WO2021050571A1 - Novel nucleobase editors and methods of using same - Google Patents

Novel nucleobase editors and methods of using same Download PDF

Info

Publication number
WO2021050571A1
WO2021050571A1 PCT/US2020/049975 US2020049975W WO2021050571A1 WO 2021050571 A1 WO2021050571 A1 WO 2021050571A1 US 2020049975 W US2020049975 W US 2020049975W WO 2021050571 A1 WO2021050571 A1 WO 2021050571A1
Authority
WO
WIPO (PCT)
Prior art keywords
adenosine deaminase
mutations
cas9
domain
fusion protein
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/049975
Other languages
English (en)
French (fr)
Inventor
Nicole GAUDELLI
Michael Packer
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Beam Therapeutics Inc
Original Assignee
Beam Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from PCT/US2020/018195 external-priority patent/WO2020168135A1/en
Priority to EP20863422.0A priority Critical patent/EP4028026A4/en
Priority to CA3153624A priority patent/CA3153624A1/en
Priority to AU2020344547A priority patent/AU2020344547A1/en
Priority to US17/641,343 priority patent/US20230075877A1/en
Priority to JP2022514994A priority patent/JP7717684B2/ja
Application filed by Beam Therapeutics Inc filed Critical Beam Therapeutics Inc
Priority to CN202080077983.2A priority patent/CN114667149A/zh
Priority to KR1020227011386A priority patent/KR20220076467A/ko
Publication of WO2021050571A1 publication Critical patent/WO2021050571A1/en
Anticipated expiration legal-status Critical
Priority to JP2025122950A priority patent/JP2025170240A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/78Hydrolases (3) acting on carbon to nitrogen bonds other than peptide bonds (3.5)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/10Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/102Mutagenizing nucleic acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/52Genes encoding for enzymes or proenzymes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/16Hydrolases (3) acting on ester bonds (3.1)
    • C12N9/22Ribonucleases [RNase]; Deoxyribonucleases [DNase]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12YENZYMES
    • C12Y305/00Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5)
    • C12Y305/04Hydrolases acting on carbon-nitrogen bonds, other than peptide bonds (3.5) in cyclic amidines (3.5.4)
    • C12Y305/04004Adenosine deaminase (3.5.4.4)

Definitions

  • Targeted editing of nucleic acid sequences for example, the targeted cleavage or the targeted introduction of a specific modification into genomic DNA is a highly promising approach for the study of gene function and also has the potential to provide new therapies for human genetic diseases.
  • base editors include cytidine base editors (e.g., BE4) that convert target C*G base pairs to T ⁇ A and adenine base editors (e.g.,
  • the present invention features novel programmable nucleobase editors comprising adenosine deaminase domains (e.g., TadA*9 or ABE9), and methods of using the same for polynucleotide editing.
  • ABE9 of the invention edits a polynucleotide, e.g., a polynucleotide comprising a pathogenic mutation associated with a genetic disease.
  • an adenosine deaminase comprising an alteration at an amino acid position selected from the group consisting of 21, 23, 25, 38, 51, 54, 70, 71, 72, 73, 94, 124, 133, 139, 146, and 158 of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase: MPRQVFNAQK KAQSSTD (SEQ ID NO: 1) is provided.
  • the adenosine deaminase comprises an alteration selected from the group consisting of R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, M94V, P124W, T133K, D139L, D139M, C146R, and A158K of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase.
  • the adenosine deaminase further comprises a V 82T alteration of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase.
  • the adenosine deaminase comprises alterations at two or more amino acid positions selected from the group consisting of 21, 23, 25, 38, 51, 54, 70, 71, 72, 73, 94, 124, 133, 139, 146, and 158 of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase.
  • the adenosine deaminase of this aspect and embodiments thereof comprises two or more of the alterations.
  • the adenosine deaminase of this aspect and embodiments thereof comprises three or more of said alterations.
  • the adenosine deaminase of this aspect and embodiments thereof further comprises one or more of the following alterations: Y147T, Y147R, Q154S, Y123H, and Q154R.
  • the adenosine deaminase of this aspect and embodiments thereof comprises any one of the following groups of alterations:
  • the adenosine deaminase variant comprises any alteration or group of alterations as described in Table 14 or 18.
  • the adenosine deaminase of this aspect and embodiments thereof comprises a deletion of the C terminus beginning at a residue selected from the group consisting of 149, 150, 151, 152, 153, 154, 155, 156, and 157.
  • the adenosine deaminase of this aspect and embodiments thereof further comprises an alteration selected from the group consisting of Y147T, Y147R, Q154S, Y123H, V82S, T166R, and Q154R.
  • the adenosine deaminase of this aspect and embodiments thereof is an adenosine deaminase variant described in Table 14, Table 18, or FIGS. 3A-3C.
  • a fusion protein in which the fusion protein comprises a polynucleotide programmable DNA binding domain and at least one base editor domain that is an adenosine deaminase variant comprising an alteration at an amino acid position selected from the group consisting of 21, 23, 25, 38, 51, 54, 70, 71, 72, 73, 94, 124, 133, 139, 146, and 158 of the below SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase: 160 (SEQ ID NO: 1).
  • the adenosine deaminase variant comprises an alteration selected from the group consisting of R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, M94V, P124W, T133K, D139L, D139M, C146R, and A158K of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase.
  • a fusion protein in which the fusion protein comprises a polynucleotide programmable DNA binding domain and at least one base editor domain that is an adenosine deaminase variant comprising an alteration selected from the group consisting of R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, M94V, P124W, T133K, D139L, D139M, C146R, and A158K of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase.
  • the adenosine deaminase variant further comprises a V82T alteration of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase.
  • a fusion protein in which the fusion protein comprises a polynucleotide programmable DNA binding domain and at least one base editor domain that is an adenosine deaminase variant comprising an alteration V 82T and one or more alterations selected from the group consisting of R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, M94V, P124W, T133K, D139L, D139M, C146R, and A158K of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase.
  • the adenosine deaminase variant comprises alterations at two or more amino acid positions selected from the group consisting of 21, 23, 25, 38, 51, 54, 70, 71, 72, 73, 94, 124, 133, 139, 146, and 158 of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase.
  • the adenosine deaminase variant comprises two or more of the alterations.
  • the adenosine deaminase variant comprises three or more of the alterations.
  • the adenosine deaminase variant further comprises one or more of the following alterations: Y147T, Y147R, Q154S, Y123H, and Q154R.
  • the adenosine deaminase variant comprises a deletion of the C terminus beginning at a residue selected from the group consisting of 149, 150, 151, 152, 153, 154, 155, 156, and 157.
  • the base editor domain comprises an adenosine deaminase variant monomer, wherein the adenosine deaminase monomer comprises one or more alterations selected from the group consisting of R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, V82T, M94V, P124W, T133K, D139L, D139M, C146R, and A158K of SEQ ID NO: 1.
  • the base editor domain comprises an adenosine deaminase heterodimer comprising a wild-type adenosine deaminase domain and an adenosine deaminase variant.
  • the adenosine deaminase variant further comprises an alteration selected from the group consisting ofY147T, Y147R, Q154S, Y123H, V82S, T166R, and Q154R.
  • the base editor domain comprises an adenosine deaminase heterodimer comprising a TadA*7.10 domain and adenosine deaminase variant domain.
  • the adenosine deaminase variant comprises two or more alterations.
  • the adenosine deaminase variant is an ABE9 (TadA*9 deaminase variant) described in Table 14, Table 18, or FIGS. 3A-3C.
  • the adenosine deaminase variant is a truncated ABE8 or ABE9 that is missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 C-terminal amino acid residues relative to the full length ABE9.
  • the polynucleotide programmable DNA binding domain is a Cas9
  • fusion protein in which the fusion protein comprises a polynucleotide programmable DNA binding domain comprising the following sequence:
  • the bold sequence indicates sequence derived from Cas9
  • the italics sequence denotes a linker sequence
  • the underlined sequence denotes a bipartite nuclear localization sequence
  • at least one base editor domain comprising an adenosine deaminase variant comprising an alteration at an amino acid position selected from the group consisting of 21, 23, 25, 38, 51, 54, 70, 71, 72, 73, 94, 124, 133, 138, 139, 146, and 158 of SEQ ID NO: 1.
  • the adenosine deaminase variant comprises an alteration selected from the group consisting of R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, M94V, P124W, T133K, D138M, D139L, D139M, C146R, and A158K of SEQ ID NO: 1.
  • the adenosine deaminase variant comprises an alteration V82T of SEQ ID NO: 1.
  • the adenosine deaminase variant comprises two or more of said alterations.
  • the adenosine deaminase variant comprises three of more of said alterations. In an embodiment, the adenosine deaminase variant further comprises an alteration selected from the group consisting of Y147T, Y147R, Q154S, Y123H, V82S, T166R, and Q154R. In an embodiment, the adenosine deaminase variant comprises two or more of the following alterations: Y147T, Y147R, Q154S, Y123H, and Q154R.
  • the adenosine deaminase variant comprises any one of the following groups of alterations:
  • the adenosine deaminase variant comprises any other alteration or group of alterations as described in Table 14 or 18, or in FIGS. 3A-3C.
  • the polynucleotide programmable DNA binding domain is a Staphylococcus aureus Cas9 (SaCas9), Streptococcus thermophilus 1 Cas9 (StlCas9), a Streptococcus pyogenes Cas9 (SpCas9), or variants thereof.
  • the polynucleotide programmable DNA binding domain comprises a modified SaCas9 having an altered protospacer-adjacent motif (PAM) specificity.
  • the modified SaCas9 comprises amino acid substitutions E782K, N968K, and R1015H, or corresponding amino acid substitutions thereof.
  • the polynucleotide programmable DNA binding domain comprises a variant of SpCas9 having an altered protospacer-adjacent motif (PAM) specificity.
  • the altered PAM has specificity for the nucleic acid sequence 5'-NGA-3', 5'- NGC-3', 5'-NGG-3', 5'-NGT-3', or 5 '’-NGN-3'.
  • the variant SpCas9 comprises amino acid substitutions selected from: D1135M, S1136Q, G1218K, E1219F, A1322R, D1332A, R1335E, and T1337R, or corresponding amino acid substitutions thereof; I322V, S409I, E427G, R654L, R753G (MQKFRAER) or corresponding amino acid substitutions thereof; I322V, S409I, E427G, R654L, R753G, R1114G, or corresponding amino acid substitutions thereof; or amino acid substitutions as set forth in FIGS. 3A-3C.
  • the polynucleotide programmable DNA binding domain is a nuclease inactive or nickase variant.
  • the nickase variant comprises an amino acid substitution D10A or a corresponding amino acid substitution thereof.
  • the adenosine deaminase domain is capable of deaminating adenine in deoxyribonucleic acid (DNA).
  • the adenosine deaminase is a modified adenosine deaminase that does not occur in nature.
  • the adenosine deaminase is a TadA deaminase.
  • the adenosine deaminase is a TadA deaminase.
  • the TadA deaminase is a TadA*7.10 variant.
  • the fusion protein comprises a linker between the polynucleotide programmable DNA binding domain and the adenosine deaminase domain.
  • the linker comprises the amino acid sequence: SGGSSGGSSGSETPGTSESATPES.
  • the fusion proteins comprises one or more nuclear localization signals.
  • the nuclear localization signal is a bipartite nuclear localization signal.
  • the Cas9 is a StCas9.
  • the Cas9 is a SaCas9 or an SpCas9.
  • the Cas9 is a modified SaCas9 or a modified SpCas9.
  • the modified SaCas9 comprises amino acid substitutions E782K, N968K, and R1015H, or corresponding amino acid substitutions thereof.
  • the modified SaCas9 comprises the amino acid sequence:
  • a polynucleotide encoding the fusion protein of any one of the above-delineated aspects and embodiments thereof is provided.
  • a cell in which the cell is produced by introducing into the cell, or a progenitor thereof: a polynucleotide encoding the fusion protein of any one of the above-delineated aspects and embodiments thereof, and one or more guide polynucleotides that target the base editor to effect an A ⁇ T to G*C alteration of a SNP associated with a genetic disease.
  • the cell is a human cell.
  • the cell is in vitro or in vivo.
  • the genetic disease is alpha-1 antitrypsin deficiency (A1AD).
  • the fusion protein and the one or more guide polynucleotides forms a complex in the cell.
  • an isolated cell or population of cells propagated or expanded from the cell of the above-delineated aspect and embodiments thereof is provided.
  • a method of treating a genetic disease in a subject in need thereof comprises administering to the subject the cell, isolated cell, or population of cells of any one of the above-delineated aspects and embodiments thereof.
  • the cell, isolated cell, or population of cells is autologous, allogeneic, or xenogeneic to the subject.
  • a base editor system in which the base editor system comprises a polynucleotide programmable DNA binding domain and at least one base editor domain that is an adenosine deaminase variant comprising an alteration at an amino acid position selected from the group consisting of 21, 23, 25, 38, 51, 54, 70, 71, 72, 73, 82, 94, 124, 133, 139, 146, and 158 of the following SEQ ID NO: 1, a corresponding alteration in another adenosine deaminase: 160 (SEQ ID NO: 1).
  • the adenosine deaminase variant comprises an alteration selected from the group consisting of R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, V82T, M94V, P124W, T133K, D139L, D139M, C146R, and A158K of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase.
  • the base editor system further comprises one or more guide polynucleotides that target the base editor domain to effect an A ⁇ T to G*C alteration of a SNP associated with a genetic disease.
  • the adenosine deaminase variant is capable of deaminating adenine in deoxyribonucleic acid (DNA).
  • the guide polynucleotide comprises ribonucleic acid (RNA), or deoxyribonucleic acid (DNA).
  • the guide polynucleotide comprises a CRISPR RNA (crRNA) sequence, a trans-activating CRISPR RNA (tracrRNA) sequence, or a combination thereof.
  • the base editor system further comprises a second guide polynucleotide.
  • the second guide polynucleotide comprises ribonucleic acid (RNA), or deoxyribonucleic acid (DNA).
  • the second guide polynucleotide comprises a CRISPR RNA (crRNA) sequence, a trans-activating CRISPR RNA (tracrRNA) sequence, or a combination thereof.
  • the polynucleotide-programmable DNA-binding domain comprises a Cas9, Casl2a/Cpfl, Casl2b/C2cl, Casl2c/C2c3, Casl2d/CasY, Casl2e/CasX, Casl2g, Casl2h, Casl2i, or Casl2j/Cas ⁇ D domain.
  • the polynucleotide-programmable DNA-binding domain is nuclease dead.
  • the polynucleotide-programmable DNA-binding domain is a nickase.
  • the polynucleotide-programmable DNA-binding domain comprises a Cas9 domain.
  • the Cas9 domain comprises a nuclease dead Cas9 (dCas9), a Cas9 nickase (nCas9), or a nuclease active Cas9.
  • the Cas9 domain comprises a Cas9 nickase.
  • the polynucleotide-programmable DNA- binding domain is an engineered or a modified polynucleotide-programmable DNA-binding domain.
  • the genetic disease is alpha-1 antitrypsin deficiency (A1AD).
  • a method for correcting a single nucleotide polymorphism (SNP) in a polynucleotide comprises: contacting a target nucleotide sequence, at least a portion of which is located in the polynucleotide or its reverse complement, with a fusion protein of any one of the above-delineated aspects and embodiments thereof, or the base editor system of any one of the above-delineated aspects and embodiments thereof; and editing the SNP by deaminating the SNP or its complement nucleobase upon targeting of the base editor to the target nucleotide sequence, wherein deaminating the SNP or its complement nucleobase corrects the SNP.
