptors.
  • signaling domain means and includes stimulatory and costimulatory domains unless otherwise specified.
  • inhibitory NK cell receptors predominantly recognize cognate MHC class I protein and provide self-tolerance toward healthy cells. Cells with absent or reduced expression of MHC class I protein, as often observed after transformation or viral infection, are unable to trigger sufficient inhibitory signals and become susceptible to NK cell attack.
  • NKG2d receptor Upregulated expression of ligands for activating NK cell receptors can render cells sensitive to NK cell attack.
  • activating receptor is the C-type lectin-like receptor NKG2d.
  • NKG2d receptor is expressed in NK cells as well as many T cells, such as NKT cells, CD8+ T cells, and gdT cells.
  • the NKG2D usually acts only as a costimulatory receptor and does not directly mediate cytotoxicity, which is different from NK cells.
  • NKG2D ligands (often expressed in tumor cells) is generally regarded as a “danger signal,” marking cells for immune attack, and activating NK cells by binding to the NKG2D receptor.
  • a “danger signal” marking cells for immune attack
  • NK cells by binding to the NKG2D receptor.
  • ex vivo studies with human cells and in vivo tumor models in mice demonstrated that expression of NKG2D ligands on tumor cells results in an increased susceptibility to NK cell attack.
  • ligation of NKG2D on NK cells serves to promote NK cell activation and influence the adaptive immune response; however, there are various mechanisms (especially with GBM) that inhibit the action of NKG2D receptor/NKG2D ligand to enable immune escape.
  • adenosine signaling results in downregulation of receptor expression on NK cells (for example, and without limitation, it has been established that adenosine downregulates NKG2D on cytokine-primed human NK cells).
  • the expression of NKG2D receptor on NK cells can be regulated by a variety of other factors, including changes in cellular activity factors and the physicochemical features of the TME (such as, for example, hypoxia).
  • the TME is composed of a variety of cells and molecules, including tumor-associated fibroblasts, tumor-associated macrophages, Tregs, immunoregulatory enzymes (e.g., arginase and cyclooxygenase-2), and immunosuppressors (e.g., interleukin- 10 (IL-10), transforming growth factor-b (TGF-b), vascular endothelial growth factor (VEGF), prostaglandin E2 (PGE2), and programmed death ligand 1).
  • immunoregulatory enzymes e.g., arginase and cyclooxygenase-2
  • immunosuppressors e.g., interleukin- 10 (IL-10), transforming growth factor-b (TGF-b), vascular endothelial growth factor (VEGF), prostaglandin E2 (PGE2), and programmed death ligand 1).
  • IL-10 interleukin- 10
  • TGF-b transforming growth factor-b
  • Tumor cells such as GMB cells
  • immunosuppressive cells express or secrete podocalyxin-like protein 1 (PCLPi) activin- a, indoleamine-pyrrole 2, 3-dioxygenase (IDO), PGE2, TGF-b, and macrophage migration inhibitory factor (MIF) in the TME to mediate NKG2D downregulation.
  • PCLPi podocalyxin-like protein 1
  • IDO indoleamine-pyrrole 2
  • PGE2 3-dioxygenase
  • TGF-b macrophage migration inhibitory factor
  • hypoxia is an important feature of the TME that can directly or indirectly induce the secretion of immunosuppressive molecules, such that NK cells lose the ability to upregulate NKG2D expression through IL-2 and other cytokines.
  • tumor cells can secrete a variety of chemokines to recruit immunosuppressive cells that secrete cytokines, thereby downregulating NKG2D expression.
  • inventive constructs, engineered NK cells and NK cell lines, compositions and methods of the present disclosure uniquely target at least one, or a combination of, cancer antigen(s) and/or NK activating receptors, and further provides a releasable, soluble antibody fragment that impairs immunosuppressive purinergic signaling by blocking the activity of an adenosine producing cell surface protein or an adenosine-intermediary producing cell surface protein of the cancer/tumor cell. Where multiple cancer antigens and/or activating receptors are employed, this limits the tumor’s ability for antigen escape.
  • the adenosine-blocking, soluble antibody fragment is spatially-controlled, it releases only when within the TME to allow for the sustained and non-toxic release thereof. This, accordingly, avoids systemic toxicity issues seen in other conventional therapies.
  • novel approaches of the present disclosure uniquely combine the specificity of engineered NK cells with the immune engagement induced by a blockade of adenosine producing enzymes (e.g., anti-CD73). Still further, as is described in additional detail below, such treatments may be combined with the administration of one or more autophagy inhibitors to further sensitive the tumor and further promote treatment efficacy. Accordingly, the constructs, engineered NK cells, pharmaceutical compositions and resulting therapies of the present disclosure yield combination immunotherapy modalities that can target multiple clinically-recognized mechanisms of GBM progression simultaneously while avoiding toxicity.
  • adenosine producing enzymes e.g., anti-CD73
  • a synthetic genetic construct 100 is provided.
  • the genetic construct 100 is engineered so that the NK cells and NK cell lines that express it (achieved via bioengineering and other known modalities) express at least one domain and/or receptor that are not normally expressed on the surface of native NK cells.
  • the construct 100 may comprise one or more CAR constructs.
  • the construct 100 comprises a first CAR construct and a second CAR construct.
  • the genetic construct 100 comprises a first construct comprising a first sequence that encodes at least a first binding domain or fragment thereof 102 operably linked to a second sequence encoding at least a second binding domain or fragment thereof and a cleavable linker 104.
  • the first binding domain or fragment thereof 102 may comprise a NK activating receptor (e.g., NKG2D; SEQ ID NO: 6) or a protein specific for a cancer- associated antigen (such as, for example, GD2; SEQ ID NO: 7).
  • Figure 5, subparts F and G illustrate in schematic at least one embodiment of a first binding domain or fragment thereof 102 encoded by the first sequence.
  • the first construct is further engineered to also encode a second binding domain or fragment thereof 104 that is specific for an adenosine or adenosine-intermediary producing cell surface protein of a target cell.
  • adenosine or adenosine-intermediary producing cell surface protein may comprise CD39, CD73, CD38 or any other cell surface protein of a target cell that produces adenosine or an intermediary thereof.
  • the adenosine or adenosine-intermediary producing cell surface protein comprises CD73 and the second binding domain or fragment thereof 104 comprises an anti-CD73 fragment such as an anti-CD73 scFv (see Figure 5, subpart K).
  • the second binding domain or fragment thereof 104 further comprises a cleavable linker.
  • cleavable linker may comprise any such linker known in the art and, in at least one exemplary embodiment, comprises a linker that is cleavable by one or more proteases present within the TME.
  • cancer cells produce adenosine through CD73 and other surface proteins.
  • the second binding domain 104 may be specific for such adenosine or adenosine-intermediary producing tumor cell surface proteins, when its linker is cleaved in the TME, the resulting soluble antibody fragment is released from the engineered NK cell and allowed to bind the adenosine (or adenosine-intermediary) producing tumor cell surface protein.
  • the genetic construct 100 may further comprise a second construct as shown in Figure 5, subparts K and L. Similar to the first construct, the second construct may comprise a second sequence that encodes at least one binding domain (or fragment thereof) 106 which comprises a NK activating receptor or a protein specific for a cancer-associated antigen.
  • Figure 5, subparts A and B illustrate in schematic at least one embodiment of the third binding domain or fragment thereof encoded by the second sequence.
  • first and third sequences may encode signaling domain(s) of a NK cell such that they can promote cytotoxic and/or cytolytic activity of the engineered cell or cell line upon activation (see, for example and without limitation, O ⁇ z in Figure 5, subparts A and F, and DAP10 in Figure 5, subpart A).
  • the first and third binding domains 102, 106 can comprise complimentary determining regions, variable regions, and/or antigen binding fragments thereof, as desired. It will likewise be appreciated that various linkers, spacers, scFv, hinges, and/or protein complexes may be additionally encoded by one or both of the first and second sequences as may be required to achieve the desired results.
  • first and the third sequence are represented in Figure 5 as comprising an activating receptor 102 and a protein specific for a cancer-associated antigen 106, respectively, the first and third sequences may both encode proteins for cancer-associated antigens or both encode NK cell activating receptors (i.e. there need not necessarily be one of each type). Furthermore, the second sequence encoding the second binding domain or fragment thereof 104 may be operatively linked to aNK cell activating receptor of the first domain 102. Where the first and third sequences both encode an antigen or a receptor 102, 106, in an exemplary embodiment, they may encode two different cancer-specific antigens or two different NK cell activating receptors; however, while often desirable, this is not required.
  • subparts K and L illustrate schematics of at least one exemplary embodiment of a genetic construct of the present disclosure that comprises the first, second, and third binding domains (or fragments thereof) 102, 104, 106.
  • the first binding domain 102 comprises anti-GD2 scFv fragment operatively linked with a CD8a Hinge, and two signaling domains (CD28 and O ⁇ 3z) (collectively, GD2-CAR; SEQ ID NO: 7)
  • the second binding domain 104 comprises an anti-CD73 scFv fragment is linked to the first binding domain 102 via a cleavable linker (SEQ ID NO: 1)
  • the third binding domain 106 comprises NKG2D, two signaling domains (DAP 10 and 6 ⁇ 3z).
  • the construct 100 encodes at least a 80%, 85%, or 90% sequence identity to SEQ ID NO: 8.