  • the SNP is associated with alpha-1 antitrypsin deficiency (A1AD).
  • the SNP is in the SERPINA1 gene and the correction comprises an E342K (PiZ allele) alteration.
  • a method for editing a polynucleotide comprises contacting a target nucleotide sequence with the fusion protein of any one of the above-delineated aspects and embodiments thereof, or the base editor system of any one of the above-delineated aspects and embodiments thereof, thereby editing the polynucleotide.
  • the editing results in less than 20% indel formation, less than 15% indel formation, less than 10% indel formation; less than 5% indel formation; less than 4% indel formation; less than 3% indel formation; less than 2% indel formation; less than 1% indel formation; less than 0.5% indel formation; or less than 0.1% indel formation.
  • the editing does not result in translocations.
  • a base editor comprising an ABE9 (TadA*9 deaminase variant) comprising a TadA*7.10 adenosine deaminase variant domain and a Cas9 endonuclease domain selected from the following: monoTadA*7.10 having mutations I76Y+V82T+Y147T+Q154S+A109S of SEQ ID NO: 1, and spCas9 having mutations I322V, S409I, E427G, R654L, R753G (MQKFRAER); monoTadA*7.10 having mutations I76Y+V82T+Y147T+Q154S+T111R of SEQ ID NO: 1, and spCas9 having mutations I322V, S409I, E427G, R654L, R753G (MQKFRAER); monoTadA*7.10 having mutations I76Y+V82T+Y147T
  • a vector in which the vector comprises one or more polynucleotides encoding an ABE9 base editor comprising a TadA adenosine deaminase domain and an SpCas9 endonuclease domain selected from monoTadA*7.10 having mutations I76Y+V82T+Y147T+Q154S+A109S and spCas9 having mutations I322V, S409I, E427G, R654L, R753G (MQKFRAER); monoTadA*7.10 having mutations I76Y+V82T+Y147T+Q154S+T111R and spCas9 having mutations I322V, S409I, E427G, R654L, R753G (MQKFRAER); monoTadA*7.10 having mutations I76Y+V82T+Y147T+Q154S+D119N and spCas9 having
  • composition in which the composition comprises the fusion protein of any one of the above-delineated aspects and embodiments thereof or the base editor system of any one of the above-delineated aspects and embodiments thereof.
  • the composition further comprises a pharmaceutically acceptable excipient, diluent, or carrier.
  • composition comprising the fusion protein of any one of the above-delineated aspects and embodiments thereof bound to a guide RNA
  • the guide RNA comprises a nucleic acid sequence that is complementary to an SERPINA1 gene associated with alpha-1 antitrypsin deficiency (A1AD).
  • composition comprising the base editor system of any one of the above-delineated aspects and embodiments thereof bound to a guide RNA
  • the guide RNA comprises a nucleic acid sequence that is complementary to an SERPINA1 gene associated with alpha-1 antitrypsin deficiency (A1AD).
  • the adenosine deaminase variant is capable of deaminating adenine in deoxyribonucleic acid (DNA).
  • compositions of any one of the above-delineated aspects and embodiments thereof the fusion protein or base editor system
  • (i) comprises a Cas9 nickase
  • (ii) comprises a nuclease inactive Cas9
  • (iii) comprises an SpCas9 variant comprising a combination of amino acid substitutions shown in FIGS. 3A-3C; or
  • (iv) comprises an SpCas9 variant comprising a combination of amino acid sequence substitutions selected from I322V, S409I, E427G, R654L, R753G (MQKFRAER); or I322V, S409I, E427G, R654L, R753G, R1114G, (MQKFRAER).
  • the composition further comprises a pharmaceutically acceptable excipient, diluent, or carrier, i.e., a pharmaceutical composition.
  • a pharmaceutical composition for the treatment of a disease or disorder comprising the composition further comprising a pharmaceutically acceptable excipient, diluent, or carrier is provided.
  • the disease or disorder is alpha-1 antitrypsin deficiency (A1 AD).
  • the fusion protein or the base editor system is bound to a guide RNA, wherein the guide RNA comprises a nucleic acid sequence that is complementary to an SERPINA1 gene associated with alpha-1 antitrypsin deficiency (A1AD).
  • the gRNA and the base editor are formulated together or separately.
  • the gRNA comprises a nucleic acid sequence, from 5' to 3', or a 1, 2, 3, 4, or 5 nucleotide 5' truncation fragment thereof, selected from one or more of
  • the pharmaceutical composition further comprises a vector suitable for expression in a mammalian cell, wherein the vector comprises a polynucleotide encoding the base editor.
  • the polynucleotide encoding the base editor is mRNA.
  • the vector is a viral vector.
  • the viral vector is a retroviral vector, adenoviral vector, lentiviral vector, herpesvirus vector, or adeno-associated viral vector (AAV).
  • the pharmaceutical composition further comprises a ribonucleoparticle suitable for expression in a mammalian cell.
  • the pharmaceutical composition further comprises a lipid.
  • a method of treating alpha-1 antitrypsin deficiency comprises administering to a subject in need thereof the pharmaceutical composition of any one of the above-delineated aspects and embodiments thereof.
  • the subject is a human.
  • the adenosine deaminase variant comprises any one of the following groups of alterations:
  • the adenosine deaminase variant e.g., TadA*9 deaminase variant
  • amino acid alterations in other adenosine deaminases may be readily determined by performing routine sequence alignments and assessing relatedness and/or identities of the amino acid sequence of SEQ ID NO: 1 and the sequences, or relevant portions thereof, of other adenosine deaminase(s), such as TadA deaminases and the like, as described supra.
  • the amino acid sequence of another adenosine deaminase comprises at least 85% sequence identity to SEQ ID NO: 1.
  • the amino acid sequence of another adenosine deaminase comprises at least 90% sequence identity to SEQ ID NO: 1. In an embodiment, the amino acid sequence of another adenosine deaminase comprises at least 95% sequence identity to SEQ ID NO: 1. In an embodiment, the amino acid sequence of another adenosine deaminase comprises at least 98% sequence identity to SEQ ID NO: 1. In an embodiment, the amino acid sequence of another adenosine deaminase comprises at least 99% sequence identity to SEQ ID NO:l.
  • adenosine deaminase in another aspect is provided the above-delineated adenosine deaminase, fusion protein, base editor, or base editor system and embodiments thereof, comprising the adenosine deaminase or adenosine deaminase variant, which is a TadA*7.10 variant comprising any one of the following amino acid alterations or groups of alterations: V82T; I76Y + V82T; or I76Y + V82T + Y147T + Q154S.
  • an adenosine deaminase variant which is a TadA*7.10 variant comprising any one of the following amino acid alterations or groups of alterations: V82T; I76Y + V82T; or I76Y + V82T + Y147T + Q154S.
  • a fusion protein in which the fusion protein comprises a polynucleotide programmable DNA binding domain and at least one base editor domain that is an TadA*7.10 adenosine deaminase variant comprising any one of the following amino acid alterations or groups of alterations: V82T; I76Y + V82T; or I76Y + V82T + Y147T + Q154S.
  • the polynucleotide programmable DNA binding domain comprises a Cas9 endonuclease domain.
  • the Cas9 endonuclease domain comprises spCas9 having mutations I322V, S409I, E427G, R654L, R753G (MQKFRAER).
  • the TadA7*10 is monomeric.
  • a nucleobase editor in which the nucleobase editor comprises a TadA*7.10 adenosine deaminase variant domain and a Cas9 endonuclease domain selected from the following: monoTadA*7.10 having mutation V82T and spCas9 having mutations I322V, S409I, E427G, R654L, R753G (MQKFRAER); monoTadA*7.10 having mutations I76Y + V82T and spCas9 having mutations I322V, S409I, E427G, R654L, R753G (MQKFRAER); or monoTadA*7.10 having mutations I76Y + V82T + Y147T + Q154S and spCas9 having mutations I322V, S409I, E427G, R654L, R753G (MQKFRAER).
  • the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method or composition of the present disclosure, and vice versa. Furthermore, compositions of the present disclosure can be used to achieve methods of the present disclosure.
  • the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, e.g., within 5-fold, within 2-fold of a value. Where particular values are described in the application and claims, unless otherwise stated, the term “about” means within an acceptable error range for the particular value should be assumed.
  • adenosine deaminase is meant a polypeptide or fragment thereof capable of catalyzing the hydrolytic deamination of adenine or adenosine.
  • the deaminase or deaminase domain is an adenosine deaminase catalyzing the hydrolytic deamination of adenosine to inosine or deoxy adenosine to deoxyinosine.
  • the adenosine deaminase catalyzes the hydrolytic deamination of adenine or adenosine in deoxyribonucleic acid (DNA).
  • the adenosine deaminases e.g., engineered adenosine deaminases, evolved adenosine deaminases
  • the adenosine deaminases may be from any organism, such as a bacterium.
  • the deaminase or deaminase domain is a variant of a naturally- occurring deaminase from an organism, such as a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse. In some embodiments, the deaminase or deaminase domain does not occur in nature.
  • the deaminase or deaminase domain is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring deaminase.
  • the adenosine deaminase is from a bacterium, such as, E. coli, S. aureus, S. typhi, S. putrefaciens, H. influenzae, or C. crescentus.
  • the adenosine deaminase is a TadA deaminase.
  • the TadA deaminase is an E. coli TadA (ecTadA) deaminase or a fragment thereof.
  • deaminase domains are described in International PCT Application Nos. PCT/2017/045381 (WO 2018/027078) and PCT/US2016/058344 (WO 2017/070632), each of which is incorporated herein by reference for its entirety.
  • a wild type TadA(wt) adenosine deaminase has the following sequence (also termed TadA reference sequence):
  • the adenosine deaminase comprises an alteration in the following sequence:
  • the present invention features novel nucleobase editors, where the alterations are made relative to a TadA*7.10 reference sequence.
  • TadA*7.10 comprises at least one alteration. In some embodiments, TadA*7.10 comprises an alteration at amino acid 82 and/or 166. In particular embodiments, a variant of the above-referenced sequence comprises one or more of the following alterations: Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R.
  • the alteration Y123H refers to the alteration H123Y in TadA*7.10 reverted back to Y123H TadA(wt).
  • a variant of the TadA*7.10 sequence comprises one or more of the following alterations R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, M94V, P124W, T133K, D139L, D139M, C146R, and A158K of SEQ ID NO: 1.
  • a variant of the TadA*7.10 sequence comprises a combination of alterations selected from the group consisting of Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + 176 Y; V82S + Y123H + Y147R + Q154R; and I76Y + V82S + Y123H + Y147R + Q154R.
  • the invention provides adenosine deaminase variants that include deletions, e.g., TadA*8, comprising a deletion of the C-terminus beginning at residue 149, 150, 151, 152, 153, 154, 155, 156, or 157, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • deletions e.g., TadA*8
  • TadA*8 comprising a deletion of the C-terminus beginning at residue 149, 150, 151, 152, 153, 154, 155, 156, or 157, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • the adenosine deaminase variant is a homodimer comprising two adenosine deaminase domains each having one or more of the following alterations Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • the adenosine deaminase variant is a homodimer comprising two adenosine deaminase domains (e.g., TadA*8) each having a combination of alterations selected from the group of: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82S + Y123H + Y147R + Q154R; and I
  • the adenosine deaminase variant is a heterodimer comprising a wild-type TadA adenosine deaminase domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising one or more of the following alterations Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • TadA*8 a heterodimer comprising a wild-type TadA adenosine deaminase domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising one or more of the following alterations Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R, relative to Tad
  • the adenosine deaminase variant is a heterodimer comprising a wild-type TadA adenosine deaminase domain and an adenosine deaminase variant domain (e.g.
  • TadA*8 comprising a combination of alterations selected from the group of: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + 176 Y; V82S + Y123H + Y147R + Q154R; and I76Y + V82S + Y123H + Y147R + Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another Tad
  • the adenosine deaminase variant is a heterodimer comprising a TadA*7.10 domain and an adenosine deaminase variant domain (e.g., TadA*8) comprising one or more of the following alterations Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • TadA*8 adenosine deaminase variant domain
  • TadA*8 adenosine deaminase variant domain comprising one or more of the following alterations Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R, relative to TadA*7.10, the TadA reference sequence, or a corresponding mutation in another TadA.
  • the adenosine deaminase variant is a heterodimer comprising a TadA*7.10 domain and an adenosine deaminase variant domain (e.g. TadA*8) comprising a combination of the following alterations: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82S + Y123H + Y147R + T166R;
  • the TadA*8 is truncated. In some embodiments, the truncated TadA*8 is missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 N- terminal amino acid residues relative to the full length TadA*8. In some embodiments, the truncated Tad A* 8 is missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 C-terminal amino acid residues relative to the full length TadA*8. In some embodiments the adenosine deaminase variant is a full-length TadA*8.
  • an adenosine deaminase heterodimer comprises an TadA*8 domain and an adenosine deaminase domain selected from one of the following: Staphylococcus aureus (S. aureus) TadA:
  • ABE8 polynucleotide is meant a polynucleotide encoding an ABE8.
  • Adenosine Deaminase Base Editor 9 ABE9 polypeptide
  • ABE9 a base editor as defined herein comprising an adenosine deaminase variant (TadA* 9) comprising one or more alterations at positions ssssss of the sequence shown below.
  • the adenosine deaminase variant (TadA*9) comprises following alterations: R21N, R23H,
  • ABE9 comprises further alterations, as described herein, relative to the reference sequence.
  • ABE9 polynucleotide is meant a polynucleotide encoding an ABE9.
  • alpha-1 antitrypsin (A1AT) protein is meant a polypeptide or fragment thereof having at least about 95% amino acid sequence identity to UniProt Accession No. P01009.
  • an A1AT protein comprises one or more alterations relative to the following reference sequence.
  • an A1AT protein associated with A1 AD comprises an E342K mutation.
  • An exemplary A1AT amino acid sequence is >sp
  • the first 24 amino acids constitute the signal peptide (underlined).
  • Position 342 of the sequence, which is mutated in A1AD i.e., E342K
  • composition administration is referred to herein as providing one or more compositions described herein to a patient or a subject.
  • composition administration e.g., injection
  • s.c. sub-cutaneous injection
  • i.d. intradermal
  • i.p. intraperitoneal
  • intramuscular injection intramuscular injection.
  • Parenteral administration can be, for example, by bolus injection or by gradual perfusion over time.
  • administration can be by an oral route.
  • agent any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
  • alteration is meant a change (increase or decrease) in the sequence, expression levels, or activity of a gene or polypeptide as detected by standard art known methods, such as those described herein.
  • an alteration includes a 10% change in expression levels, a 25% change, a 40% change, and a 50% or greater change in expression levels.
  • ameliorate is meant decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease.
  • an analog is meant a molecule that is not identical, but has analogous functional or structural features.
  • a polypeptide analog retains the biological activity of a corresponding naturally-occurring polypeptide, while having certain biochemical modifications that enhance the analog's function relative to a naturally occurring polypeptide. Such biochemical modifications could increase the analog's protease resistance, membrane permeability, or half-life, without altering, for example, ligand binding.
  • An analog may include an unnatural amino acid.
  • base editor By “base editor (BE),” or “nucleobase editor (NBE)” is meant an agent that binds a polynucleotide and has nucleobase modifying activity.