  • the target cell may comprise any cell that produces cancer-associated antigens, NKG2D or other ligands cognate with an NK activating receptor, and/or adenosine or an intermediary thereof through a cell surface protein, for example, and without limitation, a cancer cell or otherwise malignant cells within a TME.
  • GD2 and ligands to NKG2D are widely expressed on human GBM and, as such, are referred to in the present disclosure by way of non- limiting example.
  • cancer-associated antigens may be encoded in the constructs of the present disclosure, such as, without limitation, ganglioside G3 (GD3), Her 2 (pi 85), CD 19, CD20, CD56, CD123, CD22, CD30, CD33, CD171, CS-1, C-type lectin-like molecule-1; EpCAM, G250, proteoglycans, GD3, GD2, MHC II, TAG-72, milk mucin core protein, Lewis A antigen, tyrosine-protein kinase transmembrane receptor (ROR1), c-met, epidermal growth factor receptor (EGFR), EGFR variant III, and carcinoembryonic antigen (CEA), and certain antigens may be particularly associated with certain types of cancers.
  • GD3 ganglioside G3
  • Her 2 pi 85
  • CD 19 CD20
  • CD56 CD123
  • CD22 CD30
  • CD33 CD171, CS-1
  • any NK activating receptor that has cognate ligands presented on the desired target cell may be encoded in construct 100 including, without limitation, NKp30, NKp46, NKp40, DNAM- 1, and the like.
  • the constructs and resulting NK cells may be engineered specifically for a particular cancer-type by, for example, comprising a first sequence 102 and/or third sequence 106 that encodes a protein specific for an antigen or a cognate ligand that is predominantly expressed in the cancer of interest.
  • certain embodiments of the construct 100 that encode a NK activating receptor may additionally be engineered for upregulated expression using techniques known in the art.
  • one or more of the sequences encoding a binding domain or fragment thereof is engineered to encode upregulated expression of the NKG2D as compared to expression of NKG2D in a wild-type NK cell (i.e. expression of such receptor in the typical form of a NK cell at it occurs in nature).
  • Such engineered upregulated expression is particularly useful when the engineered NK cells are employed to treat GBM and other tumors with a hypoxic TME, as it increases local NKG2D available.
  • the inclusion of a protein specific for such antigens in one or more of the binding domains or fragments thereof 102, 106 in the construct 100 allows for the resulting engineered NK cells to directly target and recognize cancer and other such cells.
  • the present constructs 100 enhance specificity and allow for the direct targeting and engagement of tumor, cancer and other malignant cells safely.
  • the binding domains 102, 104, 106 may further comprise one or more single-chain variable fragment (scFv) sequences or other antibody fragments such as nanobodies, which are fusion proteins between the variable regions of the heavy (VH) and light (VL) chains of immunoglobulins, connected with a shorter linker peptide of about ten to about 25 amino acids.
  • scFv single-chain variable fragment
  • the specific configuration of the scFv or other antibody fragments may be selected based on desired properties of the resulting peptide (e.g., rich in glycine for flexibility, as well as serine or threonine for solubility).
  • the scFv or another antibody fragment can either connect the N-terminus of the VH with the C-terminus of the VL, or vice versa.
  • the protein retains the specificity of the original immunoglobulin, despite removal of the constant regions and introduction of the scFv or other antibody fragments.
  • the second binding region or domain 104 and the first binding region or domain 102 each comprise a a scFv fragment derived from a particular mouse, or human, or humanized monoclonal antibody or pursuant to other known sources and known methodologies.
  • the fragment can also be any number of different antigen-binding domains of an antigen-specific antibody.
  • the fragment is an antigen- specific scFv (e.g., aCD73 scFv or aGD2 scFv) encoded by a sequence that is optimized for human codon usage for expression in human NK cells.
  • the first sequence of the has at least a 80%, 85%, or 90% sequence identity to SEQ ID NO: 7, and the binding domain or fragment thereof 102 that it encodes CD73 scFv has at least a 80%, 85%, or 90% sequence identity to SEQ ID NO: 2.
  • the first and/or third binding regions or domains 102, 106 may be operably linked thereto (directly or via a hinge region as described below) and, in fact the first binding domain may itself comprise a signaling domain (e.g., CD28, 4-1BB, DAP10).
  • the one or more signaling domains may, for example, comprise an NK activator receptor or receptor complex capable of triggering the cytolytic and cytotoxic programs of the NK cell upon the associated binding domain or fragment thereof binding a target cell.
  • the signaling domain may comprise a CD28, O ⁇ 3z, or DAP 10 signal molecule or any other signaling domain known in the art.
  • the signaling domains may comprise FcyRIIIA, FasL, TRAIL, 4-1BB, 0X40, LFA- 1, CD244, CD137, or theNKG2D-DAP10 receptor complex.
  • the signaling domains may also comprise additional other costimulatory domains including, without limitation, one or more of DAP12, NKp46, NKp44, NKp30, and DAP10.
  • engagement of at least the first and optionally third binding domains 102, 106 of the construct 100 with the target cell promotes signaling through the signaling domains of the engineered NK cell, resulting in activation of ITAM motifs on 6 ⁇ 3z adaptor chains and NK cell-mediated cytotoxicity against solid tumor and other adenosine producing or adenosine- intermediary producing targets.
  • the engineered NK cell directly targets and binds a GD2- and/or NKG2D-ligand-producing surface cell protein (on a solid tumor, for example)
  • signals are sent to the engineered NK cell via the signaling domains to trigger cytolysis and/or cytotoxicity mechanisms of the target (cancer) cell that it has bound.
  • the construct 100 can additionally include a hinge domain (see Figure 5, labeled “CD8a Hinge”) positioned within the binding domains 102, 106 at a location, for example and without limitation, between the aGD2 scFv and the signaling domains CD28 and 6 ⁇ 3z of the third binding domain 106.
  • a hinge domain may comprise one or more sequences that encode linkers or spacers and may be included in the construct, for example, to provide sufficient distance between the first/third binding domains 102, 106 and the membrane and/or cell surface.
  • a hinge domain may be included (and/or configured) to facilitate a desired tertiary structure and/or alleviate possible steric hindrance that could adversely affect antigen binding or effector function of the modified NK cells. In this manner, the hinge domain can be used and/or manipulated for optimal expression in human cells.
  • additional intracellular signaling domains may be added to the construct 100 to enhance killing stimulus (i.e. further bolster the NK-mediated cytotoxicity of the resulting engineered NK cells).
  • human O ⁇ 3z intracellular domains can be operably linked with both the first and third binding domains 102, 106 as shown in subpart L of Figure 5.
  • Other cytoplasmic domains may also be employed as desired, with one or multiple of such cytoplasmic domains fused together for additive or synergistic effect, if desired.
  • the binding domains 102, 104, 106 targets the cell(s) of interest and, when the binding domains 102, 106 bind the targeted cell, the engineered NK cell signals via the signaling domains to trigger cytolysis and/or cytotoxicity of the target cell.
  • the binding domains or fragments thereof comprises an upregulated activating receptor (e.g., NKG2D)
  • this enhances the anti-tumor responses of the NK cells and reduces not only the local concentration of extracellular adenosine, but also the immunosuppression of the NK cell activation. This is further bolstered by release of the second binding domain 104.
  • the proteases therein cause the linker that tethers the second domain/fragment 104 to the first domain 102 to cleave, thereby releasing the fragment into the TME to initiate a local adenosine or adenosine-intermediary activity blockade in the target cell.
  • the combination of increased NKG2D activity and the localized CD73 target blockade is highly effective in achieving controlled and localized responsiveness in GBM and other cancers.
  • the construct 100 allows for a multi -prong attack on the complex network of pathways that promote GBM and other cancer progression. Incorporating two or more (in an exemplary embodiment, three) targets into a single construct, one of which is releasable, enables the engineered NK cells of the present disclosure to not only activate and enhance the anticancer immune response, but also suppress GBM’s evasion tactics such as antigen escape.
  • the constructs according to the embodiments can be prepared using conventional techniques. Because, for the most part, natural sequences may be employed, the natural genes may be isolated and manipulated, as appropriate, to allow for the proper joining of the various components. For example, the nucleic acid sequences can be isolated by employing the polymerase chain reaction (PCR), using appropriate primers that result in deletion of the undesired portions of the gene. Alternatively, restriction digests of cloned genes can be used to generate the chimeric construct. In either case, the sequences can be selected to provide for restriction sites that are blunt-ended or have complementary overlaps.
  • PCR polymerase chain reaction
  • restriction digests of cloned genes can be used to generate the chimeric construct. In either case, the sequences can be selected to provide for restriction sites that are blunt-ended or have complementary overlaps.
  • the various manipulations for preparing the constructs hereof can be carried out in vitro and in particular embodiments the construct is introduced into vectors for cloning and expression in an appropriate host using standard transformation or transfection methods.
  • the resulting construct from joining of the DNA sequences is cloned, the vector isolated, and the sequence screened to ensure that the sequence encodes the desired transgene and expression control sequences.
  • the sequence can be screened by restriction analysis, sequencing, or the like as desired.