  • the base editor comprises a nucleobase modifying polypeptide (e.g., a deaminase) and a polynucleotide programmable nucleotide binding domain in conjunction with a guide polynucleotide (e.g., guide RNA).
  • the agent is a biomolecular complex comprising a protein domain having base editing activity, i.e., a domain capable of modifying a base (e.g., A, T, C, G, or U) within a nucleic acid molecule (e.g., DNA).
  • a protein domain having base editing activity i.e., a domain capable of modifying a base (e.g., A, T, C, G, or U) within a nucleic acid molecule (e.g., DNA).
  • the polynucleotide programmable DNA binding domain is fused or linked to a deaminase domain.
  • the agent is a fusion protein comprising one or more domains having base editing activity.
  • the protein domains having base editing activity are linked to the guide RNA (e.g., via an RNA binding motif on the guide RNA and an RNA binding domain fused to the deaminase).
  • the domains having base editing activity are capable of deaminating a base within a nucleic acid molecule.
  • the base editor is capable of deaminating one or more bases within a DNA molecule.
  • the base editor is capable of deaminating a cytosine (C) or an adenosine (A) within DNA.
  • the base editor is capable of deaminating a cytosine (C) and an adenosine (A) within DNA.
  • the base editor is a cytidine base editor (CBE).
  • the base editor is an adenosine base editor (ABE).
  • the base editor is an adenosine base editor (ABE) and a cytidine base editor (CBE).
  • the base editor is a nuclease-inactive Cas9 (dCas9) fused to an adenosine deaminase.
  • the Cas9 is a circular permutant Cas9 (e.g., spCas9 or saCas9). Circular permutant Cas9s are known in the art and described, for example, in Oakes et al, Cell 176, 254-267, 2019.
  • the base editor is fused to an inhibitor of base excision repair, for example, a UGI domain, or a dISN domain.
  • the fusion protein comprises a Cas9 nickase fused to a deaminase and an inhibitor of base excision repair, such as a UGI or dISN domain.
  • the base editor is an abasic base editor.
  • an adenosine deaminase is evolved from TadA.
  • the polynucleotide programmable DNA binding domain is a CRISPR associated (e.g., Cas or Cpfl) enzyme.
  • the base editor is a catalytically dead Cas9 (dCas9) fused to a deaminase domain.
  • the base editor is a Cas9 nickase (nCas9) fused to a deaminase domain.
  • the base editor is fused to an inhibitor of base excision repair (BER).
  • the inhibitor of base excision repair is a uracil DNA glycosylase inhibitor (UGI).
  • the inhibitor of base excision repair is an inosine base excision repair inhibitor. Details of base editors are described in International PCT Application Nos.
  • base editors are generated (e.g., ABE8 or ABE9) by cloning an adenosine deaminase variant (e.g., TadA*8) into a scaffold that includes a circular permutant Cas9 (e.g., spCAS9) and a bipartite nuclear localization sequence.
  • Circular permutant Cas9s are known in the art and described, for example, in Oakes et al, Cell 176, 254-267, 2019. Exemplary circular permutant sequences are set forth below, in which the bold sequence indicates sequence derived from Cas9, the italics sequence denotes a linker sequence, and the underlined sequence denotes a bipartite nuclear localization sequence.
  • the ABE8 is selected from a base editor from Table 10, 11 or 13 infra. In some embodiments, ABE8 contains an adenosine deaminase variant evolved from TadA. In some embodiments, the adenosine deaminase variant of ABE8 is a TadA*8 variant as described in Table 8, 10, 11, or 13 infra. In some embodiments, the adenosine deaminase variant is the TadA*7.10 variant (e.g., TadA*8) comprising one or more of an alteration selected from the group consisting of Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R.
  • TadA*8 comprising one or more of an alteration selected from the group consisting of Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R.
  • ABE8 comprises TadA*7.10 variant (e.g. TadA*8) with a combination of alterations selected from the group of Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82S + Y123H + Y147R + Q154R; and I76Y + V82S + Y123H + Y147R + Q154R.
  • TadA*8 comprises TadA*7.1
  • the ABE8 is a monomeric construct containing one copy of a TadA deaminase, e.g., a TadA*8 variant. In some embodiments, the ABE8 is a dimeric or heterodimeric construct containing more than one, e.g., two, copies of the same or different TadA deaminase, e.g., a wild-type TadA and a TadA*8 variant. In some embodiments, the ABE9 is selected from a base editor from Table 14 infra.
  • ABE9 contains an adenosine deaminase variant evolved from TadA.
  • the adenosine deaminase variant of ABE9 is a TadA*7.10 variant as described in Table 14.
  • the adenosine deaminase variant is TadA*7.10 comprising one or more alterations selected from the group consisting of Y147T, Y147R, Q154S, Y123H, V82S, T166R, Q154R.
  • ABE9 comprises TadA*7.10 with alterations selected from the following: Y147R + Q154R +Y123H; Y147R + Q154R + 176 Y; Y147R + Q154R + T166R; Y147T + Q154R; Y147T + Q154S; V82S + Q154S; V82T + Q154S and Y123H + Y147R + Q154R + I76Y, in addition to those listed in Table 14.
  • the ABE9 is a monomeric construct containing one copy of a TadA deaminase, e.g., a TadA* 9 variant.
  • the ABE9 is a dimeric or heterodimeric construct containing more than one, e.g., two, copies of the same or different TadA deaminase, e.g., a wild-type TadA and a TadA*9 variant.
  • the ABE9 base editor comprises the sequence:
  • the adenine base editor ABE to be used in the base editing compositions, systems and methods described herein has the nucleic acid sequence (8877 base pairs), (Addgene, Watertown, MA.; Gaudelli NM, et al, Nature. 2017 Nov 23;551(7681):464-471. doi: 10.1038/nature24644; Koblan LW, etal, Nat Biotechnol. 2018 Oct;36(9): 843-846. doi: 10.1038/nbt.4172.) as provided below.
  • Polynucleotide sequences having at least 95% or greater identity to the ABE nucleic acid sequence are also encompassed.
  • base editing activity is meant acting to chemically alter a base within a polynucleotide.
  • a first base is converted to a second base.
  • the base editing activity is cytidine deaminase activity, e.g., converting target OG to T ⁇ A.
  • the base editing activity is adenosine or adenine deaminase activity, e.g., converting A ⁇ T to G*C.
  • the base editing activity is cytidine deaminase activity, e.g., converting target OG to T ⁇ A and adenosine or adenine deaminase activity, e.g., converting A ⁇ T to G*C.
  • base editor system refers to a system for editing a nucleobase of a target nucleotide sequence.
  • the base editor (BE) system comprises (1) a polynucleotide programmable nucleotide binding domain, a deaminase domain (e.g., a cytidine deaminase or adenosine deaminase) for deaminating nucleobases in the target nucleotide sequence; and (2) one or more guide polynucleotides (e.g., guide RNA) in conjunction with the polynucleotide programmable nucleotide binding domain.
  • a deaminase domain e.g., a cytidine deaminase or adenosine deaminase
  • guide polynucleotides e.g., guide RNA
  • the base editor (BE) system comprises a nucleobase editor domain selected from an adenosine deaminase or a cytidine deaminase, and a domain having nucleic acid sequence specific binding activity.
  • the base editor system comprises (1) a base editor (BE) comprising a polynucleotide programmable DNA binding domain and a deaminase domain for deaminating one or more nucleobases in a target nucleotide sequence; and (2) one or more guide RNAs in conjunction with the polynucleotide programmable DNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain.
  • the base editor is a cytidine base editor (CBE). In some embodiments, the base editor is an adenine or adenosine base editor (ABE). In some embodiments, the base editor is an adenine or adenosine base editor (ABE) or a cytidine base editor (CBE).
  • Cas9 or “Cas9 domain” refers to an RNA guided nuclease comprising a Cas9 protein, or a fragment thereof (e.g, a protein comprising an active, inactive, or partially active DNA cleavage domain of Cas9, and/or the gRNA binding domain of Cas9).
  • a Cas9 nuclease is also referred to sometimes as a casnl nuclease or a CRISPR (clustered regularly interspaced short palindromic repeat) associated nuclease.
  • An exemplary Cas9 is Streptococcus pyogenes Cas9 (spCas9), the amino acid sequence of which is provided below:
  • GGD single underline: HNH domain; double underline: RuvC domain
  • Casl2b or “Casl2b domain” refers to an RNA-guided nuclease comprising a Casl2b/C2cl protein, or a fragment thereof (e.g., a protein comprising an active, inactive, or partially active DNA cleavage domain of Casl2b, and/or the gRNA binding domain of Casl2b). contents of each of which are incorporated herein by reference).
  • Casl2b orthologs have been described in various species, including, but not limited to, Alicyclobacillus acidoterrestris, Alicyclobacillus acidophilus (Teng etal., Cell Discov. 2018 Nov 27;4:63 ), Bacillus hisashi, and Bacillus sp. V3-13. Additional suitable Cas 12b nucleases and sequences will be apparent to those of skill in the art based on this disclosure.
  • proteins comprising Casl2b or fragments thereof are referred to as “Cas 12b variants.”
  • a Cas 12b variant shares homology to Cas 12b, or a fragment thereof.
  • a Casl2b variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to wild type Casl2b.
  • the Casl2b variant may have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more amino acid changes compared to wild type Casl2b.
  • the Cas 12b variant comprises a fragment of Cas 12b (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to the corresponding fragment of wild type Casl2b.
  • a fragment of Cas 12b e.g., a gRNA binding domain or a DNA-cleavage domain
  • the fragment is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the amino acid length of a corresponding wild type Casl2b.
  • Exemplary Casl2b polypeptides are listed below.
  • Casl2b/C2cl (uniprot.org/uniprot/T0D7 A2#2) sp
  • C2cl OS Alicyclobacillus acido- terrestris (strain ATCC 49025 / DSM 3922/ CIP 106132 /NCIMB 13137/GD3B)
  • BvCasl2b V4 includes the changes S893R, K846R, and E837G relative to the wild-type sequence above. L.
  • “conservative amino acid substitution” or “conservative mutation” refers to the replacement of one amino acid by another amino acid with a common property.
  • a functional way to define common properties between individual amino acids is to analyze the normalized frequencies of amino acid changes between corresponding proteins of homologous organisms (Schulz, G. E. and Schirmer, R. H., Principles of Protein Structure, Springer-Verlag, New York (1979)). According to such analyses, groups of amino acids can be defined where amino acids within a group exchange preferentially with each other, and therefore resemble each other most in their impact on the overall protein structure (Schulz, G. E. and Schirmer, R. H., supra).
  • Non-limiting examples of conservative mutations include amino acid substitutions of amino acids, for example, lysine for arginine and vice versa such that a positive charge can be maintained; glutamic acid for aspartic acid and vice versa such that a negative charge can be maintained; serine for threonine such that a free -OH can be maintained; and glutamine for asparagine such that a free -NH2 can be maintained.
  • coding sequence or “protein coding sequence” as used interchangeably herein refers to a segment of a polynucleotide that codes for a protein. Coding sequences can also be referred to as open reading frames. The region or sequence is bounded nearer the 5’ end by a start codon and nearer the 3’ end with a stop codon. Stop codons useful with the base editors described herein include the following:
  • cytidine deaminase is meant a polypeptide or fragment thereof capable of catalyzing a deamination reaction that converts an amino group to a carbonyl group.
  • the cytidine deaminase converts cytosine to uracil or 5-methylcytosine to thymine.
  • PmCDAl which is derived from Petromyzon marinus ( Petromyzon marinus cytosine deaminase 1, “PmCDAl”), AID (Activation-induced cytidine deaminase; AICDA), which is derived from a mammal (e.g., human, swine, bovine, horse, monkey etc.), and APOBEC are exemplary cytidine deaminases.
  • deaminase or “deaminase domain,” as used herein, refers to a protein or enzyme that catalyzes a deamination reaction.
  • the deaminase or deaminase domain is a cytidine deaminase, catalyzing the hydrolytic deamination of cytidine or deoxy cytidine to uridine or deoxyuridine, respectively.
  • the deaminase or deaminase domain is a cytosine deaminase, catalyzing the hydrolytic deamination of cytosine to uracil.
  • the deaminase is an adenosine deaminase, which catalyzes the hydrolytic deamination of adenine to hypoxanthine.
  • the deaminase is an adenosine deaminase, which catalyzes the hydrolytic deamination of adenosine or adenine (A) to inosine (I).
  • the deaminase or deaminase domain is an adenosine deaminase, catalyzing the hydrolytic deamination of adenosine or deoxy adenosine to inosine or deoxyinosine, respectively.
  • the adenosine deaminase catalyzes the hydrolytic deamination of adenosine in deoxyribonucleic acid (DNA).
  • the adenosine deaminase e.g engineered adenosine deaminase, evolved adenosine deaminase
  • the adenosine deaminase can be from any organism, such as a bacterium.
  • the adenosine deaminase is from a bacterium, such as E. coli, S. aureus, S. typhi, S. putrefaciens , H. influenzae, or C. crescentus.
  • the adenosine deaminase is a TadA deaminase.
  • the deaminase or deaminase domain is a variant of a naturally occurring deaminase from an organism, such as a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse. In some embodiments, the deaminase or deaminase domain does not occur in nature.
  • the deaminase or deaminase domain is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% identical to a naturally occurring deaminase.
  • Detect refers to identifying the presence, absence or amount of the analyte to be detected. In one embodiment, a sequence alteration in a polynucleotide or polypeptide is detected. In another embodiment, the presence of indels is detected.
  • detectable label is meant a composition that when linked to a molecule of interest renders the latter detectable, via spectroscopic, photochemical, biochemical, immunochemical, or chemical means.
  • useful labels include radioactive isotopes, magnetic beads, metallic beads, colloidal particles, fluorescent dyes, electron-dense reagents, enzymes (for example, as commonly used in an enzyme linked immunosorbent assay (ELISA)), biotin, digoxigenin, or haptens.
  • disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
  • an effective amount is meant the amount of an agent or active compound, e.g., a base editor as described herein, that is required to ameliorate the symptoms of a disease relative to an untreated patient or an individual without disease, i.e., a healthy individual, or is the amount of the agent or active compound sufficient to elicit a desired biological response.
  • the effective amount of active compound(s) used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an “effective” amount.
  • an effective amount is the amount of a base editor of the invention sufficient to introduce an alteration in a gene of interest in a cell (e.g., a cell in vitro or in vivo). In one embodiment, an effective amount is the amount of a base editor required to achieve a therapeutic effect. Such therapeutic effect need not be sufficient to alter a pathogenic gene in all cells of a subject, tissue or organ, but only to alter the pathogenic gene in about 1%, 5%, 10%, 25%, 50%, 75% or more of the cells present in a subject, tissue or organ. In one embodiment, an effective amount is sufficient to ameliorate one or more symptoms of a disease.
  • an effective amount of a fusion protein provided herein refers to the amount that is sufficient to induce editing of a target site specifically bound and edited by the nucleobase editors described herein.
  • an agent e.g., a fusion protein
  • the effective amount of an agent may vary depending on various factors as, for example, on the desired biological response, e.g., on the specific allele, genome, or target site to be edited, on the cell or tissue being targeted, and/or on the agent being used.
  • an effective amount of a fusion protein provided herein e.g., of a fusion protein comprising a nCas9 domain and a deaminase domain may refer to the amount of the fusion protein that is sufficient to induce editing of a target site specifically bound and edited by the fusion protein.
  • an agent e.g., a fusion protein, a nuclease, a hybrid protein, a protein dimer, a complex of a protein (or protein dimer) and a polynucleotide, or a polynucleotide
  • an agent e.g., a fusion protein, a nuclease, a hybrid protein, a protein dimer, a complex of a protein (or protein dimer) and a polynucleotide, or a polynucleotide
  • the desired biological response e.g., on the specific allele, genome, or target site to be edited, on the cell or tissue being targeted, and/or on the agent being used.
  • fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide. A fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
  • guide RNA or “gRNA” is meant a polynucleotide that is specific for a target sequence and can form a complex with a polynucleotide programmable nucleotide binding domain protein (e.g., Cas9 or Cpfl).
  • the guide polynucleotide is a guide RNA (gRNA).
  • gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule.
  • gRNAs that exist as a single RNA molecule may be referred to as single-guide RNAs (sgRNAs), although “gRNA” is used interchangeably to refer to guide RNAs that exist as either single molecules or as a complex of two or more molecules.
  • gRNAs that exist as single RNA species comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g., and directs binding of a Cas9 complex to the target); and (2) a domain that binds a Cas9 protein.
  • domain (2) corresponds to a sequence known as atracrRNA, and comprises a stem-loop structure.
  • domain (2) is identical or homologous to a tracrRNA as provided in Jinek et al, Science 337:816-821(2012), the entire contents of which is incorporated herein by reference.
  • gRNAs e.g., those including domain 2
  • US20160208288 entitled “Switchable Cas9 Nucleases and Uses Thereof”
  • US 9,737,604 entitled “Delivery System For Functional Nucleases,” the entire contents of each are hereby incorporated by reference in their entirety.
  • a gRNA comprises two or more of domains (1) and (2), and may be referred to as an “extended gRNA.”
  • An extended gRNA will bind two or more Cas9 proteins and bind a target nucleic acid at two or more distinct regions, as described herein.
  • the gRNA comprises a nucleotide sequence that complements a target site, which mediates binding of the nuclease/RNA complex to the target site, providing the sequence specificity of the nuclease:RNA complex.
  • heterodimer a fusion protein comprising two domains, such as a wild type TadA domain and a variant of TadA domain (e.g., TadA*8 or TadA*9) or two variant T ad A domains (e.g, T ad A* 7.10 and T adA* 8 or two T ad A* 8 domains ; or T adA* 7.10 and TadA* 9 or two TadA* 9 domains).
  • a wild type TadA domain e.g., TadA*8 or TadA*9
  • T ad A domains e.g., T ad A* 7.10 and T adA* 8 or two T ad A* 8 domains
  • T adA* 7.10 and TadA* 9 or two TadA* 9 domains e.g., T ad A* 7.10 and TadA* 9 or two TadA* 9 domains.
  • Hybridization means hydrogen bonding, which may be Watson-Crick, Hoogsteen or reversed Hoogsteen hydrogen bonding, between complementary nucleobases.
  • adenine and thymine are complementary nucleobases that pair through the formation of hydrogen bonds.
  • inhibitor of base repair refers to a protein that is capable in inhibiting the activity of a nucleic acid repair enzyme, for example a base excision repair enzyme.
  • the IBR is an inhibitor of inosine base excision repair.
  • Exemplary inhibitors of base repair include inhibitors of APE1, Endo III, Endo IV, Endo V, Endo VIII, Fpg, hOGGl, hNEILl, T7 Endol, T4PDG, UDG, hSMUGl, and hAAG.
  • the base repair inhibitor is an inhibitor of Endo V or hAAG.
  • the IBR is an inhibitor of Endo V or hAAG. In some embodiments, the IBR is a catalytically inactive EndoV or a catalytically inactive hAAG. In some embodiments, the base repair inhibitor is a catalytically inactive EndoV or a catalytically inactive hAAG. In some embodiments, the base repair inhibitor is uracil glycosylase inhibitor (UGI).
  • UGI refers to a protein that is capable of inhibiting a uracil-DNA glycosylase base-excision repair enzyme. In some embodiments, a UGI domain comprises a wild-type UGI or a fragment of a wild-type UGI.
  • the UGI proteins provided herein include fragments of UGI and proteins homologous to a UGI or a UGI fragment.
  • the base repair inhibitor is an inhibitor of inosine base excision repair.
  • the base repair inhibitor is a “catalytically inactive inosine specific nuclease” or “dead inosine specific nuclease.”
  • catalytically inactive inosine glycosylases e.g., alkyl adenine glycosylase (AAG)
  • AAG alkyl adenine glycosylase
  • the catalytically inactive inosine specific nuclease can be capable of binding an inosine in a nucleic acid but does not cleave the nucleic acid.
  • Non-limiting exemplary catalytically inactive inosine specific nucleases include catalytically inactive alkyl adenosine glycosylase (AAG nuclease), for example, from a human, and catalytically inactive endonuclease V (EndoV nuclease), for example, from E. coli.
  • AAG nuclease catalytically inactive alkyl adenosine glycosylase
  • EndoV nuclease catalytically inactive endonuclease V
  • the catalytically inactive AAG nuclease comprises an E125Q mutation or a corresponding mutation in another AAG nuclease.
  • an "intein” is a fragment of a protein that is able to excise itself and join the remaining fragments (the exteins) with a peptide bond in a process known as protein splicing. Inteins are also referred to as “protein introns.” The process of an intein excising itself and joining the remaining portions of the protein is herein termed “protein splicing" or “intein- mediated protein splicing.”
  • an intein of a precursor protein an intein containing protein prior to intein-mediated protein splicing comes from two genes. Such intein is referred to herein as a split intein (e.g., split intein-N and split intein-C).
  • cyanobacteria DnaE
  • the catalytic subunit a of DNA polymerase III is encoded by two separate genes, dnaE-n and dnaE-c.
  • the intein encoded by the dnaE-n gene may be herein referred as "intein-N.”
  • the intein encoded by the dnaE-c gene may be herein referred as "intein-C.”
  • intein systems may also be used.
  • a synthetic intein based on the dnaE intein, the Cfa-N (e.g., split intein-N) and Cfa-C (e.g., split intein-C) intein pair has been described (e.g., in Stevens et al, J Am Chem Soc. 2016 Feb. 24; 138(7):2162-5, incorporated herein by reference).
  • Non-limiting examples of intein pairs that may be used in accordance with the present disclosure include: Cfa DnaE intein, Ssp GyrB intein, Ssp DnaX intein, Ter DnaE3 intein, Ter ThyX intein, Rma DnaB intein and Cne Prp8 intein (e.g., as described in U.S. Patent No. 8,394,604, incorporated herein by reference.
  • nucleotide and amino acid sequences of inteins are provided.
  • Intein-N and intein-C may be fused to the N-terminal portion of the split Cas9 and the C-terminal portion of the split Cas9, respectively, for the joining of the N-terminal portion of the split Cas9 and the C-terminal portion of the split Cas9.
  • an intein-N is fused to the C-terminus of the N-terminal portion of the split Cas9, i.e., to form a structure of N— [N-terminal portion of the split Cas9]-[intein-N]— C.
  • an intein-C is fused to the N-terminus of the C-terminal portion of the split Cas9, i.e., to form a structure of N-[intein-C]— [C-terminal portion of the split Cas9]-C.
  • the mechanism of intein-mediated protein splicing for joining the proteins the inteins are fused to is known in the art, e.g., as described in Shah et al, Chem Sci.
  • isolated refers to material that is free to varying degrees from components which normally accompany it as found in its native state.
  • Isolate denotes a degree of separation from original source or surroundings.
  • Purify denotes a degree of separation that is higher than isolation.
  • a “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
  • Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography.
  • the term "purified" can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel.
  • modifications for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
  • isolated polynucleotide is meant a nucleic acid (e.g., a DNA) that is free of the genes which, in the naturally-occurring genome of the organism from which the nucleic acid molecule of the invention is derived, flank the gene.
  • the term therefore includes, for example, a recombinant DNA that is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote; or that exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease digestion) independent of other sequences.
  • the term includes an RNA molecule that is transcribed from a DNA molecule, as well as a recombinant DNA that is part of a hybrid gene encoding additional polypeptide sequence.
  • an “isolated polypeptide” is meant a polypeptide of the invention that has been separated from components that naturally accompany it.
  • the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
  • the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention.
  • An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
  • linker can refer to a covalent linker (e.g., covalent bond), a non-covalent linker, a chemical group, or a molecule linking two molecules or moieties, e.g., two components of a protein complex or a ribonucleocomplex, or two domains of a fusion protein, such as, for example, a polynucleotide programmable DNA binding domain (e.g., dCas9) and a deaminase domain ((e.g., an adenosine deaminase, a cytidine deaminase, or an adenosine deaminase and a cytidine deaminase).
  • a covalent linker e.g., covalent bond
  • non-covalent linker e.g., a chemical group
  • a molecule linking two molecules or moieties e.g., two components of a protein complex or
  • a linker can join different components of, or different portions of components of, a base editor system.
  • a linker can join a guide polynucleotide binding domain of a polynucleotide programmable nucleotide binding domain and a catalytic domain of a deaminase.
  • a linker can join a CRISPR polypeptide and a deaminase.
  • a linker can join a Cas9 and a deaminase.
  • a linker can join a dCas9 and a deaminase.
  • a linker can join a nCas9 and a deaminase. In some embodiments, a linker can join a guide polynucleotide and a deaminase. In some embodiments, a linker can join a deaminating component and a polynucleotide programmable nucleotide binding component of a base editor system. In some embodiments, a linker can join a RNA-binding portion of a deaminating component and a polynucleotide programmable nucleotide binding component of a base editor system.
  • a linker can join a RNA-binding portion of a deaminating component and a RNA-binding portion of a polynucleotide programmable nucleotide binding component of a base editor system.
  • a linker can be positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond or non-covalent interaction, thus connecting the two.
  • the linker can be an organic molecule, group, polymer, or chemical moiety.
  • the linker can be a polynucleotide.
  • the linker can be a DNA linker.
  • the linker can be a RNA linker.
  • a linker can comprise an aptamer capable of binding to a ligand.
  • the ligand may be carbohydrate, a peptide, a protein, or a nucleic acid.
  • the linker may comprise an aptamer may be derived from a riboswitch.
  • the riboswitch from which the aptamer is derived may be selected from a theophylline riboswitch, a thiamine pyrophosphate (TPP) riboswitch, an adenosine cobalamin (AdoCbl) riboswitch, an S-adenosyl methionine (SAM) riboswitch, an SAH riboswitch, a flavin mononucleotide (FMN) riboswitch, a tetrahydrofolate riboswitch, a lysine riboswitch, a glycine riboswitch, a purine riboswitch, a GlmS riboswitch, or a pre-queosinel (PreQl) riboswitch.
  • TPP thiamine pyrophosphate
  • AdoCbl adenosine cobalamin
  • a linker may comprise an aptamer bound to a polypeptide or a protein domain, such as a polypeptide ligand.
  • the polypeptide ligand may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a sterile alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
  • the polypeptide ligand may be a portion of a base editor system component.
  • a nucleobase editing component may comprise a deaminase domain and a RNA recognition motif.
  • the linker can be an amino acid or a plurality of amino acids (e.g., a peptide or protein). In some embodiments, the linker can be about 5-100 amino acids in length, for example, about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-30, 30- 40, 40-50, 50-60, 60-70, 70-80, 80-90, or 90-100 amino acids in length. In some embodiments, the linker can be about 100-150, 150-200, 200-250, 250-300, 300-350, 350- 400, 400-450, or 450-500 amino acids in length. Longer or shorter linkers can also be used. Longer or shorter linkers are also contemplated.
  • a linker comprises the amino acid sequence SGSET PGTSESATPES, which may also be referred to as the XTEN linker.
  • a linker comprises the amino acid sequence SGGS.
  • a linker comprises (SGGS) n , (GGGS) n , (GGGGS)n, (G) n, (EAAAK) n , (GGS) n , SGSETPGTSESATPES, or (XP)n motif, or a combination of any of these, where n is independently an integer between 1 and 30, and where X is any amino acid.
  • n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15.
  • a linker comprises a plurality of proline residues and is 5-21, 5-14, 5-9, 5-7 amino acids in length, e.g., PAPAP, PAPAPA, PAPAPAP, PAPAPAPA, P(AP) 4 , P(AP)v, P(AP)io.
  • proline-rich linkers are also termed “rigid” linkers.
  • a linker joins a gRNA binding domain of an RNA- programmable nuclease, including a Cas9 nuclease domain, and the catalytic domain of a nucleic-acid editing protein (e.g., cytidine or adenosine deaminase).
  • a linker joins a dCas9 and a nucleic-acid editing protein.
  • the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two.
  • the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein).
  • the linker is an organic molecule, group, polymer, or chemical moiety.
  • the linker is 5-200 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,
  • the domains of a base editor are fused via a linker that comprises the amino acid sequence of S
  • domains of the base editor are fused via a linker comprising the amino acid sequence which may also be referred to as the XTEN linker.
  • the linker is 24 amino acids in length.
  • the linker comprises the amino acid sequence In some embodiments, the linker is 40 amino acids in length.
  • the linker comprises the amino acid sequence In some embodiments, the linker is 64 amino acids in length.
  • the linker comprises the amino acid sequence In some embodiments, the linker is 92 amino acids in length. In some embodiments, the linker comprises the amino acid sequence
  • marker any protein or polynucleotide having an alteration in expression level or activity that is associated with a disease or disorder.
  • mutation refers to a substitution of a residue within a sequence, e.g., a nucleic acid or amino acid sequence, with another residue, or a deletion or insertion of one or more residues within a sequence. Mutations are typically described herein by identifying the original residue followed by the position of the residue within the sequence and by the identity of the newly substituted residue. Various methods for making the amino acid substitutions (mutations) provided herein are well known in the art, and are provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)).
  • an intended mutation such as a point mutation
  • a nucleic acid e.g., a nucleic acid within a genome of a subject
  • an intended mutation is a mutation that is generated by a specific base editor (e.g., cytidine base editor or adenosine base editor) bound to a guide polynucleotide (e.g., gRNA), specifically designed to generate the intended mutation.
  • a specific base editor e.g., cytidine base editor or adenosine base editor
  • a guide polynucleotide e.g., gRNA
  • mutations made or identified in a sequence are numbered in relation to a reference (or wild type) sequence, i.e., a sequence that does not contain the mutations.
  • a reference sequence i.e., a sequence that does not contain the mutations.
  • the skilled practitioner in the art would readily understand how to determine the position of mutations in amino acid and nucleic acid sequences relative to a reference sequence.
  • non-conservative mutations involve amino acid substitutions between different groups, for example, lysine for tryptophan, or phenylalanine for serine, etc. In this case, it is preferable for the non-conservative amino acid substitution to not interfere with, or inhibit the biological activity of, the functional variant.
  • the non-conservative amino acid substitution can enhance the biological activity of the functional variant, such that the biological activity of the functional variant is increased as compared to the wild-type protein.
  • nuclear localization sequence refers to an amino acid sequence that promotes import of a protein into the cell nucleus.
  • Nuclear localization sequences are known in the art and described, for example, in Plank et al, International PCT application, PCT/EP2000/011690, filed November 23, 2000, published as WO/2001/038547 on May 31, 2001, the contents of which are incorporated herein by reference for their disclosure of exemplary nuclear localization sequences.
  • the NLS is an optimized NLS described, for example, by Koblan et al, Nature Biotech. 2018 doi:10.1038/nbt.4172.