  • Vectors of the embodiments presented herein may further employ eukaryotic promoters as is known in the art.
  • the vectors may contain a selectable marker, if for no other reason, to facilitate their manipulation in vitro.
  • the transgene can be expressed from mRNA in vitro transcribed from a DNA template.
  • the promoter is operably linked to the nucleic acid sequence encoding a transgene of the embodiments, i.e., they are positioned so as to promote transcription of the messenger RNA from the DNA encoding the single-agent construct.
  • the promoter can be of genomic origin or synthetically generated. Alternatively, a number of well-known viral promoters are also suitable.
  • the naturally occurring or endogenous transcriptional initiation region of the nucleic acid sequence encoding the transgene can be used to generate the desired expression in the target host.
  • an exogenous transcriptional initiation region can be used that allows for constitutive or inducible expression, wherein expression can be controlled depending upon the target host, the level of expression desired, the nature of the target host, and the like.
  • a leader and/or signal sequence added to the N-terminus specific for human protein expression directing the construct to be encoded by the transgene to the cell surface may be used.
  • Isolated nucleic acid segments and expression cassettes incorporating the DNA sequences of the constructs of the present disclosure are also provided.
  • One of skill in the art will appreciate that such constructs may be employed with known gene modification techniques, including viral transduction, mRNA or DNA electroporation, and other viral and non-viral transduction and transfection techniques, to achieve engineered NK cells and/or an engineered NK cell line that expresses the constructs described herein.
  • a polynucleotide that encodes a construct provided herein can be introduced into a subject's own cells (or into cells from a different donor subject) using conventional transfection and/or transducing methods, either in a suitable vector or vector- free. Methods of stably transducing or transfecting NK cells by electroporation or otherwise are known in the art.
  • the present constructs can be introduced into cells using a transposon-based system to mediate integration of the construct into genomic DNA of the cells, a non-viral vector, or a viral vector (e.g., a retroviral vector, adenoviral vector, adeno-associated viral vector, or lentiviral vector).
  • a viral vector e.g., a retroviral vector, adenoviral vector, adeno-associated viral vector, or lentiviral vector.
  • the CAR may be modified to facilitate uptake by the NK cells and, thus, expression of the construct-derived fusion protein in NK cells.
  • Sources of native NK cells may include both allogeneic and autologous sources.
  • NK cells may be differentiated from stem cells or induced pluripotent stem cells (iPSCs).
  • iPSCs induced pluripotent stem cells
  • a construct as described herein can be expressed in stem cells or iPSCs, which can then be differentiated into NK cells using methods known to one skilled in the relevant arts.
  • a cell for engineering according to the embodiments hereof can be isolated from umbilical cord blood, peripheral blood, human embryonic stem cells, or iPSCs.
  • the NK cells are primary human NK (pNK) cells, such as NK cells derived from human peripheral blood mononuclear cells or umbilical cord blood.
  • pNK primary human NK
  • the engineered NK cells may be produced from recurrent and primary patient-derived cells pursuant to methods known in the art.
  • the engineered NK cell(s) and/or engineered NK cell line expressing the constructs of the present disclosure can be produced from a standardized cell population to provide a homogenous NK cell population that can be grown to clinical scale.
  • NK cells, stem cells, pNK cells, or iPSCs modified to express a construct described herein may be formulated into a pharmaceutical composition along with a “carrier” for delivery to a subject having a condition at least partially characterized by cells that can be targets of NK cytotoxicity (e.g., adenosine overexpressing disease state).
  • carrier includes any solvent, dispersion medium, diluent, antibacterial, coating, vehicle, and/or antifungal agent, isotonic agent, absorption delaying agent, buffer, carrier solution, suspension, colloid, and the like. The use of such media and/or agents is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the pharmaceutical compositions hereof is contemplated. Supplementary active ingredients can also be incorporated into the compositions.
  • composition of the present disclosure e.g., comprising a engineered cells expressing a construct hereof
  • the pharmaceutical composition of the present disclosure can be used alone or in combination with other well-established agents useful for treating cancer and/or solid tumor cancers.
  • one or more pharmaceutical compositions of the present disclosure may be administered to a single patient in conjunction with one or more autophagy inhibitors.
  • pharmacologic impairment of the autophagic process may be achieved through administration of a therapeutic treatment comprising an autophagy inhibitor in conjunction with, in series with, or before or after administration of a composition (or active ingredient) comprising engineered cells expressing the constructs of the present disclosure.
  • autophagy inhibitor may comprise any therapy that is capable of inhibiting or reducing autophagy in the subject including, for example, administration of a small molecule inhibitor.
  • the small molecule inhibitor may comprise CQ, hydoroxycholorquine, saputin-1, SAR405, vertoprofm, or any other small molecule inhibitor now known or hereinafter developed that is suitable for administration to a patient to inhibit or block autophagy.
  • autophagy may be genetically inhibited through the downregulation of one or more genes associated with autophagy, for example, through gene knockdown techniques.
  • the gene may comprise one or more of the following genes BECN1, p62, b-actin, ATG5, ATG7, LC3B, ATG12, ATG16L1 PI3K-III, ULK1, ULK2, FIP200, and LAMP2, or any other gene associated with (and capable of inhibiting via downregulation or otherwise) the autophagy pathway.
  • the pharmaceutical compositions hereof can be delivered via various routes and to various sites in a mammal, preferably a human, body to achieve a particular effect.
  • a particular route can provide a more immediate and/or more effective reaction than other routes.
  • intratumoral delivery may be used for the treatment of a solid tumor cancer (and may be advantageous in terms of minimizing off-target effects).
  • Local or systemic delivery can be accomplished by administering the pharmaceutical composition into body cavities, infusion, or by parenteral introduction.
  • the compositions of the present disclosure are administered in addition to an additional therapeutic treatment such as autophagy inhibition, the autophagy inhibition may be performed via systemic injection or infusion, or as otherwise desired by the healthcare provider.
  • compositions may be formulated in a variety of forms adapted to a preferred route of administration. Accordingly, a composition can be administered via known routes including, without limitation, parenteral (e.g, intradermal, subcutaneous, intravenous, transcutaneous, intramuscular, intraperitoneal, etc.) or topical (e.g., intratracheal, intrapulmonary, etc.). A composition can also be administered via a sustained or delayed release.
  • parenteral e.g, intradermal, subcutaneous, intravenous, transcutaneous, intramuscular, intraperitoneal, etc.
  • topical e.g., intratracheal, intrapulmonary, etc.
  • a composition can also be administered via a sustained or delayed release.
  • a formulation may be conveniently presented in unit dosage form and may be prepared by methods well known in the art of pharmacy.
  • Methods of preparing a composition with a pharmaceutically acceptable carrier include the step of bringing NK cells (and/or stem cells or iPSCs) modified to express a construct of the present disclosure into association with a carrier that constitutes one or more accessory ingredients.
  • a formulation may be prepared by uniformly and/or intimately bringing the engineered cells into association with, for example, a liquid carrier.
  • a pharmaceutical composition that includes NK cells (and/or stem cells or iPSCs) modified to express a construct hereof may be provided in any suitable form including but not limited to a solution, a suspension, an emulsion, a spray, an aerosol, or any form of mixture.
  • the composition may be delivered in formulation with any pharmaceutically acceptable excipient, carrier, or vehicle.
  • the effective amount of NK cells (and/or stem cells or iPSCs) modified to express a construct hereof that is administered to a subject can vary depending on various dosing factors discussed herein.
  • the method can include administering a therapeutically effective amount of engineered cells modified to express a construct of the present disclosure to provide a dose of, for example, at or greater than about 10 9 cells/subject, or from about 10 5 cells/kg to about 10 10 cells/kg to the subject, although in some embodiments the methods may be performed by administering an amount of engineered cells in a dose outside these ranges.
  • the pharmaceutical composition that includes engineered cells modified to express a construct hereof may be administered, for example, from a single dose to multiple doses per week, although in some embodiments the method can be performed by administering the pharmaceutical composition at a frequency outside this range.
  • the amount of engineered cells administered should take into account the route of administration and should be such that a sufficient number of the engineered cells will be introduced so as to achieve the desired therapeutic response.
  • the pharmaceutical composition is administered to a subject in an amount, and in a dosing regimen effective to treat the symptoms or clinical signs of the condition, which may include (without limitation) reducing, limiting the progression of, ameliorating, or resolving the same (to any extent).