  • an NLS comprises the amino
  • nucleobase refers to a nitrogen-containing biological compound that forms a nucleoside, which in turn is a component of a nucleotide.
  • RNA ribonucleic acid
  • DNA deoxyribonucleic acid
  • nucleobases - adenine (A), cytosine (C), guanine (G), thymine (T), and uracil (U) - are called primary or canonical.
  • Adenine and guanine are derived from purine, and cytosine, uracil, and thymine are derived from pyrimidine.
  • DNA and RNA can also contain other (non-primary) bases that are modified.
  • Non-limiting exemplary modified nucleobases can include hypoxanthine, xanthine, 7-methylguanine, 5,6- dihydrouracil, 5-methylcytosine (m5C), and 5-hydromethylcytosine.
  • Hypoxanthine and xanthine can be created through mutagen presence, both of them through deamination (replacement of the amine group with a carbonyl group).
  • Hypoxanthine can be modified from adenine.
  • Xanthine can be modified from guanine.
  • Uracil can result from deamination of cytosine.
  • a “nucleoside” consists of a nucleobase and a five carbon sugar (either ribose or deoxyribose). Examples of a nucleoside include adenosine, guanosine, uridine, cytidine, 5- methyluridine (m5U), deoxyadenosine, deoxyguanosine, thymidine, deoxyuridine, and deoxy cytidine.
  • nucleoside with a modified nucleobase examples include inosine (I), xanthosine (X), 7-methylguanosine (m7G), dihydrouridine (D), 5-methylcytidine (m5C), and pseudouridine (Y).
  • a “nucleotide” consists of a nucleobase, a five carbon sugar (either ribose or deoxyribose), and at least one phosphate group.
  • nucleic acid and “nucleic acid molecule,” as used herein, refer to a compound comprising a nucleobase and an acidic moiety, e.g., a nucleoside, a nucleotide, or a polymer of nucleotides.
  • polymeric nucleic acids e.g., nucleic acid molecules comprising three or more nucleotides are linear molecules, in which adjacent nucleotides are linked to each other via a phosphodiester linkage.
  • nucleic acid refers to individual nucleic acid residues (e.g. nucleotides and/or nucleosides).
  • nucleic acid refers to an oligonucleotide chain comprising three or more individual nucleotide residues.
  • oligonucleotide and polynucleotide can be used interchangeably to refer to a polymer of nucleotides (e.g., a string of at least three nucleotides).
  • nucleic acid encompasses RNA as well as single and/or double-stranded DNA.
  • Nucleic acids may be naturally occurring, for example, in the context of a genome, a transcript, an mRNA, tRNA, rRNA, siRNA, snRNA, a plasmid, cosmid, chromosome, chromatid, or other naturally occurring nucleic acid molecule.
  • a nucleic acid molecule may be a non-naturally occurring molecule, e.g., a recombinant DNA or RNA, an artificial chromosome, an engineered genome, or fragment thereof, or a synthetic DNA, RNA, DNA/RNA hybrid, or including non-naturally occurring nucleotides or nucleosides.
  • nucleic acid examples include nucleic acid analogs, e.g., analogs having other than a phosphodiester backbone.
  • Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, and backbone modifications. A nucleic acid sequence is presented in the 5' to 3' direction unless otherwise indicated.
  • a nucleic acid is or comprises natural nucleosides (e.g.
  • nucleoside analogs e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7- deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, 0(6)-methylguanine, and 2-thiocy
  • nucleic acid programmable DNA binding protein or “napDNAbp” may be used interchangeably with “polynucleotide programmable nucleotide binding domain” to refer to a protein that associates with a nucleic acid (e.g., DNA or RNA), such as a guide nucleic acid or guide polynucleotide (e.g., gRNA), that guides the napDNAbp to a specific nucleic acid sequence.
  • a nucleic acid e.g., DNA or RNA
  • gRNA guide nucleic acid or guide polynucleotide
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable RNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a Cas9 protein.
  • a Cas9 protein can associate with a guide RNA that guides the Cas9 protein to a specific DNA sequence that is complementary to the guide RNA.
  • the napDNAbp is a Cas9 domain, for example a nuclease active Cas9, a Cas9 nickase (nCas9), or a nuclease inactive Cas9 (dCas9).
  • Non-limiting examples of nucleic acid programmable DNA binding proteins Cas effector proteins, CARF, DinG, homologues thereof, or modified or engineered versions thereof.
  • Other nucleic acid programmable DNA binding proteins are also within the scope of this disclosure, although they may not be specifically listed in this disclosure. See, e.g., Makarova etal. “Classification and Nomenclature of CRISPR-Cas Systems: Where from Here?” CRISPR J. 2018 Oct;l:325-336. doi: 10.1089/crispr.2018.0033; Yan etal, “Functionally diverse type V CRISPR-Cas systems” Science. 2019 Jan 4;363(6422):88-91. doi: 10.1126/science.aav7271, the entire contents of each are hereby incorporated by reference.
  • nucleobase editing domain refers to a protein or enzyme that can catalyze a nucleobase modification in RNA or DNA, such as cytosine (or cytidine) to uracil (or uridine) or thymine (or thymidine), and adenine (or adenosine) to hypoxanthine (or inosine) deaminations, as well as non-templated nucleotide additions and insertions.
  • cytosine or cytidine
  • uracil or uridine
  • thymine or thymidine
  • adenine or adenosine
  • hypoxanthine or inosine
  • the nucleobase editing domain is a deaminase domain (e.g., an adenine deaminase or an adenosine deaminase; or a cytidine deaminase or a cytosine deaminase). In some embodiments, the nucleobase editing domain is more than one deaminase domain (e.g., an adenine deaminase or an adenosine deaminase and a cytidine or a cytosine deaminase). In some embodiments, the nucleobase editing domain can be a naturally occurring nucleobase editing domain.
  • the nucleobase editing domain can be an engineered or evolved nucleobase editing domain from the naturally occurring nucleobase editing domain.
  • the nucleobase editing domain can be from any organism, such as a bacterium, human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse.
  • obtaining as in “obtaining an agent” includes synthesizing, purchasing, or otherwise acquiring the agent.
  • a “patient” or “subject” as used herein refers to a mammalian subject or individual diagnosed with, at risk of having or developing, or suspected of having or developing a disease or a disorder.
  • the term “patient” refers to a mammalian subject with a higher than average likelihood of developing a disease or a disorder.
  • Exemplary patients can be humans, non-human primates, cats, dogs, pigs, cattle, cats, horses, camels, llamas, goats, sheep, rodents (e.g., mice, rabbits, rats, or guinea pigs) and other mammalians that can benefit from the therapies disclosed herein.
  • Exemplary human patients can be male and/or female.
  • Patient in need thereof or “subject in need thereof’ is referred to herein as a patient diagnosed with, at risk or having, predetermined to have, or suspected of having a disease or disorder.
  • pathogenic mutation refers to a genetic alteration or mutation that increases an individual’s susceptibility or predisposition to a certain disease or disorder.
  • the pathogenic mutation comprises at least one wild-type amino acid substituted by at least one pathogenic amino acid in a protein encoded by a gene.
  • protein refers to a polymer of amino acid residues linked together by peptide (amide) bonds.
  • the terms refer to a protein, peptide, or polypeptide of any size, structure, or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long.
  • a protein, peptide, or polypeptide can refer to an individual protein or a collection of proteins.
  • One or more of the amino acids in a protein, peptide, or polypeptide can be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a famesyl group, an isofamesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modifications, etc.
  • a protein, peptide, or polypeptide can also be a single molecule or can be a multi-molecular complex.
  • a protein, peptide, or polypeptide can be just a fragment of a naturally occurring protein or peptide.
  • a protein, peptide, or polypeptide can be naturally occurring, recombinant, or synthetic, or any combination thereof.
  • the term “fusion protein” as used herein refers to a hybrid polypeptide which comprises protein domains from at least two different proteins.
  • One protein can be located at the amino-terminal (N-terminal) portion of the fusion protein or at the carboxy -terminal (C -terminal) protein thus forming an amino-terminal fusion protein or a carboxy-terminal fusion protein, respectively.
  • a protein can comprise different domains, for example, a nucleic acid binding domain (e.g., the gRNA binding domain of Cas9 that directs the binding of the protein to a target site) and a nucleic acid cleavage domain, or a catalytic domain of a nucleic acid editing protein.
  • a protein comprises a proteinaceous part, e.g., an amino acid sequence constituting a nucleic acid binding domain, and an organic compound, e.g., a compound that can act as a nucleic acid cleavage agent.
  • a protein is in a complex with, or is in association with, a nucleic acid, e.g., RNA or DNA.
  • Any of the proteins provided herein can be produced by any method known in the art.
  • the proteins provided herein can be produced via recombinant protein expression and purification, which is especially suited for fusion proteins comprising a peptide linker.
  • Polypeptides and proteins disclosed herein can comprise synthetic amino acids in place of one or more naturally-occurring amino acids.
  • Such synthetic amino acids include, for example, aminocyclohexane carboxylic acid, norleucine, a-amino n-decanoic acid, homoserine, S-acetylaminomethyl-cysteine, trans-3- and trans-4-hydroxyproline, 4- aminophenylalanine, 4-nitrophenylalanine, 4-chlorophenylalanine, 4-carboxyphenylalanine, b-phenylserine b-hydroxyphenylalanine, phenylglycine, a-naphthylalanine, cyclohexylalanine, cyclohexylglycine, indoline-2-carboxylic acid, 1, 2,3,4- tetrahydroisoquinoline-3-carboxylic acid, aminomalonic acid, aminomalonic acid monoamide, N’-benzyl-N’ -methyl-lysine, N’,N’-dibenzyl-lysine
  • the polypeptides and proteins can be associated with post-translational modifications of one or more amino acids of the polypeptide constructs.
  • post- translational modifications include phosphorylation, acylation including acetylation and formylation, glycosylation (including N-linked and O-linked), amidation, hydroxylation, alkylation including methylation and ethylation, ubiquitylation, addition of pyrrolidone carboxylic acid, formation of disulfide bridges, sulfation, myristoylation, palmitoylation, isoprenylation, famesylation, geranylation, glypiation, lipoylation and iodination.
  • recombinant protein or nucleic acid molecule comprises an amino acid or nucleotide sequence that comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations as compared to any naturally occurring sequence.
  • reference is meant a standard or control condition.
  • the reference is a wild-type or healthy cell.
  • a reference is an untreated cell that is not subjected to a test condition, or is subjected to placebo or normal saline, medium, buffer, and/or a control vector that does not harbor a polynucleotide of interest.
  • a “reference sequence” is a defined sequence used as a basis for sequence comparison.
  • a reference sequence may be a subset of or the entirety of a specified sequence; for example, a segment of a full-length cDNA or gene sequence, or the complete cDNA or gene sequence.
  • the length of the reference polypeptide sequence will generally be at least about 16 amino acids, at least about 20 amino acids, at least about 25 amino acids, about 35 amino acids, about 50 amino acids, or about 100 amino acids.
  • the length of the reference nucleic acid sequence will generally be at least about 50 nucleotides, at least about 60 nucleotides, at least about 75 nucleotides, about 100 nucleotides or about 300 nucleotides or any integer thereabout or therebetween.
  • a reference sequence is a wild-type sequence of a protein of interest.
  • a reference sequence is a polynucleotide sequence encoding a wild-type protein.
  • RNA-programmable nuclease and "RNA-guided nuclease” are used with (e.g., binds or associates with) one or more RNA(s) that is not a target for cleavage.
  • an RNA-programmable nuclease when in a complex with an RNA, may be referred to as a nuclease:RNA complex.
  • the bound RNA(s) is referred to as a guide RNA (gRNA).
  • the RNA-programmable nuclease is the (CRISPR-associated system) Cas9 endonuclease, for example, Cas9 (Csnl) from Streptococcus pyogenes ⁇ See, e.g., "Complete genome sequence of an Ml strain of Streptococcus pyogenes .” Ferretti J.J. et al, Proc. Natl. Acad. Sci. U.S.A. 98:4658- 4663(2001); "CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III.” Deltcheva E., et al., Nature 471 :602-607(2011).
  • RNA-programmable nucleases e.g., Cas9
  • Cas9 RNA:DNA hybridization to target DNA cleavage sites
  • these proteins are able to be targeted, in principle, to any sequence specified by the guide RNA.
  • Methods of using RNA-programmable nucleases, such as Cas9, for site-specific cleavage (e.g., to modify a genome) are known in the art (see e.g., Cong, L. et al, Multiplex genome engineering using CRISPR/Cas systems. Science 339, 819-823 (2013); Mali, P. et al, RNA-guided human genome engineering via Cas9. Science 339, 823- 826 (2013); Hwang, W.Y.
  • single nucleotide polymorphism is a variation in a single nucleotide that occurs at a specific position in the genome, where each variation is present to some appreciable degree within a population (e.g > 1%).
  • the C nucleotide can appear in most individuals, but in a minority of individuals, the position is occupied by an A. This means that there is a SNP at this specific position, and the two possible nucleotide variations, C or A, are said to be alleles for this position.
  • SNPs underlie differences in susceptibility to disease. The severity of illness and the way our body responds to treatments are also manifestations of genetic variations.
  • SNPs can fall within coding regions of genes, non-coding regions of genes, or in the intergenic regions (regions between genes). In some embodiments, SNPs within a coding sequence do not necessarily change the amino acid sequence of the protein that is produced, due to degeneracy of the genetic code.
  • SNPs in the coding region are of two types: synonymous and nonsynonymous SNPs. Synonymous SNPs do not affect the protein sequence, while nonsynonymous SNPs change the amino acid sequence of protein. The nonsynonymous SNPs are of two types: missense and nonsense. SNPs that are not in protein-coding regions can still affect gene splicing, transcription factor binding, messenger RNA degradation, or the sequence of noncoding RNA.
  • SNP expression SNP
  • SNV single nucleotide variant
  • a somatic single nucleotide variation can also be called a single-nucleotide alteration.
  • nucleic acid molecule e.g., a nucleic acid programmable DNA binding domain and guide nucleic acid
  • compound e.g., a nucleic acid programmable DNA binding domain and guide nucleic acid
  • molecule that recognizes and binds a polypeptide and/or nucleic acid molecule of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample.
  • Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having “substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having “substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule.
  • hybridize pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
  • complementary polynucleotide sequences e.g., a gene described herein
  • stringency See, e.g., Wahl, G. M. and S. L. Berger (1987) Methods Enzymol. 152:399; Kimmel, A. R. (1987) Methods Enzymol. 152:507).
  • stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
  • Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
  • Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C.
  • hybridization time the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA
  • concentration of detergent e.g., sodium dodecyl sulfate (SDS)
  • SDS sodium dodecyl sulfate
  • Various levels of stringency are accomplished by combining these various conditions as needed.
  • hybridization will occur at 30° C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS.
  • hybridization will occur at 37° C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 pg/ml denatured salmon sperm DNA (ssDNA).
  • ssDNA denatured salmon sperm DNA
  • hybridization will occur at 42° C in 250 mM NaCl, 25 mM trisodium citrate,
  • wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
  • stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
  • Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C.
  • wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In another embodiment, wash steps will occur at 42 C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Hogness (Proc. Natl. Acad.
  • split is meant divided into two or more fragments.
  • a “split Cas9 protein” or “split Cas9” refers to a Cas9 protein that is provided as an N- terminal fragment and a C-terminal fragment encoded by two separate nucleotide sequences.
  • the polypeptides corresponding to the N-terminal portion and the C-terminal portion of the Cas9 protein may be spliced to form a “reconstituted” Cas9 protein.
  • the Cas9 protein is divided into two fragments within a disordered region of the protein, e.g., as described in Nishimasu et al, Cell, Volume 156, Issue 5, pp. 935-949, 2014, or as described in Jiang et al. (2016) Science 351: 867-871.
  • the protein is divided into two fragments at any C, T, A, or S within a region of SpCas9 between about amino acids A292-G364, F445-K483, or E565-T637, or at corresponding positions in any other Cas9, Cas9 variant (e.g., nCas9, dCas9), or other napDNAbp.
  • protein is divided into two fragments at SpCas9 T310, T313, A456, S469, or C574.
  • the process of dividing the protein into two fragments is referred to as “splitting” the protein.
  • the N-terminal portion of the Cas9 protein comprises amino acids 1-573 or 1-637 S. pyogenes Cas9 wild-type (SpCas9) (NCBI Reference Sequence: NC_002737.2, Uniprot Reference Sequence: Q99ZW2) and the C-terminal portion of the Cas9 protein comprises a portion of amino acids 574-1368 or 638-1368 of SpCas9 wild-type.
  • the C-terminal portion of the split Cas9 can be joined with the N-terminal portion of the split Cas9 to form a complete Cas9 protein.
  • the C-terminal portion of the Cas9 protein starts from where the N-terminal portion of the Cas9 protein ends.
  • the C-terminal portion of the split Cas9 comprises a portion of amino acids (551 -651)-1368 of spCas9.
  • “(551-651)-1368” means starting at an amino acid between amino acids 551-651 (inclusive) and ending at amino acid 1368.
  • the C- terminal portion of the split Cas9 may comprise a portion of any one of amino acid 551-1368, 552-1368, 553-1368, 554-1368, 555-1368, 556-1368, 557-1368, 558-1368, 559-1368, 560- 1368, 561-1368, 562-1368, 563-1368, 564-1368, 565-1368, 566-1368, 567-1368, 568-1368, 569-1368, 570-1368, 571-1368, 572-1368, 573-1368, 574-1368, 575-1368, 576-1368, 577- 1368, 578-1368, 579-1368, 580-1368, 581-1368, 582-1368, 583-1368, 584-1368, 585-1368, 586-1368, 587-1368, 588-1368, 589-1368, 590-1368, 591-1368, 592-1368, 593-1368, 594- 1368, 595-1368, 596-13
  • subject is meant a mammal, including, but not limited to, a human or non human mammal, such as a non-human primate (monkey), bovine, equine, canine, ovine, or feline.
  • a subject described herein includes a pathogenic mutation in a polynucleotide sequence.
  • substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein). In one embodiment, such a sequence is at least 60%, 80% or 85%, 90%, 95% or even 99% identical at the amino acid level or nucleic acid level to the sequence used for comparison.
  • Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, COBALT, EMBOSS Needle, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
  • sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, COBALT, EMBOSS Needle, GAP, or PILEUP/PRETTYBOX programs.
  • Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
  • a BLAST program may be used, with a probability score between e 3 and e 100 indicating a closely related sequence.
  • COBALT is used, for example, with the following parameters: a) alignment parameters: Gap penalties-11,-1 and End-Gap penalties-5,-1, b) CDD Parameters: Use RPS BLAST on; Blast E-value 0.003; Find conserveed columns and Recompute on, and c) Query Clustering Parameters: Use query clusters on; Word Size 4; Max cluster distance 0.8; Alphabet Regular.
  • EMBOSS Needle is used, for example, with the following parameters: a) Matrix: BLOSUM62; b) GAP OPEN: 10; c) GAP EXTEND: 0.5; d) OUTPUT FORMAT: pair; e) END GAP PENALTY: false; f) END GAP OPEN: 10; and g) END GAP EXTEND : 0.5.
  • target site refers to a sequence within a nucleic acid molecule that is deaminated by a deaminase (e.g., cytidine or adenine deaminase) or a fusion protein comprising a deaminase (e.g., a dCas9-adenosine deaminase fusion protein or a base editor disclosed herein).
  • a deaminase e.g., cytidine or adenine deaminase
  • a fusion protein comprising a deaminase (e.g., a dCas9-adenosine deaminase fusion protein or a base editor disclosed herein).
  • the terms “treat,” treating,” “treatment,” and the like refer to reducing or ameliorating a disorder and/or symptoms associated therewith or obtaining a desired pharmacologic and/or physiologic effect. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
  • the effect is therapeutic, /. e.. without limitation, the effect partially or completely reduces, diminishes, abrogates, abates, alleviates, decreases the intensity of, or cures a disease and/or adverse symptom attributable to the disease.
  • the effect is preventative, /. e.. the effect protects or prevents an occurrence or reoccurrence of a disease or condition.
  • the presently disclosed methods comprise administering a therapeutically effective amount of a compositions as described herein.
  • uracil glycosylase inhibitor or “UGI” is meant an agent that inhibits the uracil- excision repair system.
  • the agent is a protein or fragment thereof that binds a host uracil-DNA glycosylase and prevents removal of uracil residues from DNA.
  • a UGI is a protein, a fragment thereof, or a domain that is capable of inhibiting a uracil-DNA glycosylase base-excision repair enzyme.
  • a UGI domain comprises a wild-type UGI or a modified version thereof.
  • a UGI domain comprises a fragment of the exemplary amino acid sequence set forth below.
  • a UGI fragment comprises an amino acid sequence that comprises at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% of the exemplary UGI sequence provided below.
  • a UGI comprises an amino acid sequence that is homologous to the exemplary UGI amino acid sequence or fragment thereof, as set forth below.
  • the UGI is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.9%, or 100% identical to a wild type UGI or a UGI sequence, or portion thereof, as set forth below.
  • An exemplary UGI comprises an amino acid sequence as follows:
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
  • compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
  • FIG. 1 presents a series of graphs showing percent A>G editing activity for the designated adenosine base editors.
  • Each of the editors is referred to by number where, for example, 433 denotes pNMG-B433, which is ABE8.32.
  • Each of the editors referenced in the graph was tested with each of gRNAs HRB03, HRB04, HRB08, HRB12, and ng-424.
  • the gRNA sequences are provided in Example 3.
  • FIG. 2 provides a heat map depicting in gray shading percent A>G editing activity for the designated adenosine base editors (ABE8 and ABE9), which are described at Table 14. Each of the editors listed in the figure was tested with a different gRNA, HRB03, HRB04, HRB08, HRB12, and ng-424.
  • FIGS. 3A-3C provide tables showing TadA deaminase variant (e.g., TadA*9; ABE9) and Cas9 (e.g., SpCas9) variant components of adenosine base editors described herein.
  • TadA deaminase variant e.g., TadA*9; ABE9
  • Cas9 e.g., SpCas9
  • FIG. 3A refers to the adenosine base editors by their plasmid number.
  • FIGS. 3B and 3C present various TadA deaminase variants and amino acid mutations included in the Tad*7.10 amino acid sequence, as well as PAM variants and their included amino acid mutations.
  • FIGS. 4A-4D present a nucleic acid sequence, a table and graphs related to produing improved rates of nucleobase correction through base editor engineering.
  • FIGS. 4A and 4B present a nucleic acid sequence and a table related to produing improved rates of nucleobase correction in primary PiZZ fibroblasts through base editor engineering as described in FIGS. 4C and 4D and related to increasing serum alpha-1 antitrypsin (A1AT) produced by lipid nanoparticle (LNP)-mediated delivery and base editing in NSG-PiZ transgenic mice as described in FIGS. 5A and 5B infra.
  • FIG. 5A and 5B infra.
  • FIG. 4A shows the target DNA sequence, including the target site (the A at position 7 in the target DNA sequence), encoding the PiZZ mutation associated with A1AD.
  • FIG. 4B presents a table describing the TadA deaminase variant and the Cas9 PAM variant constituents of the various base editors used to correct the PiZ mutation. The table shows the variants (e.g., Variants (Vars) 1-9) as used to obtain the results provided in FIGS. 4C, 4D,
  • FIGS. 4C and 4D present bar-graphs depicting the editing rates observed in patient-derived PiZZ fibroblasts (GM11423 Corriel Biorepository) that were transfected with base editing reagents using the Neon electroporation system.
  • Each treatment consisted of IOmI electroporation buffer containing 70,000 fibroblasts, lOOng mRNA encoding the base editor and 50ng Alpha-1 correction gRNA. After 48 hours of recovery, the cells were lysed, and the locus of interest was interrogated by targeted amplicon sequencing. The data were obtained from two independent experiments. These data and results demonstrate the improvements in target base editing efficiency from both optimization of the NGC PAM recognition (variants 1-3, FIGs. 4B and 4C) and optimization of the TadA deaminase through incorporation of mutations in the TadA deaminase, e.g., ABE9, (variants 4-9, FIGS. 4B-4D).
  • FIGS. 5A and 5B present graphs related to the increase in serum A1 AT produced by lipid nanoparticle (LNP)-mediated delivery and base editing in NSG-PiZ transgenic mice.
  • LNP lipid nanoparticle
  • FIG. 5A presents a graph depicting the editing rates observed in total liver gDNA from the NSG-PiZ transgenic mouse model 7 days after treatment with 1.5 mg/kg of LNP containing a 1:1 weight ratio of gRNA and mRNA encoding base editor.
  • FIG. 5B presents a graph showing that the editing rates are correlated with an increase in serum Alpha-1 Antitrypsin (A1 AT), (post-bleed), relative to pretreatment samples, (pre-bleed), as measured by an MSD Sandwich Immunoassay. Based on these results, base editing with the TadA deaminase variants described herein is capable of addressing a deficiency of alpha- 1 antitrypsin and its potential pulmonary sequelae.
  • the invention features novel adenine base editors (e.g., ABE9) and methods of using these adenosine deaminase variants for editing a target sequence.
  • ABE9 novel adenine base editors
  • novel base editors e.g., ABE8 and ABE9
  • nucleobase editors for editing, modifying or altering a target nucleotide sequence of a polynucleotide.
  • novel ABE9 base editor and its component adenosine deaminase are described in Tables 14 and 18 infra.
  • a nucleobase editor or a base editor comprising a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain (e.g., adenosine deaminase).
  • a polynucleotide programmable nucleotide binding domain when in conjunction with a bound guide polynucleotide (e.g., gRNA), can specifically bind to a target polynucleotide sequence (i.e., via complementary base pairing between bases of the bound guide nucleic acid and bases of the target polynucleotide sequence) and thereby localize the base editor to the target nucleic acid sequence desired to be edited.
  • the target polynucleotide sequence comprises single- stranded DNA or double-stranded DNA.
  • the target polynucleotide sequence comprises RNA.
  • the target polynucleotide sequence comprises a DNA-RNA hybrid.
  • polynucleotide programmable nucleotide binding domains can also include nucleic acid programmable proteins that bind RNA.
  • the polynucleotide programmable nucleotide binding domain can be associated with a nucleic acid that guides the polynucleotide programmable nucleotide binding domain to an RNA.
  • Other nucleic acid programmable DNA binding proteins are also within the scope of this disclosure, though they are not specifically listed in this disclosure.
  • a polynucleotide programmable nucleotide binding domain of a base editor can itself comprise one or more domains.
  • a polynucleotide programmable nucleotide binding domain can comprise one or more nuclease domains.
  • the nuclease domain of a polynucleotide programmable nucleotide binding domain can comprise an endonuclease or an exonuclease.
  • an endonuclease refers to a protein or polypeptide capable of digesting a nucleic acid (e.g., RNA or DNA) from free ends
  • the term “endonuclease” refers to a protein or polypeptide capable of catalyzing (e.g., cleaving) internal regions in a nucleic acid (e.g., DNA or RNA).
  • an endonuclease can cleave a single strand of a double-stranded nucleic acid.
  • an endonuclease can cleave both strands of a double-stranded nucleic acid molecule.
  • a polynucleotide programmable nucleotide binding domain can be a deoxyribonuclease. In some embodiments a polynucleotide programmable nucleotide binding domain can be a ribonuclease.
  • a nuclease domain of a polynucleotide programmable nucleotide binding domain can cut zero, one, or two strands of a target polynucleotide.
  • the polynucleotide programmable nucleotide binding domain can comprise a nickase domain.
  • nickase refers to a polynucleotide programmable nucleotide binding domain comprising a nuclease domain that is capable of cleaving only one strand of the two strands in a duplexed nucleic acid molecule (e.g., DNA).
  • a nickase can be derived from a fully catalytically active (e.g., natural) form of a polynucleotide programmable nucleotide binding domain by introducing one or more mutations into the active polynucleotide programmable nucleotide binding domain.
  • a polynucleotide programmable nucleotide binding domain comprises a nickase domain derived from Cas9
  • the Cas9-derived nickase domain can include a D10A mutation and a histidine at position 840.
  • the residue H840 retains catalytic activity and can thereby cleave a single strand of the nucleic acid duplex.
  • a Cas9-derived nickase domain can comprise an H840A mutation, while the amino acid residue at position 10 remains a D.
  • a nickase can be derived from a fully catalytically active (e.g., natural) form of a polynucleotide programmable nucleotide binding domain by removing all or a portion of a nuclease domain that is not required for the nickase activity.
  • a polynucleotide programmable nucleotide binding domain comprises a nickase domain derived from Cas9
  • the Cas9-derived nickase domain can comprise a deletion of all or a portion of the RuvC domain or the HNH domain.
  • amino acid sequence of an exemplary catalytically active Cas9 is as follows:
  • a base editor comprising a polynucleotide programmable nucleotide binding domain comprising a nickase domain is thus able to generate a single-strand DNA break (nick) at a specific polynucleotide target sequence (e.g ., determined by the complementary sequence of a bound guide nucleic acid).
  • a specific polynucleotide target sequence e.g ., determined by the complementary sequence of a bound guide nucleic acid.
  • the strand of a nucleic acid duplex target polynucleotide sequence that is cleaved by a base editor comprising a nickase domain is the strand that is not edited by the base editor (i.e..
  • a base editor comprising a nickase domain can cleave the strand of a DNA molecule which is being targeted for editing. In such cases, the non-targeted strand is not cleaved.
  • base editors comprising a polynucleotide programmable nucleotide binding domain which is catalytically dead (i.e.. incapable of cleaving a target polynucleotide sequence).
  • catalytically dead and “nuclease dead” are used interchangeably to refer to a polynucleotide programmable nucleotide binding domain which has one or more mutations and/or deletions resulting in its inability to cleave a strand of a nucleic acid.
  • a catalytically dead polynucleotide programmable nucleotide binding domain base editor can lack nuclease activity as a result of specific point mutations in one or more nuclease domains.
  • the Cas9 can comprise both a D10A mutation and an H840A mutation. Such mutations inactivate both nuclease domains, thereby resulting in the loss of nuclease activity.
  • a catalytically dead polynucleotide programmable nucleotide binding domain can comprise one or more deletions of all or a portion of a catalytic domain (e.g RuvCl and/or HNH domains).
  • a catalytically dead polynucleotide programmable nucleotide binding domain comprises a point mutation (e.g., D10A or H840A) as well as a deletion of all or a portion of a nuclease domain.
  • mutations capable of generating a catalytically dead polynucleotide programmable nucleotide binding domain from a previously functional version of the polynucleotide programmable nucleotide binding domain.
  • dCas9 catalytically dead Cas9
  • variants having mutations other than D10A and H840A are provided, which result in nuclease inactivated Cas9.