  • constructs, engineered cells and NK cell lines of the present disclosure may be used in many applications including, without limitation, treating a subject having an adenosine overexpressing cancer or other disease state through reducing the size of a tumor or other targeted cell or preventing the growth or re-growth of a tumor or other cancerous or malignant cells in treated subj ects. Accordingly, embodiments of a method for treating a subj ect having an adenosine overexpressing cancer or related disease state are also provided.
  • Such a method may comprise a step of administering (or having administered) to a subject a therapeutically effective amount of a pharmaceutical composition as described herein.
  • the pharmaceutical composition may comprise a population of engineered NK cells (as described herein) that express a polynucleotide construct encoding at least a first binding domain or fragment thereof that targets at least one cognate ligand on a target cell (e.g., NKG2D), at least a second binding domain or fragment thereof that is specific for GD2 (e.g., anti-GD2 and, optionally, scFv), and at least a third binding domain or fragment thereof that is specific for an adenosine-producing or an adenosine-intermediary producing cell surface protein of a target cell (e.g., anti-CD73 and, optionally, scFv).
  • a target cell e.g., NKG2D
  • GD2 e.g., anti-GD2 and, optionally, sc
  • the signaling domains may also be encoded which comprise one or more domains involved in promoting cytotoxic or cytolytic activity of the engineered cell upon activation by the associated binding domain binding the target cell.
  • the target cell may comprise a a cancer cell (e.g., GBM) or a malignant cell in a TME, for example.
  • the administration step may be performed using any of the administration techniques heretofore described including, without limitation, intravenously, intratumorally (locally), parenterally, or via infusion (systematically).
  • the pharmaceutical compositions hereof comprising engineered cells modified to express one or more of the constructs of the present disclosure may be assembled into a kit for treating a subject experiencing an adenosine overexpressing cancer, such as glioblastoma.
  • kits may further include one or more tools and/or devices desirable to simplify and/or facilitate administration of such compositions to the subject (e.g., vials, syringes, tubing, etc.).
  • the methods of treating a subject suffering from a cancer may further comprise the step of administering (or having administered) an additional therapeutic treatment to the subject comprising one or more autophagy inhibitors as described herein.
  • autophagy inhibitor may comprise a therapeutically effective amount of a small molecule inhibitor and/or the genetic downregulation of a gene in the autophagy pathway.
  • the method comprises administering (or having administered) chloroquine to the subject at a concentration of between 0.01 mM and 200 pM.
  • Administration of the additional therapeutic treatment may be performed as appropriate, including without limitation, via systemic injection or infusion. Where the method comprises at least a dual approach (i.e.
  • the means of administering both treatment modalities need not be the same or occur at the same time or via the same dosage patterns.
  • the pharmaceutical composition may be administered intravenously, intratumorally, parenterally, or via infusion, and administration of the additional therapeutic treatment is performed via systemic injection or infusion.
  • the timing and dosages of the treatments may be tailored to the specific patient and his or her condition.
  • kits may also be provided to facilitate the multiple treatment approaches hereof.
  • the kit may comprise a therapeutically effective amount of a pharmaceutical composition according to the present disclosure, and a therapeutically effective amount of an autophagy inhibitor.
  • such treatment components are housed separately within the kit.
  • the kits may further include one or more tools and/or devices desirable to simplify and/or facilitate administration of such compositions to the subject (e.g., vials, syringes, tubing, etc.).
  • the method may also comprise steps of preparing the pharmaceutical composition for the subject.
  • optional step may comprise withdrawing, or having withdrawn, a sample, such sample comprising stem cells, blood cells, or iPSCs.
  • a sample such sample comprising stem cells, blood cells, or iPSCs.
  • Such withdrawn cells are thereafter isolated from the sample (i.e. in the case of a sample comprising a peripheral blood draw, one or more NK cells are isolated) and, if needed or desired, expanded.
  • the sample may be obtained from the subject (e.g., an autologous cancer immunotherapy) and adoptive cell therapy is performed therewith.
  • the sample may be provided from a donor separate from the subject (e.g, an allogeneic therapy).
  • the isolation, genetic modification, and/or any expansion steps are performed in vitro.
  • the method may also comprise optional step comprising transducing or transfecting the isolated cells are with an expression vector containing a construct of the present disclosure. Thereafter, a population of engineered cells are achieved that express the desired construct. Such population of engineered cells may then be administered to the subject as previously described. In at least one embodiment, such administration comprises adoptive cell therapy.
  • the method may be combined with (or include) the administration of additional therapies now known or hereafter developed for the treatment of cancer, solid tumors, and/or related to ameliorating or eliminating symptoms or side-effects associated with such therapies.
  • the method may comprise the additional step of administering (or having administered) to a subject additional therapeutic treatment comprising an autophagy inhibitor as previously described.
  • a construct of the present disclosure is introduced into an isolated NK cell of the subject and, thereafter, the transformed NK cell is reintroduced into the subject, thereby effecting anti -tumor and/or anti-cancer responses to reduce or eliminate the condition in the subject.
  • Suitable NK cells that can be used are addressed above and include, without limitation, blood-derived NK cells. Even non-NK cells as set forth herein may be employed. As is well known to one of ordinary skill in the art, various methods are readily available for isolating these cells from a subject, such as leukapheresis.
  • the disclosure may have presented a method and/or process as a particular sequence of steps.
  • the method or process should not be limited to the particular sequence of steps described.
  • other sequences of steps may be possible. Therefore, the particular order of the steps disclosed herein should not be construed as limitations on the claims.
  • the claims directed to a method and/or process should not be limited to the performance of their steps in the order written, and one skilled in the art can readily appreciate that the sequences may be varied and still remain within the spirit and scope of the present disclosure.
  • the antigen target selections of the present disclosure were based on the combinatorial presence of pro-tumorigenic antigens in GBM patient samples. It was observed that the gene level transcriptional expression of GD2, NKG2DL and CD73 - markers with distinct roles contributing to GBM pathology - is present, individually, on over 96% (151 of 156) of the GBM RNA-seq patient dataset (156 patients) from The Cancer Genome Atlas (TCGA) patient cohort, while dual combinations were detected on 68% of patient samples. Patient-derived GBM cells - pediatric, adult primary, and adult recurrent - further confirmed this expression pattern.
  • NK cells were engineered to express a trifunctional construct that can target heterogeneous combinations of antigens responsively to their expression levels, locally and while sparing healthy cells.
  • CAR-NK cells revealed no obvious toxicity towards to normal cells in the brain, including human cerebral microvascular endothelial cells (hCMEC/D3) and human cortical neuronal cells (HCN-2) (see Examples below). This is aided, at least in part, by the low expression of at least one of the targeted markers on these cells.
  • the triggerable release of CD73 antibody fragments by GBM TAPs results in low concentrations of CD73 in the local TME, a sustained response that depends on CAR expression but is independent of its activation, providing two related but independent mechanisms of tumor recognition.
  • GBM tumor-resident NK cells are markedly altered and characterized by significantly lower levels of the activating receptors CD 16, NKG2D, NKp30, NKp46, DNAM-1, CD2 and 2B4.
  • GBM patients utilize their own immunosuppressive TME to impair infiltrated NK cell function in favor of GBM escape from immune surveillance and NK-mediated cytotoxicity. These immune escape mechanisms are rooted in GBM’s heterogeneity, and represent a complex network of pathways that promote GBM progression.
  • NKG2D-NKG2DL interactions play a vital role in activating the anticancer immune response.
  • NKG2D expression on the surface of NK cells is significantly decreased in response to the high extracellular concentrations of adenosine produced by the ectoenzyme CD73 in the GBM TME.
  • CD73 is a significant prognostic biomarker for GBM and can be used as correlative factor of GBM patient survival.
  • the present disclosure achieves compositions, cells, and methods that can induce upregulation of NKG2D through the use of inventive engineered NK cells that express an NKG2D-based CAR, which has been previously shown to enhance anti-tumor responses in combination with CD73 blockade.
  • Immunosuppression of NK cells via the adenosinergic axis goes beyond activating receptor inhibition, however, and encompasses NK cell metabolism and various effector functions. Because of the wide expression of CD73, localizing targeted blockade of this enzyme may be preferential to systemic administration of anti-CD73 therapies.
  • NK cells were engineered to possess a tumor-responsive, locally -released anti-CD73 scFv that, upon triggering for release in the GBM TME, is capable of blocking local CD73 activity.
  • the data presented herein supports that the engineered NK cells of the present disclosure not only reduce the local concentration of extracellular adenosine, but also reduce the immunosuppression of NK cell activation in a tumor- specific manner.