  • Such mutations include other amino acid substitutions at D10 and H840, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and/or the RuvCl subdomain).
  • nuclease-inactive dCas9 domains can be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et cil, CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology. 2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).
  • Non-limiting examples of a polynucleotide programmable nucleotide binding domain which can be incorporated into a base editor include a CRISPR protein-derived domain, a restriction nuclease, a meganuclease, TAL nuclease (TALEN), and a zinc finger nuclease (ZFN).
  • a base editor comprises a polynucleotide programmable nucleotide binding domain comprising a natural or modified protein or portion thereof which via a bound guide nucleic acid is capable of binding to a nucleic acid sequence during CRISPR (i.e., Clustered Regularly Interspaced Short Palindromic Repeats)-mediated modification of a nucleic acid.
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • CRISPR protein Such a protein is referred to herein as a “CRISPR protein”.
  • a base editor comprising a polynucleotide programmable nucleotide binding domain comprising all or a portion of a CRISPR protein (i.e. a base editor comprising as a domain all or a portion of a CRISPR protein, also referred to as a “CRISPR protein-derived domain” of the base editor).
  • a CRISPR protein-derived domain incorporated into a base editor can be modified compared to a wild-type or natural version of the CRISPR protein.
  • a CRISPR protein-derived domain can comprise one or more mutations, insertions, deletions, rearrangements and/or recombinations relative to a wild-type or natural version of the CRISPR protein.
  • CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids).
  • CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids.
  • CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA).
  • crRNA CRISPR RNA
  • type II CRISPR systems correct processing of pre-crRNA requires a trans- encoded small RNA (tracrRNA), endogenous ribonuclease 3 (me) and a Cas9 protein.
  • tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA.
  • Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer.
  • the target strand not complementary to crRNA is first cut endonucleolytically, and then trimmed 3'-5' exonucleolytically.
  • DNA-binding and cleavage typically requires protein and both RNAs.
  • single guide RNAs (“sgRNA”, or simply “gNRA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M., Chybnski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E.
  • Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motii) to help distinguish self-versus- non-self.
  • a guide RNA is a short synthetic RNA composed of a scaffold sequence necessary for Cas-binding and a user-defined ⁇ 20 nucleotide spacer that defines the genomic (or polynucleotide, e.g., DNA or RNA) target to be modified.
  • a skilled artisan can change the genomic or polynucleotide target of the Cas protein by changing the target sequence present in the gRNA.
  • the specificity of the Cas protein is partially determined by how specific the gRNA targeting sequence is for the genomic polynucleotide target sequence compared to the rest of the genome.
  • the Cas protein is SpCas9.
  • the gRNA scaffold sequence is as follows:
  • the gRNA scaffold sequence is as follows:
  • terminal uracils (U) of above gRNA scaffolds may optionally comprise "mU*mU*mU*U, " which denote 2'OMe and have phosphorothioate linkages.
  • the RNA scaffold comprises a stem loop. In an embodiment, the RNA scaffold comprises the nucleic acid sequence:
  • an S. pyrogenes sgRNA scaffold polynucleotide sequence is as follows:
  • an S. aureus sgRNA scaffold polynucleotide sequence is as follows:
  • a BhCasl2b sgRNA scaffold has the following polynucleotide sequence:
  • a BvCasl2b sgRNA scaffold has the following polynucleotide sequence:
  • a CRISPR protein-derived domain incorporated into a base editor is an endonuclease (e.g., deoxyribonuclease or ribonuclease) capable of binding a target polynucleotide when in conjunction with a bound guide nucleic acid.
  • a CRISPR protein-derived domain incorporated into a base editor is a nickase capable of binding a target polynucleotide when in conjunction with a bound guide nucleic acid.
  • a CRISPR protein-derived domain incorporated into a base editor is a catalytically dead domain capable of binding a target polynucleotide when in conjunction with a bound guide nucleic acid.
  • a target polynucleotide bound by a CRISPR protein derived domain of a base editor is DNA. In some embodiments, a target polynucleotide bound by a CRISPR protein-derived domain of a base editor is RNA.
  • Cas proteins that can be used herein include class 1 and class 2.
  • Non-limiting examples of Cas proteins include Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t,
  • a CRISPR enzyme can direct cleavage of one or both strands at a target sequence, such as within a target sequence and/or within a complement of a target sequence.
  • a CRISPR enzyme can direct cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence.
  • Cas9 can refer to a polypeptide with at least or at least about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild type exemplary Cas9 polypeptide (e.g., Cas9 from S. pyogenes).
  • Cas9 can refer to a polypeptide with at most or at most about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild type exemplary Cas9 polypeptide (e.g., from A pyogenes).
  • Cas9 can refer to the wild type or a modified form of the Cas9 protein that can comprise an amino acid change such as a deletion, insertion, substitution, variant, mutation, fusion, chimera, or any combination thereof.
  • a CRISPR protein-derived domain of a base editor can include all or a portion of Cas9 from Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquis (NCBI Ref: NC_018721.1); Streptococcus thermophilus (NCBI Ref: YP_820832.1); Listeria innocua (NCBI Refs: NC
  • Cas9 nuclease sequences and structures are well known to those of skill in the art (See, e.g.. “Complete genome sequence of an Ml strain of Streptococcus pyogenes ” Ferretti et ctl, Proc. Natl. Acad. Sci. U.S.A. 98:4658-4663(2001); “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III.” Deltcheva E. et al, Nature 471:602- 607(2011); and “A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity.” Jinek M.
  • Cas9 orthologs have been described in various species, including, but not limited to, S. pyogenes and S. thermophilus . Additional suitable Cas9 nucleases and sequences will be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier, “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference.
  • a nucleic acid programmable DNA binding protein is a Cas9 domain.
  • the Cas9 domain may be a nuclease active Cas9 domain, a nuclease inactive Cas9 domain, or a Cas9 nickase.
  • the Cas9 domain is a nuclease active domain.
  • the Cas9 domain may be a Cas9 domain that cuts both strands of a duplexed nucleic acid (e.g., both strands of a duplexed DNA molecule).
  • the Cas9 domain comprises any one of the amino acid sequences as set forth herein. In some embodiments the Cas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth herein.
  • the Cas9 domain comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48,
  • the Cas9 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth herein.
  • proteins comprising fragments of Cas9 are provided.
  • a protein comprises one of two Cas9 domains: (1) the gRNA binding domain of Cas9; or (2) the DNA cleavage domain of Cas9.
  • proteins comprising Cas9 or fragments thereof are referred to as “Cas9 variants.”
  • a Cas9 variant shares homology to Cas9, or a fragment thereof.
  • a Cas9 variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to wild type Cas9.
  • the Cas9 variant may have 1, 2, 3,
  • the Cas9 variant comprises a fragment of Cas9 (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to the corresponding fragment of wild type Cas9.
  • a fragment of Cas9 e.g., a gRNA binding domain or a DNA-cleavage domain
  • the fragment is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the amino acid length of a corresponding wild type Cas9.
  • the fragment is at least 100 amino acids in length.
  • the fragment is at least 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, or at least 1300 amino acids in length.
  • Cas9 fusion proteins as provided herein comprise the full- length amino acid sequence of a Cas9 protein, e.g., one of the Cas9 sequences provided herein. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length Cas9 sequence, but only one or more fragments thereof. Exemplary amino acid sequences of suitable Cas9 domains and Cas9 fragments are provided herein, and additional suitable sequences of Cas9 domains and fragments will be apparent to those of skill in the art.
  • a Cas9 protein can associate with a guide RNA that guides the Cas9 protein to a specific DNA sequence that has complementary to the guide RNA.
  • the polynucleotide programmable nucleotide binding domain is a Cas9 domain, for example a nuclease active Cas9, a Cas9 nickase (nCas9), or a nuclease inactive Cas9 (dCas9).
  • nucleic acid programmable DNA binding proteins include, without limitation, Cas9 (e.g., dCas9 and nCas9), Casl2a/Cpfl, Casl2b/C2cl, Casl2c/C2c3, Casl2d/CasY, Casl2e/CasX, Casl2g, Casl2h, Casl2i, and Casl2j/Cas ⁇ D.
  • Cas9 e.g., dCas9 and nCas9
  • Casl2a/Cpfl Casl2a/Cpfl
  • Casl2b/C2cl Casl2c/C2c3
  • Casl2d/CasY Casl2d/CasY
  • Casl2e/CasX Casl2g, Casl2h, Casl2i, and Casl2j/Cas ⁇ D.
  • Cas enzymes include Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas8a, Cas8b, Cas8c, Cas9 (also known as Csnl or Csxl2), Casio, CaslOd, Casl2a/Cpfl, Casl2b/C2cl, Casl2c/C2c3, Casl2d/CasY, Casl2e/CasX, Casl2g, Casl2h, Casl2i, Casl2j/Cas ⁇ D, Csyl , Csy2, Csy3, Csy4, Csel, Cse2, Cse3, Cse4, Cse5e, Cscl, Csc2, Csa5, Csnl, Csn2, Csml,
  • wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC_017053.1, nucleotide and amino acid sequences as follows).
  • wild type Cas9 corresponds to, or comprises the following nucleotide and/or amino acid sequences:
  • wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC_002737.2 (nucleotide sequence as follows); and Uniprot Reference Sequence: Q99ZW2 (amino acid sequence as follows): LGGD (single underline: HNH domain; double underline: RuvC domain)
  • Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs:
  • NCBI Ref NC_016782.1, NC_016786.1
  • Spiroplasma syrphidicola NC_021284.1
  • Prevotella intermedia NCBI Ref: NC_017861.1
  • Spiroplasma taiwanense NCBI Ref: NC_021846.1
  • Streptococcus iniae NCBI Ref: NC_021314.1
  • Belliella baltica NCBI Ref: NC_018010.1
  • Psychroflexus torquisl NCBI Ref: NC_018721.1
  • Streptococcus thermophilus NCBI Ref: YP_820832.1
  • Listeria innocua NCBI Ref: NP_472073.1
  • Campylobacter jejuni NCBI Ref: YP_002344900.1
  • ox Neisseria meningitidis NCBI Ref: YP_002342100.1 or to a Cas9 from any other organism.
  • Cas9 proteins e.g., a nuclease dead Cas9 (dCas9), a Cas9 nickase (nCas9), or a nuclease active Cas9), including variants and homologs thereof, are within the scope of this disclosure.
  • Exemplary Cas9 proteins include, without limitation, those provided below.
  • the Cas9 protein is a nuclease dead Cas9 (dCas9).
  • the Cas9 protein is a Cas9 nickase (nCas9).
  • the Cas9 protein is a nuclease active Cas9.
  • the Cas9 domain is a nuclease-inactive Cas9 domain (dCas9).
  • the dCas9 domain may bind to a duplexed nucleic acid molecule (e.g., via a gRNA molecule) without cleaving either strand of the duplexed nucleic acid molecule.
  • the nuclease-inactive dCas9 domain comprises a D10X mutation and a H840X mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid change.
  • the nuclease-inactive dCas9 domain comprises a D10A mutation and a H840A mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein.
  • a nuclease-inactive Cas9 domain comprises the amino acid sequence set forth in Cloning vector pPlatTET-gRNA2 (Accession No. BAV54124).
  • the amino acid sequence of an exemplary catalytically inactive Cas9 is as follows:
  • nuclease-inactive dCas9 domains will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et al, CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology. 2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).
  • a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase, referred to as an “nCas9” protein (for “nickase” Cas9).
  • a nuclease-inactivated Cas9 protein may interchangeably be referred to as a “dCas9” protein (for nuclease-“dead” Cas9) or catalytically inactive Cas9.
  • Methods for generating a Cas9 protein (or a fragment thereof) having an inactive DNA cleavage domain are known (See, e.g., Jinek et al, Science.
  • the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvCl subdomain.
  • the HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvCl subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9.
  • the mutations D10A and H840A completely inactivate the nuclease activity of S. pyogenes Cas9 (Jinek et al, Science. 337:816-821(2012); Qi et al,
  • the dCas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the dCas9 domains provided herein.
  • the Cas9 domain comprises an amino acid sequences that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41,
  • the Cas9 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth herein.
  • dCas9 corresponds to, or comprises in part or in whole, a Cas9 amino acid sequence having one or more mutations that inactivate the Cas9 nuclease activity.
  • the nuclease-inactive dCas9 domain comprises a D10X mutation and a H840X mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid change.
  • the nuclease-inactive dCas9 domain comprises a D10A mutation and a H840A mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein.
  • a nuclease-inactive Cas9 domain comprises the amino acid sequence set forth in Cloning vector pPlatTET- gRNA2 (Accession No. BAV54124).
  • the dCas9 comprises the amino acid sequence of dCas9 (D10A and H840A): LGGD (single underline: HNH domain; double underline: RuvC domain).
  • amino acid sequence of an exemplary catalytically inactive Cas9 is as follows:
  • amino acid sequence of an exemplary catalytically inactive Cas9 is as follows:
  • the Cas9 domain comprises a D10A mutation, while the residue at position 840 remains a histidine in the amino acid sequence provided above, or at corresponding positions in any of the amino acid sequences provided herein.
  • dCas9 variants having mutations other than D10A and H840A are provided, which, e.g., result in nuclease inactivated Cas9 (dCas9).
  • Such mutations include other amino acid substitutions at D10 and H840, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and/or the RuvCl subdomain).
  • variants or homologues of dCas9 are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical.
  • variants of dCas9 are provided having amino acid sequences which are shorter, or longer, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids or more.
  • nuclease-inactive dCas9 domains will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant etal, CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology. 2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).
  • the Cas9 domain is a Cas9 nickase.
  • the Cas9 nickase may be a Cas9 protein that is capable of cleaving only one strand of a duplexed nucleic acid molecule (e.g., a duplexed DNA molecule).
  • the Cas9 nickase cleaves the target strand of a duplexed nucleic acid molecule, meaning that the Cas9 nickase cleaves the strand that is base paired to (complementary to) a gRNA (e.g., an sgRNA) that is bound to the Cas9.
  • a gRNA e.g., an sgRNA
  • a Cas9 nickase comprises a D10A mutation and has a histidine at position 840.
  • the Cas9 nickase cleaves the non-target, non-base- edited strand of a duplexed nucleic acid molecule, meaning that the Cas9 nickase cleaves the strand that is not base paired to a gRNA (e.g., an sgRNA) that is bound to the Cas9.
  • a Cas9 nickase comprises an H840A mutation and has an aspartic acid residue at position 10, or a corresponding mutation.
  • the Cas9 nickase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 nickases provided herein. Additional suitable Cas9 nickases will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • nCas9 The amino acid sequence of an exemplary catalytically Cas9 nickase (nCas9) is as follows:
  • Cas9 refers to a Cas9 from archaea (e.g., nanoarchaea), which constitute a domain and kingdom of single-celled prokaryotic microbes.
  • the programmable nucleotide binding protein may be a CasX or CasY protein, which have been described in, for example, Burstein etal, "New CRISPR-Cas systems from uncultivated microbes.” Cell Res. 2017 Feb 21. doi: 10.1038/cr.2017.21, the entire contents of which is hereby incorporated by reference. Using genome-resolved metagenomics, a number of CRISPR-Cas systems were identified, including the first reported Cas9 in the archaeal domain of life.
  • RNA-guided DNA binding proteins may be used as a nucleic acid programmable DNA binding protein (napDNAbp), and are within the scope of this disclosure.