  • the sustained, low concentration release of anti-CD73 sustains the metabolic function of NK cells that is otherwise lost in a setting of unencumbered CD73 enzymatic activity (i.e. the TME).
  • CAR-mediated signaling in combination with local CD73 blockade results in anti-tumor responses that are not only measurable by cytotoxicity against cancer cells, but also by their impaired metabolic activity, in turn sustaining the longer-term retention of NK cells in the tumor.
  • NKG2DLs Temporal modulation of antigens also occurs in response to treatment.
  • the expression of NKG2DLs which include two MHC class I chain-related proteins (MICA and MICB) and six UL 16-binding proteins (ULBP1-6), is upregulated in GBM following standard treatment with chemotherapy (TMZ) or irradiation (IR).
  • TMZ standard treatment with chemotherapy
  • IR irradiation
  • NKG2DL expression may also be regulated by an autophagy inhibitor and treatment therewith can induce a significant increase in NKG2DL (both at MFI and % level) on patient-derived GBM cells.
  • NKG2DL expression was previously found to inversely correlate with GBM cell maturity, with stem-like GBM cells expressing a more substantial, though heterogeneous, pattern of expression of these ligands.
  • the changes induced by autophagy inhibitors sensitizes GBM to effector function via the NKG2DL-R axis and also promotes the indirect loss of NKG2D on effector cells through a phenomenon that can be lessened by the induction of NKG2D expression via CARs.
  • the reorganization of the GBM TME induced by autophagy inhibitors includes a decrease in GD2 expression, which lessens the apoptotic burden imposed on tumor-infiltrating cells induced by gangliosides on GBM.
  • Antigenic targeting may not be sufficient to induce sustained anti-GBM responses.
  • Clinical data have indicated that intratumoral NK cell presence associates positively with patient outcome and survival.
  • NK cells are present in low amounts in GBM.
  • chemokine receptor/ligand interactions can drive NK cell trafficking alongside their signaling gradient to result in improved homing, responses that were demonstrated for the CXCR4/CXCL12-directed NK cell homing to GBM.
  • scant evidence of chemokine-dependent trafficking has been shown in intracranial GBM.
  • the present disclosure reveals a significant relevance of the CCL5 and CXCL10 chemokine pathways in GBM upon pharmacological targeting of autophagy.
  • CCL2 and CXCL12 both recognized for their contributing roles to the recruitment of immunosuppressive cells such as tumor associated macrophages (TAMs), was significantly decreased in response to autophagy blockade.
  • TAMs tumor associated macrophages
  • the preclinical in vivo data presented herein further demonstrates that autophagy inhibitor-mediated targeting of autophagy potentiates anti-GBM activity of NK cells via mechanisms that may involve a sensitization to their killing by modulating antigen level expression, and the activation of pro-apoptotic pathways on GBM.
  • CQ (a representative example of an autophagy inhibitor) was shown to enhance clinical responses to anti-GBM therapy in double-blinded Phase III studies.
  • concentrations of 50 mg/kg are suitable for administration regimens against orthotopic glioblastoma xenografts.
  • the present disclosure and related data demonstrates that development of multifunctional genetically-engineered human NK (CD73.mCAR-pNK) cells can result in effective anti-GBM activity supported by a concerted approach of overcoming tumor heterogeneity and multiple immunosuppressive features of the GBM TME.
  • the present disclosure also uncovers that targeting autophagy functions as an immuno-modulator to promote the homing of effector CAR- NK cells into GBM tumor sites while reprogramming the GBM TME toward sensitization to CAR-based targeting. Indeed, all treated mice experienced either a delay or complete arrest of tumor growth with the most significant responses obtained upon co-administration of CAR-NK cells with an autophagy inhibitor.
  • the data shows that, while human CAR-NK therapy is a viable option, in certain embodiments, optimal responses may rely on administration regiment, dosage and frequency of adoptive transfer.
  • mice Female 6- to 8-week-old Rag 1 _/ mice and NOD.Cg-Prkdc scld IL2 rgtmlw - il /SzJ (NSG) mice were maintained at the Purdue Center for Cancer Research. All animal experiments described herein were approved by the Purdue University Animal Care and Use Committee.
  • NK-92 cells (directly purchased from the American Type Culture Collection (ATCC) were maintained in RPMI1640 supplemented with 10% FBS, 100 U/mL penicillin, 100 pg/mL streptomycin, 2 mM L-glutamine, 400 U/mL IL-2 and 0.1 mM 2-mercaptoethanol.
  • HCN-2 cells (directly purchased from ATCC) were maintained in DMEM supplemented with 10% FBS, 100 U/mL penicillin, and 100 pg/mL streptomycin.
  • hCMEC/D3 cells (Purdue University, Indiana) were grown in EBM-2 supplemented with 5% FBS, 100 U/mL penicillin, 100 pg/mL streptomycin, 1.4 pM hydrocortisone, 5 pg/mL ascorbic acid, 1% chemically defined lipid concentrate, 10 mM HEPES and 1 ng/mL bFGF.
  • SJ-GBM2, GBM43, and GBM10 cells (Indiana University School of Medicine, Indiana) were grown in DMEM supplemented with 10% FBS and 1% HEPES. All cell lines were incubated at 37°C in a humidified 5% CO2 environment.
  • Chloroquine diphosphate salt (CQ) (98%) and adenosine 5'-monophosphate sodium salt hydrate (AMP) (99%) were purchased from ACROS OrganicsTM (Fair Lawn, New Jersey). Hydrocortisone (98%) was purchased from Alfa Aesar (Haverhill, Massachusetts). Ascorbic acid, sodium chloride (NaCl) and bovine serum albumin (BSA) were purchased from Thermo Fisher Scientific (Waltham, Massachusetts). Potassium chloride (KC1), magnesium chloride (MgCb). sodium bicarbonate (NaHCCh). adenosine (>99%), DEAE-dextran hydrochloride and glucose were purchased from Sigma (St. Louis, Missouri).
  • Brefeldin A Solution lOOCU and Monensin Solution 1000X were purchased from BioLegend (San Diego, California). D-luciferin potassium salt (>99%) was purchased from Syd Labs (Natick, Massachusetts). LY294002, BAY11-782 and SP600125 were purchased from Cayman Chemical (Ann Arbor, Michigan). Fetal bovine serum (FBS) and dimethyl sulfoxide (DMSO) were purchased from Coming (Coming, New York). Recombinant human interleukin- 12 (IL-2) was gifted from Akron Biotech (Boca Raton, Florida). Recombinant human interleukin- 15 (IL-15) and fibroblast growth factor-basic (bFGF) were purchased from GoldBio (St. Louis, Missouri).
  • Recombinant human RANTES (CCL5) was purchased from PeproTech (Rocky Hill, New Jersey).
  • Recombinant human CXCL10, recombinant human u-plasminogen activator/urokinase, CF (uPA) and recombinant human NKG2D/CD314 Fc chimera were purchased from Research and Diagnostic Systems, Inc. (Minneapolis, Minnesota).
  • Biotin-protein L was purchased from GenScript Biotech (Piscataway, New Jersey).
  • BsiWI was purchased from New England Biolabs (Ipswich, Massachusetts).
  • RPMI1640, DMEM, IMDM, penicillin/streptomycin solution 100/ (PS), 2-mercaptoethanol (50 mM), HEPES (1 M), chemically defined lipid concentrate, trypan blue solution and trypsin-EDTA were purchased from GibcoTM, Thermo Fisher Scientific (Waltham, Massachusetts).
  • Opti-MEM Reduced Serum Media was purchased from Invitrogen (Carlsbad, California).
  • EBM-2 was purchased from Lonza Group AG (Basel, Switzerland).
  • Human AB serum was purchased from Valley Biomedical (Winchester, Virginia).
  • Collagen I, rat tail was purchased from Enzo Life Sciences, Inc. (Farmingdale, New York).
  • RIPA lysis buffer system (sc-24948) was purchased from Santa Cruz Biotechnology, Inc. (Dallas, Texas).
  • pT7[mRNA]-NKG2D-CAR In this plasmid, a human NKG2D-specific CAR (NKO2O-OAR10 ⁇ O3z; identified as Construct IB below) was expressed under the control of the T7 promoter.
  • NKO2O-OAR10 ⁇ O3z identified as Construct IB below
  • pT7[mRNA]-GD2-CAR In this plasmid, a human GD2-specific CAR (anti-GD2 scFv- CD8 H ⁇ 3 ⁇ 46-M3028 ⁇ 3z; identified as Constrict 1A below) was expressed under the control of the T7 promoter.
  • the anti-GD2 scFv sequence was derived from previous work.
  • pT7[mRNA]-CD73-CAR In this plasmid, the entire construct, including a human CD73-specific cleavable anti-CD73 scFv, the human GD2-specific CAR (GD2 scFv-CD8 H ⁇ 3 ⁇ 46-M 028 ⁇ 03z; Constrict 1A) and the human NKG2D-specific CAR (NKG2D-DAP10- CD3z; Construct IB) were expressed under the control of the T7 promoter.
  • the anti-CD73 scFv fragment was coupled with GD2-CAR through a linker comprising SEQ ID NO: 1, a cleavable peptide fragment (SEQ ID NO: 2) and a short spacer (GSSGT).
  • the GD2-CAR was associated with NKG2D-CAR through “self-cleaving” P2A peptides (SEQ ID NO: 4).
  • the anti- CD73 scFv sequence was derived from previous work.
  • BECN1 Beclin 1 ( BECN1 ) shRNA (h) Lentiviral Particles (sc-29797-V): BECN1 gene knockdown 5i?C7V7 GBM43 cells were generated by lentiviral transduction according to the manufacturer’s protocol.
  • Table 1 lists the antibodies and stains used in the experiments described herein and assay kits and primers described in the present disclosure are listed below.
  • mirVana TM miRNA Isolation Kit Life Technologies, Carlsbad, California
  • HiScribe TM T7 ARCA mRNA Kit with tailing
  • RT-PCR primers were used in the examples described herein: Human CCL5 qPCR primer pair (HP100784), Human CXCL10 qPCR pair (HP100690), Human CCL2 qPCR primer pair (HP104854), Human CXCL9 qPCR primer pair (HP100773) and Human CXCL12 qPCR primer pair (HP100192) were obtained from Sino Biological US Inc. (Chesterbrook, Pennsylvania). GAPDH was used as the endogenous control. Its primers — primer 1 (SEQ ID NO: 4) and primer 2 (SEQ ID NO: 5) — were obtained from Integrated DNA Technologies, Inc. (Coralville, Iowa). All of the primers used in the RT-PCR assay were used according to the manufacturer’s instructions.
  • NK Cells Engineered with a Multifunctional, Responsive CAR-Based Construct Can Target Multiple Antigens Widely Present in Human GBM
  • a gene-set scoring method was used to investigate a GBM RNA-seq patient dataset (156 patients) from The Cancer Genome Atlas (TCGA) through the Genomic Data Commons and relationships were identified between expression of certain functional genes and NK cell presence.
  • NK cell signature gene set including, for example, NCR1, NCR3, KLRB1, CD160, and PRF1
  • NT5E which encodes CD73
  • B4GALNT1 which encodes the enzyme that produces GD2
  • MICA/B which encodes common ligands for NKG2D
  • CCL5 and CXCL10 which encode two eponymous chemokines
  • NT5E and B4GALNT1 each had a negative correlation with individual genes that represented the NK signature set in GBM, suggesting that the antigens encoded by these genes act to suppress NK cell function and proliferation in GBM.
  • genes that are known to drive NK effector responses including the NKG2D-ligand encoding MICA/B, CCL5, and CXCL10, revealed a positive correlation with individual NK signature genes (r ⁇ 0) (see Figure 1, subpart A).
  • a Venn diagram showing the association of gene expression among patient numbers indicates a corresponding and expected lower number of patients expressing multiple gene combinations (see Figures 1C-1D).
  • the two pro-tumorigenic markers GD2 and CD73 are widely and heterogeneously expressed on different types of GBM, including patient-derived primary adult (GBM43), pediatric (SJ-GBM2), and recurrent adult (GBM10) brain tumor cells (see Figure 1, subpart E).
  • GBM43 patient-derived primary adult
  • SJ-GBM2 pediatric
  • GBM10 recurrent adult
  • the ectoenzyme CD73 was previously demonstrated to be a negative prognostic factor.
  • pNK cells were seeded into a 24-well plate at a density of 5 c 10 5 cells/well in 500 pL medium. Adenosine was then added to a final concentration of 1000 mM. After 24 h, the cells were collected and their viability (%) was determined via a CCK-8 assay (subpart A of Figure 2). The NKG2D expression (% and MFI) was determined by flow cytometry (subpart B of Figure 2). As shown in Figure 2, the presence of adenosine had a clear negative affect on cell viability and similarly decreased the expression of NKG2D.
  • a bicistronic vector was first engineered to express two individual CARs simultaneously, yielding NK cells expressing both a GD2.CD28.CD3 CAR (Construct 1A) and NKG2D.DAP 10C ⁇ 3z CAR (Construct IB).
  • Construct 1A was then further engineered in tandem, following a cleavable, tumor-sensitive linker, with an anti-CD73scFv to generate CD73-GD2.CD28.CD3z-CAR (Construct 1) (see Figures 3-4) and result in a construct configured for localized release of a CD73-blocking antibody fragment in the GBM TME independent of CAR activation.
  • Each CAR was separately expressed into NK-92 cells and expression of the corresponding CAR structure was verified ( Figure 5, subparts B, G and L). More specifically, mRNA individually derived from plasmid (1), (2) and (3) (referenced above) was synthesized through HiScribe TM T7 ARCA mRNA Kit (with tailing) (New England Biolabs, Ipswich, Massachusetts). All the mRNA products were concentrated and purified via EZ-10 Spin Column RNA Cleanup & Concentration Kit (Bio Basic Inc., Markham, Canada). After that, their concentrations were measured using a Qubit 4 Fluorometer (Thermo Fisher Scientific, Waltham, Massachusetts).
  • NK-92 cells were transfected with mRNA via TransIT ® -mRNA Transfection Kit (Mirus Bio LLC, Madison, Wisconsin) according to the manufacturer's recommended protocols. Briefly, NK-92 cells were plated in 12-well plates (5 c 10 5 cells/well in 1 mL complete growth medium). The mRNA (1 pg) was added into Opti-MEM (100 pL) in a sterile polystyrene tube and mixed well. Thereafter, the mRNA Boost Reagent (3 pL) and Trans Reagent (3 pL) were added and mixed sequentially. The tube was incubated at room temperature for 5 min, and the complexes were added dropwise to the cells. Following transfection, the cells were incubated at 37°C and 5% CO2 for 48 hours and then harvested for the CAR structures expression determination.
  • NKG2D expression expression of Construct IB and/or Construct 1
  • the cells were stained with APC-conjugated NKG2D antibody and analyzed by flow cytometry using a BD AccuriTM C6 Plus (Becton, Dickinson and Company, Franklin Lakes, New Jersey).
  • GD2.CAR expression expression of Construct 1 A and/or Construct 1
  • the cells were sequentially stained with Biotin-Protein L and APC-streptavidin and the levels of GD2.CAR expression were analyzed by flow cytometry.
  • expression of anti-CD73 scFv was determined by incubating the cells with various concentrations of uPA to trigger the removal of anti-CD73 scFv from the cell surface and the rest of the CAR-construct. Following this, the cells were stained with Biotin-Protein L and APC-streptavidin. The expression of the remaining construct was then analyzed by flow cytometry. The cell viability after transfection was measured by CCK-8 assay analysis (Dojindo Molecular Technologies, Inc., Rockville, Maryland).
  • NK- 92 cells When engineered to express the complete multifunctional sequence (Construct 1), NK- 92 cells showed a significant increase in NKG2D expression (Figure 5, subpart N), anti-GD2 scFv expression, and anti-CD73 scFv expression ( Figure 5, subpart O). As compared to NK-92 cells, primary NK (pNK) cells derived from the peripheral blood of healthy donors generally possess higher lytic activity against patient-derived GBM target cells.
  • pNK cells were isolated from healthy adult donors ( Figure 5, subpart P, and Figure 6) and engineered by lentiviral transduction in the presence of DEAE-dextran to express the full multifunctional Construct 1 (CD73.mCAR-pNK).
  • Cytokine-activated pNK cells (activated for 1 week of culture in NK-MACS ® medium) were engineered to express the functional CAR over two rounds of lentiviral transduction (pLVp[Exp]-Puro-EFlA> ⁇ CD73-CAR ⁇ ) with the help of dextran.
  • pLVp[Exp]-Puro-EFlA> ⁇ CD73-CAR ⁇ lentiviral transduction
  • pNK cells were plated in 24-well plates (5x10 5 cells/well in 0.5 mL RPMI1640 medium supplemented with 10% FBS and 500 U/mL IL-2).
  • the lentivirus supernatant was added at 10 multiplicity of infection (MOI) and, thereafter, the dextran aqueous solution was added to a final concentration of 8 pg/mL.
  • Each plate was centrifuged at lOOOg for 60 min and incubated overnight in a 37°C incubator infused with 5% CO2. After transduction, the CD73.mCAR-pNK cells were harvested and expanded under the NK-MACS ® medium until further use. The expression levels of all constructs were then measured and analyzed by flow cytometry according to the above- described protocol. The cell viability after transduction was measured by Trypan blue staining.
  • Multifunctional Engineered NK Cells Target Patient-Derived GBM Cells While Sparing Normal Cells
  • a killing assay was utilized with either NK-92, NKG2D.CAR-
  • NK92 (Construct IB), GD2.
  • C AR-NK92 (Construct 1A), CD73.mCAR-NK92 (Construct 1), pNK or CD73.mCAR-pNK cells were co-cultured with different target cells (SJ-GBM2, GBM43,
  • CD73.mCAR-NK92 or CD73.mCAR-pNK cells with expression of the entire construct were incubated with uPA to remove all the anti-CD73 scFv from the surface. After that, the killing ability of these cells against GBM43 target cells was measured.
  • GBM43 cells were seeded at 2 x 10 4 cells per well in a 96-well plate in complete DMEM. After overnight incubation, GBM43 cells were incubated with anti-CD73 scFv following uPA (100 nM)-mediated cleavage from either CD73.mCAR-NK92 or CD73.mCAR-pNK cells during incubation for 6 hours.
  • phosphate-free buffer 117 mM NaCl, 5.3 mM KC1, 1.8 mM MgCh, 26 mM NaHCCb, 10 mM glucose, pH 7.4, diluted in ddH20.
  • AMP 250 mM final
  • phosphate (Pi) concentrations resulting from AMP hydrolysis were measured using a malachite green phosphate assay kit following the manufacturer’s instructions.
  • CD73.mCAR-NK92 cells Compared to control NK-92 cells, CD73.mCAR-NK92 cells (expressing Construct 1) showed significantly improved killing of GBM43 cells after 4 h at various E/T ratios ( Figure 7, subpart A). Furthermore, co-culture with GBM43 cells stimulated CD73.mCAR-NK92 cells to induce degranulation as measured by cell surface CD107a expression ( Figure 7, subpart B) and up-regulate IFN-g secretion ( Figure 7, subpart C).
  • the human peripheral blood-derived NK cells genetically-engineered to express the multi-functional Construct 1 (CD73.mCAR-pNK), similarly resulted in efficient killing of SJ-GBM2 (pediatric), GBM43 (adult) and GBM 10 (recurrent) cells, to significantly higher levels than those of control non-engineered NK cells (see Figure 6 and Figure 7, subparts F-H).
  • Live imaging of the killing of GBM targets by native or engineered NK cells demonstrates the dynamic nature of this process and a higher killing specificity of GBM cells by CD73.mCAR-pNK cells as compared to that by native human NK cells (see Figure 9: GBM cells were seeded into a 24-well plate at a density of 4 x 104 cells/well. After overnight culture, either pNK or CD73.m.CAR-pNK cells were added to an E/T ratio at 5. The co-cultures were then imaged using an IncuCyte S3 with scans performed every 10 min for 4 hours.).
  • the anti-tumor specificity imparted upon NK cells by genetic expression of the multifunctional construct resulted in enhanced resistance to the loss of CD 16 upon contact with GBM cells (Figure 7, subpart M), as well as a reduced upregulation of NKG2A ( Figure 7, subpart N) as compared to changes observed on non-engineered human NK cells in response to GBM.
  • CD73.mCAR-pNK cells did not preferentially kill normal cells, specifically those belonging to neural lineages including hCMEC/D3 and HCN-2 cells. Instead, CD73.mCAR-pNK cells exhibited effector activity comparable to that of control non-engineered pNK cells against healthy brain cells (see Figure 7, subparts O and P).
  • CD73.mCAR-pNK cells Although multiple mechanisms may be involved in the targeting of such cells, including for example, a distinct pattern of inhibitory ligand expression, the low cytotoxicity rates induced by CD73.mCAR-pNK cells could be due to the relatively lower expression profiles for the targeted ligands on these cells compared with GBM cells (see Figure 10). Together, these observations indicate the functional superiority of CD73.mCAR-pNK cells, and represent a promising path forward for highly specific anti-GBM immunotherapies without observable toxicities to normal cells.
  • Autophagy is a critical cell survival mechanism leading to and driving cancer development and progression.
  • the effects of blocking autophagy in GBM were investigated via two approaches.
  • autophagy was blocked genetically, through the targeting the BECN1 gene via the generation of knockdown patient-derived GBM cells (/i/i. ’ (WAGBM43). More specifically, GBM43 cells were grown as previously described. Lentiviral BECN1 shRNA particles were used, according to the manufacturer’s instructions, to generate BECNE GBM43 cells. In vitro growth behavior of BECNE GBM43 was verified via CCK8 assay analysis.
  • CQ chloroquine
  • the target autophagic markers include BECN1, LC3B, p62 and b-actin (with Beclin 1 (BECNE), LC3-II ( LC3B ) and p62 being the three primary markers of autophagy).
  • chemokines The gradient between chemokines and their cognate receptors initiates the directional movement of cells to sites with higher concentrations to ultimately regulate immune cell trafficking to tumors. Stimulated by a paucity of insight into chemokine-mediated trafficking of NK cells to GBM, the consequence of inhibiting autophagy in GBM on the expression levels of a number of chemokines known to be associated with NK cell trafficking to tumors was studied.
  • RNAs were extracted using the mirVana TM miRNA Isolation Kit and the concentrations determined with a Qubit 4 Fluorometer.
  • the RNA (80 ng) from each sample was reverse-transcribed using the qScript TM One-Step SYBR ® Green qRT-PCR kit in a ViiA-7 RT- PCR system (Thermo Fisher Scientific, Waltham, Massachusetts).
  • the GAPDH gene was used as the endogenous control.
  • the comparative Ct values of genes of interest were normalized to the Ct value of GAPDH.
  • the 2 Act method was used to determine the relative expression of the genes, while the 2 AAct method was used to calculate fold changes of gene expression over control.
  • chemokine concentrations were quantified in the conditioned media of CQ-treated GBM43 cells using ELISA in absence and presence of various pharmacological inhibitors driving signaling pathways for these chemokines. This included the PI3K inhibitor LY294002, NF-KB inhibitor BAY11-7082 and JNK inhibitor SP600125.
  • GBM43 cells were treated with CQ at a final concentration of 50 mM in presence or absence of various small molecule inhibitors, including LY294002, BAY11-7082 and SP600125 for 24 hours.
  • Supernatants were collected and the levels of CCL5 and CXCL10 were quantified using Human CCL5 and CXCL10 Biolegend-ELISA MAXTM Deluxe Sets according to the manufacturer’s directions.
  • the cell culture supernatants were also collected and all the selected targets were determined with the chemokine array provided by Eve Technologies (Calgary, Canada).
  • the conditioned medium of control GBM43 cells displayed relatively low levels of both CCL5 (12.55 pg/mL) and CXCL10 (21.03 pg/mL) as compared with their expression of CCL2 (1324.95 pg/mL) and CXCL12 (69.2 pg/mL) (see Figure 14 and, in particular, subpart B thereof).
  • CQ-treated GBM43 cells secreted significantly higher amounts of both CCL5 and CXCL10 as compared with untreated control cells across the board (see Figure 12, subparts 4E and 4F).
  • BBB blood-brain barrier
  • the co-culture was grown in EBM-2 with media changes every other day for an additional 7 days before studies were conducted.
  • 600 pL of RPMI1640 medium supplemented with 1% FBS containing recombinant CCL5 or CXCL10 at 100 ng/mL was placed in the lower chamber of the Transwell ® plate.
  • Activated pNK cells (5 c 10 5 ) in 100 pL RPMI1640 medium supplemented with 1% FBS were placed into the upper chamber (5-pm pore size). After incubation for 6 hours at 37°C and 5% CO2, the number of pNK cells that migrated into the lower chamber was determined by flow cytometry. Data are presented as percentage of migration based on total cell input.
  • GBM43 cells (3 c 10 6 ) were inoculated subcutaneously (SC) in both flanks (GBM43 control cells in the right flanks and BECNEGBM43 cells in the left flanks) of Ragl /_ mice.
  • SC subcutaneously
  • the tumor growth was monitored and the length (L), width (W) and height (H) of the tumor were measured using a digital caliper.
  • IL-15 0.5 pg/mice
  • IP intraperitoneal
  • IC intracranial
  • CQ was continually injected 3 times a week (once/day) before administration of CD73.mCAR- pNK cells.
  • CD73.mCAR-pNK cells were administered once a week for three weeks. Tumor volumes were monitored and recorded using the Spectral Ami Optical imaging system. Body weights of the mice were also recorded during the treatment period. At the end of the treatment, the mice were sacrificed and whole brain tissues from each mouse were harvested for adenosine measurement and IHC/IF analyses.
  • Immunohistochemistry (IHC) and immunofluorescence (IF) staining were carried out at the Histology Research Laboratory at the Purdue University College of Veterinary Medicine (West Lafayette, Indiana). Briefly, the tumors were fixed in 10% neutral-buffered formalin, embedded in paraffin, and cut into 3-5 pm sections.
  • the mouse NK cells in tumors were detected through the staining using mouse NKp46/NCRl antibody.
  • the stained cells were counted in 5 randomly selected intratumoral fields of each slide at 200 x magnification.
  • CCL5 and CXCL10 expression in the tumors were detected through the staining using human CCL5/RANTES antibody and CXCL10 antibody respectively.
  • NK cell infiltration was investigated by IF staining performed with the following stains: Protein L (Alexa 647, far red), NKp46 (Alexa 488, green) and DAPI nuclear counterstain. CCL5 and CXCL10 expression were evaluated by IHC staining as described above. CD73 expression in the tumors was detected through the staining using human CD73 antibody.
  • the NK cells in tumors were detected through the staining using human NKp46/NCRl antibody.
  • CCL5 and CXCL10 expression in the tumors were detected through the staining using human CCL5/RANTES antibody and CXCL10 antibody, respectively.
  • CD73 expression in the tumors was detected through the staining using human CD73 antibody.
  • NK cells in BECNE tumors showed a higher distribution both at the tumor periphery and in intratumoral areas (see Figure 15). Further, the expression of CCL5 and CXCL10 was upregulated from relatively low baseline levels in control tumors to significantly higher levels in BECNE tumors ( Figure 12, subparts L, N, and O).
  • NK2G2DL expression (MFI and percentage) on GBM43 cells after 24 hours of treatment with various concentrations of CQ was evaluated.
  • GBM43 cells were first treated with CQ (varying concentrations), then collected and re seeded into 96 wells. After overnight culture, the NK cells (NK92 control cells and pNK cells against 5AC/V7 GBM43) were added at an E/T ratio of 5 and co-incubated for 4 h.
  • NKG2DL expression both % and MFI
  • CD73 decreased following CQ treatment, even at a low concentration of 6.25 mM (-70% of control) ( Figure 16, subpart B).
  • intratumoral adenosine concentrations were also assessed. Brain tissues were harvested post-treatment, rinsed with cold PBS and homogenized in PBS. After that, the suspension was centrifuged at 10,000g for 10 minutes at 4°C and the supernatant was collected. Adenosine concentrations were determined using an Adenosine Assay Kit according to the manufacturer’s directions. The IHC staining was performed as described above.
  • Multifunctional Engineered NK Cells Efficiently Target Patient-Derived GBM Tumors
  • a subcutaneous xenograft model was established by engrafting patient-derived GBM43 cells into NSG mice.
  • mice in the CQ group were subcutaneously (SC) implanted into the right flank of the mice (Day 0). 10 days later (Day 10), mice in the CQ group were intraperitoneally (IP) injected with CQ at 50 mg/kg for 3 weeks, once a week. One day later (Day 11), the mice in pNK and CD73.mCAR-pNK groups were treated with 5 c 10 6 adoptively-transferred pNK or CD73.mCAR-pNK cells intravenously (IV), once a week for 3 weeks. Starting on the day of the first injection of NK cells, all mice received 0.5 pg of IL-15 once every 3-4 days IP.
  • NK cell infiltration into GBM xenograft tumors was then investigated by IF staining.
  • subpart E adoptively transferred NK cells (light dots) were observed in tumor tissues from pNK cell-treated mice.
  • higher NK cell numbers were detected in tumors from CD73.mCAR-pNK cell-treated mice.
  • GBM43 xenograft orthotopic model in NSG mice was established.
  • GBM43 cells were genetically manipulated to express firefly luciferase (GBM43-Luc) to enable the monitoring of tumor growth via / « vivo bioluminescence imaging (see Figure 18). More specifically, cells (1000) were grown for 4 days in regular growth medium without puromycin. Total viability of cells over time was measured using the CCK-8 assay and plotted in a logarithmic scale. Both cells showed similar growth patterns and doubling times.
  • FIG 19 A schematic diagram illustrating the in vivo treatment program used herein is shown in Figure 19, subpart A.
  • NSG mice were orthotopically implanted with GBM43-Luc cells ( ⁇ 8xl0 4 ) and treated on day 10 post-implantation with weekly intraperitoneal (IP) injections of CQ for three weeks (50 mg/kg per day, 3 continuous days) and/or intracranial (IC) injections of CD73.mCAR-pNK cells (2 c 10 4 ).
  • IP intraperitoneal
  • IC intracranial
  • mice that were treated with either CD73.mCAR-pNK cells or CQ + CD73.mCAR- pNK cells showed obviously reduced tumor growth as determined by bioluminescence imaging (see Figure 19, subpart B).
  • the most potent anti -tumor response was seen with CQ + CD73.mCAR-pNK cells treated-mice.
  • tumors on half of the mice treated with CQ + CD73.mCAR-pNK cells showed significant arrest during the treatment period. No significant change in body weight of the mice in all groups were found throughout the entire treatment period ( Figure 19, subpart E).
  • mice in CQ-treated groups displayed robustly up-regulated chemokine expression, including CCL5 and CXCL10 (Figure 19, subpart F), which may contribute to the increased NK cell infiltration and lead to improved therapeutic efficacy.
  • Figure 19 subparts G and H, a significantly higher NK cell infiltration was found in GBM tumors of CQ + CD73.mCAR-pNK cell-treated mice as compared to mice that received CD73.mCAR-pNK cells alone.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Organic Chemistry (AREA)
  • Epidemiology (AREA)
  • Medicinal Chemistry (AREA)
  • Cell Biology (AREA)
  • Immunology (AREA)
  • Zoology (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Hematology (AREA)
  • Engineering & Computer Science (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
PCT/US2020/056723 2019-10-21 2020-10-21 Engineered natural killer cells and methods for using the same in immunotherapy and autophagy inhibition techniques Ceased WO2021081133A1 (en)

Priority Applications (5)

Application Number Priority Date Filing Date Title
AU2020371628A AU2020371628A1 (en) 2019-10-21 2020-10-21 Engineered natural killer cells and methods for using the same in immunotherapy and autophagy inhibition techniques
CA3155246A CA3155246A1 (en) 2019-10-21 2020-10-21 Engineered natural killer cells and methods for using the same in immunotherapy and autophagy inhibition techniques
EP20879537.7A EP4048292A4 (en) 2019-10-21 2020-10-21 Engineered natural killer cells and methods for using the same in immunotherapy and autophagy inhibition techniques
JP2022523383A JP2022553292A (ja) 2019-10-21 2020-10-21 操作されたナチュラルキラー細胞、ならびに免疫療法およびオートファジー阻害技法においてそれを使用するための方法
US17/770,585 US20220362299A1 (en) 2019-10-21 2020-10-21 Engineered natural killer cells and methods for using the same in immunotherapy and autophagy inhibiton techniques

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962923644P 2019-10-21 2019-10-21
US62/923,644 2019-10-21

Publications (1)

Publication Number Publication Date
WO2021081133A1 true WO2021081133A1 (en) 2021-04-29

Family

ID=75620220

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/056723 Ceased WO2021081133A1 (en) 2019-10-21 2020-10-21 Engineered natural killer cells and methods for using the same in immunotherapy and autophagy inhibition techniques

Country Status (6)

Country Link
US (1) US20220362299A1 (https=)
EP (1) EP4048292A4 (https=)
JP (1) JP2022553292A (https=)
AU (1) AU2020371628A1 (https=)
CA (1) CA3155246A1 (https=)
WO (1) WO2021081133A1 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11661459B2 (en) 2020-12-03 2023-05-30 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof
US11883432B2 (en) 2020-12-18 2024-01-30 Century Therapeutics, Inc. Chimeric antigen receptor system with adaptable receptor specificity
JP2024525807A (ja) * 2021-07-14 2024-07-12 スジョウ イミュノフォコ バイオテクノロジー カンパニー リミテッド 新規キメラ受容体組成物、組換えベクター、細胞およびそれらの応用
US12269888B2 (en) 2020-12-03 2025-04-08 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN120459135B (zh) * 2025-07-16 2025-10-10 深圳市中佳生物医疗科技有限公司 Cd73+nk细胞在制备预防或治疗帕金森的药物中的应用

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017186121A1 (zh) 2016-04-26 2017-11-02 科济生物医药(上海)有限公司 一种改善免疫应答细胞功能的方法
US20170343550A1 (en) * 2006-10-19 2017-11-30 Sanofi Novel anti-cd38 antibodies for the treatment of cancer
US20180230225A1 (en) * 2015-08-11 2018-08-16 Nanjing Legend Biotech Co., Ltd. Chimeric antigen receptors based on single-domain antibodies and methods of use thereof
US20190062456A1 (en) * 2014-11-21 2019-02-28 Bristol-Myers Squibb Company Antibodies against cd73 and uses thereof
US20190112380A1 (en) 2016-03-29 2019-04-18 University Of Southern California Chimeric antigen receptors targeting cancer

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2948544A4 (en) * 2013-01-28 2016-08-03 St Jude Childrens Res Hospital CHIMERIC RECEPTOR WITH NKG2D SPECIFICITY FOR CELL THERAPY AGAINST CANCER AND INFECTION DISEASES
GB201403972D0 (en) * 2014-03-06 2014-04-23 Ucl Business Plc Chimeric antigen receptor
GB2538120A (en) * 2014-11-11 2016-11-09 Medimmune Ltd Therapeutic combinations comprising anti-CD73 antibodies and uses thereof
US20180100016A1 (en) * 2016-12-22 2018-04-12 Xiaotong Song Use of car-modified human natural killer cells to treat cancer
CN110650975B (zh) * 2017-05-15 2024-04-05 美国卫生和人力服务部 双顺反子嵌合抗原受体及其用途

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170343550A1 (en) * 2006-10-19 2017-11-30 Sanofi Novel anti-cd38 antibodies for the treatment of cancer
US20190062456A1 (en) * 2014-11-21 2019-02-28 Bristol-Myers Squibb Company Antibodies against cd73 and uses thereof
US20180230225A1 (en) * 2015-08-11 2018-08-16 Nanjing Legend Biotech Co., Ltd. Chimeric antigen receptors based on single-domain antibodies and methods of use thereof
US20190112380A1 (en) 2016-03-29 2019-04-18 University Of Southern California Chimeric antigen receptors targeting cancer
WO2017186121A1 (zh) 2016-04-26 2017-11-02 科济生物医药(上海)有限公司 一种改善免疫应答细胞功能的方法

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
DING ET AL., INT J MOL SCI., 2018
See also references of EP4048292A4
WANG ET AL.: "NT5E/ CD 73 as Correlative Factor of Patient Survival and Natural Killer Cell Infiltration in Glioblastoma", J. CLIN MED, vol. 8, no. 1526, 23 September 2019 (2019-09-23), pages 1 - 14, XP055820694 *
WANG ET AL.: "Purinergic targeting enhances immunotherapy of CD 73 + solid tumors with piggyBac-engineered chimeric antigen receptor natural killer cells", J. IMMUNOTHER CANCER, vol. 6, no. 136, 4 December 2018 (2018-12-04), pages 1 - 14, XP021263637, DOI: 10.1186/s40425-018-0441-8 *

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11661459B2 (en) 2020-12-03 2023-05-30 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof
US12269888B2 (en) 2020-12-03 2025-04-08 Century Therapeutics, Inc. Artificial cell death polypeptide for chimeric antigen receptor and uses thereof
US11883432B2 (en) 2020-12-18 2024-01-30 Century Therapeutics, Inc. Chimeric antigen receptor system with adaptable receptor specificity
JP2024525807A (ja) * 2021-07-14 2024-07-12 スジョウ イミュノフォコ バイオテクノロジー カンパニー リミテッド 新規キメラ受容体組成物、組換えベクター、細胞およびそれらの応用
EP4372010A4 (en) * 2021-07-14 2025-04-23 Suzhou Immunofoco Biotechnology Co., Ltd. Novel chimeric receptor composition, recombinant vector, cell, and application thereof

Also Published As

Publication number Publication date
CA3155246A1 (en) 2021-04-29
EP4048292A4 (en) 2024-06-19
EP4048292A1 (en) 2022-08-31
JP2022553292A (ja) 2022-12-22
US20220362299A1 (en) 2022-11-17
AU2020371628A1 (en) 2022-05-19

Similar Documents

Publication Publication Date Title
US12559562B2 (en) Treatment of cancer using humanized anti-EGFRvIII chimeric antigen receptor
JP7157839B2 (ja) 癌治療のための免疫療法とサイトカイン制御療法との組み合わせ
AU2014236098B8 (en) Treatment of cancer using humanized anti-CD19 chimeric antigen receptor
US20220362299A1 (en) Engineered natural killer cells and methods for using the same in immunotherapy and autophagy inhibiton techniques
WO2021053667A2 (en) Combination cancer therapy and cytokine control therapy for cancer treatment
TW201827455A (zh) 用於治療癌症之表現膜錨定il-12之t細胞
US20230374454A1 (en) Human immune cells genomically modified to express orthogonal receptors
JP2024514149A (ja) uPARを標的とするCAR-T細胞及びその使用
US20250170182A1 (en) Epitope engineering of cell-surface receptors
AU2020350221A1 (en) Combination cancer therapy and cytokine control therapy for cancer treatment
US20220193138A1 (en) Engineered natural killer cells redirected toward purinergic signaling, constructs thereof, and methods for using the same
JP2023537104A (ja) シグレック6結合ポリペプチド
Zoine Developing novel cellular and gene therapies for pediatric malignancies
CN119894923A (zh) 包含tmigd2共刺激结构域的嵌合抗原受体及其相关使用方法
Valia Emerging Natural Killer Cell Immunotherapy for Acute Myeloid Leukemia
HK40012714B (en) Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
HK40012714A (en) Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
HK1218922B (en) Treatment of cancer using humanized anti-cd19 chimeric antigen receptor
HK1217498B (en) Treatment of cancer using humanized anti-egfrviii chimeric antigen receptor
BR122020024818B1 (pt) Molécula de ácido nucleico isolada, molécula polipeptídica isolada, molécula de car isolada, domínio de ligação anti-egfrviii, vetor, método para produção de uma célula e para gerar uma população de células modificadas por rna, e uso de uma quantidade eficaz de uma célula que expressa uma molécula de car

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20879537

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3155246

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2022523383

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020371628

Country of ref document: AU

Date of ref document: 20201021

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020879537

Country of ref document: EP

Effective date: 20220523