  • nucleic acid programmable DNA binding protein (napDNAbp) of any of the fusion proteins provided herein may be a CasX or CasY protein.
  • the napDNAbp is a CasX protein. In some embodiments, the napDNAbp is a CasY protein. In some embodiments, the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally-occurring CasX or CasY protein. In some embodiments, the programmable nucleotide binding protein is a naturally-occurring CasX or CasY protein.
  • the programmable nucleotide binding protein comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any CasX or CasY protein described herein. It should be appreciated that CasX and CasY from other bacterial species may also be used in accordance with the present disclosure.
  • the Cas9 nuclease has two functional endonuclease domains: RuvC and HNH.
  • Cas9 undergoes a conformational change upon target binding that positions the nuclease domains to cleave opposite strands of the target DNA.
  • the end result of Cas9-mediated DNA cleavage is a double-strand break (DSB) within the target DNA ( ⁇ 3-4 nucleotides upstream of the PAM sequence).
  • the resulting DSB is then repaired by one of two general repair pathways: (1) the efficient but error-prone non-homologous end joining (NHEJ) pathway; or (2) the less efficient but high-fidelity homology directed repair (HDR) pathway.
  • NHEJ efficient but error-prone non-homologous end joining
  • HDR homology directed repair
  • the “efficiency” of non-homologous end joining (NHEJ) and/or homology directed repair (HDR) can be calculated by any convenient method. For example, in some cases, efficiency can be expressed in terms of percentage of successful HDR.
  • a surveyor nuclease assay can be used to generate cleavage products and the ratio of products to substrate can be used to calculate the percentage.
  • a surveyor nuclease enzyme can be used that directly cleaves DNA containing a newly integrated restriction sequence as the result of successful HDR. More cleaved substrate indicates a greater percent HDR (a greater efficiency of HDR).
  • a fraction (percentage) of HDR can be calculated using the following equation [(cleavage products)/(substrate plus cleavage products)] (e.g., (b+c)/(a+b+c), where “a” is the band intensity of DNA substrate and “b” and “c” are the cleavage products).
  • efficiency can be expressed in terms of percentage of successful NHEJ.
  • a T7 endonuclease I assay can be used to generate cleavage products and the ratio of products to substrate can be used to calculate the percentage NHEJ.
  • T7 endonuclease I cleaves mismatched heteroduplex DNA which arises from hybridization of wild-type and mutant DNA strands (NHEJ generates small random insertions or deletions (indels) at the site of the original break). More cleavage indicates a greater percent NHEJ (a greater efficiency of NHEJ).
  • a fraction (percentage) of NHEJ can be calculated using the following equation: (l-(l-(b+c)/(a+b+c)) 1/2 )xl00, where “a” is the band intensity of DNA substrate and “b” and “c” are the cleavage products (Ran et. al, Cell. 2013 Sep. 12; 154(6): 1380-9; and Ran et al. , Nat Protoc. 2013 Nov.; 8(11): 2281-2308).
  • the NHEJ repair pathway is the most active repair mechanism, and it frequently causes small nucleotide insertions or deletions (indels) at the DSB site.
  • the randomness of NHEJ-mediated DSB repair has important practical implications, because a population of cells expressing Cas9 and a gRNA or a guide polynucleotide can result in a diverse array of mutations.
  • NHEJ gives rise to small indels in the target DNA that result in amino acid deletions, insertions, or frameshift mutations leading to premature stop codons within the open reading frame (ORF) of the targeted gene.
  • ORF open reading frame
  • HDR homology directed repair
  • a DNA repair template containing the desired sequence can be delivered into the cell type of interest with the gRNA(s) and Cas9 or Cas9 nickase.
  • the repair template can contain the desired edit as well as additional homologous sequence immediately upstream and downstream of the target (termed left & right homology arms). The length of each homology arm can be dependent on the size of the change being introduced, with larger insertions requiring longer homology arms.
  • the repair template can be a single-stranded oligonucleotide, double-stranded oligonucleotide, or a double-stranded DNA plasmid.
  • the efficiency of HDR is generally low ( ⁇ 10% of modified alleles) even in cells that express Cas9, gRNA and an exogenous repair template.
  • the efficiency of HDR can be enhanced by synchronizing the cells, since HDR takes place during the S and G2 phases of the cell cycle. Chemically or genetically inhibiting genes involved in NHEJ can also increase HDR frequency.
  • Cas9 is a modified Cas9.
  • a given gRNA targeting sequence can have additional sites throughout the genome where partial homology exists. These sites are called off-targets and need to be considered when designing a gRNA.
  • CRISPR specificity can also be increased through modifications to Cas9.
  • Cas9 generates double-strand breaks (DSBs) through the combined activity of two nuclease domains, RuvC and HNH.
  • Cas9 nickase, a D10A mutant of SpCas9 retains one nuclease domain and generates a DNA nick rather than a DSB.
  • the nickase system can also be combined with HDR-mediated gene editing for specific gene edits.
  • Cas9 is a variant Cas9 protein.
  • a variant Cas9 polypeptide has an amino acid sequence that is different by one amino acid (e.g., has a deletion, insertion, substitution, fusion) when compared to the amino acid sequence of a wild type Cas9 protein.
  • the variant Cas9 polypeptide has an amino acid change (e.g., deletion, insertion, or substitution) that reduces the nuclease activity of the Cas9 polypeptide.
  • the variant Cas9 polypeptide has less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, or less than 1% of the nuclease activity of the corresponding wild-type Cas9 protein.
  • the variant Cas9 protein has no substantial nuclease activity.
  • a subject Cas9 protein is a variant Cas9 protein that has no substantial nuclease activity, it can be referred to as “dCas9.”
  • a variant Cas9 protein has reduced nuclease activity.
  • a variant Cas9 protein exhibits less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 1%, or less than about 0.1%, of the endonuclease activity of a wild-type Cas9 protein, e.g., a wild-type Cas9 protein.
  • a variant Cas9 protein can cleave the complementary strand of a guide target sequence but has reduced ability to cleave the non-complementary strand of a double stranded guide target sequence.
  • the variant Cas9 protein can have a mutation (amino acid substitution) that reduces the function of the RuvC domain.
  • a variant Cas9 protein has a D10A (aspartate to alanine at amino acid position 10) and can therefore cleave the complementary strand of a double stranded guide target sequence but has reduced ability to cleave the non-complementary strand of a double stranded guide target sequence (thus resulting in a single strand break (SSB) instead of a double strand break (DSB) when the variant Cas9 protein cleaves a double stranded target nucleic acid) (see, for example, Jinek et al, Science. 2012 Aug. 17;
  • a variant Cas9 protein can cleave the non-complementary strand of a double stranded guide target sequence but has reduced ability to cleave the complementary strand of the guide target sequence.
  • the variant Cas9 protein can have a mutation (amino acid substitution) that reduces the function of the HNH domain (RuvC/HNH/RuvC domain motifs).
  • the variant Cas9 protein has an H840A (histidine to alanine at amino acid position 840) mutation and can therefore cleave the non-complementary strand of the guide target sequence but has reduced ability to cleave the complementary strand of the guide target sequence (thus resulting in a SSB instead of a DSB when the variant Cas9 protein cleaves a double stranded guide target sequence).
  • H840A histidine to alanine at amino acid position 840
  • Such a Cas9 protein has a reduced ability to cleave a guide target sequence (e.g., a single stranded guide target sequence) but retains the ability to bind a guide target sequence (e.g, a single stranded guide target sequence).
  • a variant Cas9 protein has a reduced ability to cleave both the complementary and the non-complementary strands of a double stranded target DNA.
  • the variant Cas9 protein harbors both the D10A and the H840A mutations such that the polypeptide has a reduced ability to cleave both the complementary and the non-complementary strands of a double stranded target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors W476A and W1126A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g. , a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors H840A, W476A, and W1126A, mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g. , a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors H840A, D10A, W476A, and W1126A, mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 has restored catalytic His residue at position 840 in the Cas9 HNH domain (A840H).
  • the variant Cas9 protein harbors, H840A, P475A, W476A, N477A, D1125 A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors D10A, H840A, P475A, W476A, N477A,
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g. , a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • a target DNA e.g., a single stranded target DNA
  • the variant Cas9 protein does not bind efficiently to a PAM sequence.
  • the method when such a variant Cas9 protein is used in a method of binding, the method does not require a PAM sequence.
  • the method when such a variant Cas9 protein is used in a method of binding, the method can include a guide RNA, but the method can be performed in the absence of a PAM sequence (and the specificity of binding is therefore provided by the targeting segment of the guide RNA).
  • Other residues can be mutated to achieve the above effects (i.e.. inactivate one or the other nuclease portions).
  • residues D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or A987 can be altered (i.e., substituted). Also, mutations other than alanine substitutions are suitable.
  • a variant Cas9 protein that has reduced catalytic activity e.g., when a Cas9 protein has a D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or a A987 mutation, e.g., D10A, G12A, G17A, E762A, H840A, N854A, N863A, H982A, H983A, A984A, and/or D986A), the variant Cas9 protein can still bind to target DNA in a site-specific manner (because it is still guided to a target DNA sequence by a guide RNA) as long as it retains the ability to interact with the guide RNA.
  • the variant Cas9 protein can still bind to target DNA in a site-specific manner (because it is still guided to a target DNA sequence by a guide RNA) as long as it retains the ability to interact with the guide RNA.
  • the variant Cas protein can be spCas9, spCas9-VRQR, spCas9- VRER, xCas9 (sp), saCas9, saCas9-KKH, SpCas9-MQKFRAER, spCas9-MQKSER, spCas9-LRKIQK, or spCas9-LRVSQL.
  • a modified SpCas9 including amino acid substitutions D1135M, S1136Q, G1218K, E1219F, A1322R, D1332A, R1335E, and T1337R (SpCas9- MQKFRAER) and having specificity for the altered PAM 5’-NGC-3’ is used.
  • Cas9 can include RNA-guided endonucleases from the Cpfl family that display cleavage activity in mammalian cells.
  • CRISPR from Prevotella and Francisella 1 (CRISPR/Cpfl) is a DNA-editing technology analogous to the CRISPR/Cas9 system.
  • Cpfl is an RNA-guided endonuclease of a class II CRISPR/Cas system. This acquired immune mechanism is found in Prevotella and Francisella bacteria.
  • Cpfl genes are associated with the CRISPR locus, coding for an endonuclease that use a guide RNA to find and cleave viral DNA.
  • Cpfl is a smaller and simpler endonuclease than Cas9, overcoming some of the CRISPR/Cas9 system limitations. Unlike Cas9 nucleases, the result of Cpfl- mediated DNA cleavage is a double-strand break with a short 3' overhang. Cpfl ’s staggered cleavage pattern can open up the possibility of directional gene transfer, analogous to traditional restriction enzyme cloning, which can increase the efficiency of gene editing. Like the Cas9 variants and orthologues described above, Cpfl can also expand the number of sites that can be targeted by CRISPR to AT-rich regions or AT-rich genomes that lack the NGG PAM sites favored by SpCas9.
  • the Cpfl locus contains a mixed alpha/beta domain, a RuvC-I followed by a helical region, a RuvC-II and a zinc fmger-like domain.
  • the Cpfl protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9. Furthermore, Cpfl does not have a HNH endonuclease domain, and the N-terminal of Cpfl does not have the alpha-helical recognition lobe of Cas9.
  • Cpfl CRISPR-Cas domain architecture shows that Cpfl is functionally unique, being classified as Class 2, type V CRISPR system.
  • the Cpfl loci encode Casl, Cas2 and Cas4 proteins more similar to types I and III than from type II systems. Functional Cpfl doesn’t need the trans-activating CRISPR RNA (tracrRNA), therefore, only CRISPR (crRNA) is required. This benefits genome editing because Cpfl is not only smaller than Cas9, but also it has a smaller sgRNA molecule (proximately half as many nucleotides as Cas9).
  • the Cpfl -crRNA complex cleaves target DNA or RNA by identification of a protospacer adjacent motif 5’-YTN-3’ in contrast to the G-rich PAM targeted by Cas9. After identification of PAM, Cpfl introduces a sticky-end- like DNA double-stranded break of 4 or 5 nucleotides overhang.
  • the Cas9 is a Cas9 variant having specificity for an altered PAM sequence.
  • the Additional Cas9 variants and PAM sequences are described in Miller, S.M., et al. Continuous evolution of SpCas9 variants compatible with non-G PAMs, Nat. Biotechnol. (2020), the entirety of which is incorporated herein by reference in some embodiments, a Cas9 variate have no specific PAM requirements.
  • a Cas9 variant, e.g. a SpCas9 variant has specificity for aNRNH PAM, wherein R is A or G and H is A, C, or T.
  • the SpCas9 variant has specificity for a PAM sequence AAA, TAA, CAA, GAA, TAT, GAT, or CAC.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1134, 1135, 1137, 1139, 1151, 1180, 1188, 1211, 1218, 1219, 1221, 1249, 1256, 1264, 1290, 1318, 1317, 1320, 1321, 1323, 1332, 1333, 1335, 1337, or 1339 or a corresponding position thereof.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1135, 1218, 1219, 1221, 1249, 1320, 1321, 1323, 1332, 1333, 1335, or 1337 or a corresponding position thereof. In some embodiments, the SpCas9 variant comprises an amino acid substitution at position 1114, 1134, 1135, 1137, 1139, 1151, 1180, 1188, 1211, 1219, 1221, 1256, 1264, 1290, 1318, 1317, 1320, 1323, 1333 or a corresponding position thereof.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1131, 1135, 1150, 1156, 1180, 1191, 1218, 1219, 1221, 1227, 1249, 1253, 1286, 1293, 1320, 1321, 1332, 1335, 1339 or a corresponding position thereof.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1127, 1135, 1180, 1207, 1219, 1234, 1286, 1301, 1332, 1335, 1337, 1338, 1349 or a corresponding position thereof.
  • Exemplary amino acid substitutions and PAM specificity of SpCas9 variants are shown in Tables 1A-1D.
  • the Cas9 is a Neisseria meningitidis Cas9 (NmeCas9) or a variant thereof.
  • the NmeCas9 has specificity for aNNNNGAYW PAM, wherein Y is C or T and W is A or T.
  • the NmeCas9 has specificity for a NNNNGYTT PAM, wherein Y is C or T.
  • the NmeCas9 has specificity for a NNNNGYTT PAM, wherein Y is C or T.
  • NmeCas9 has specificity for aNNNNGTCT PAM.
  • the NmeCas9 is a Nmel Cas9.
  • the NmeCas9 has specificity for aNNNNGATT PAM, a NNNNCCTA PAM, aNNNNCCTC PAM, aNNNNCCTT PAM, aNNNNCCTG PAM, a NNNNCCGT PAM, a NNNNCCGGPAM, aNNNNCCCA PAM, aNNNNCCCT PAM, a NNNNCCCC PAM, a NNNNCCAT PAM, a NNNNCCAG PAM, a NNNNCC AT PAM, or aNNNGATT PAM.
  • theNmelCas9 has specificity for aNNNNGATT PAM, a NNNNCCTA PAM, aNNNNCCTC PAM, aNNNNCCTT PAM, or aNNNNCCTG PAM.
  • the NmeCas9 has specificity for a CAA PAM, a CAAA PAM, or a CCA PAM.
  • the NmeCas9 is aNme2 Cas9.
  • the NmeCas9 has specificity for a NNNNCC (N4CC) PAM, wherein N is any one of A, G, C, or T.
  • the NmeCas9 has specificity for a NNNNCCGT PAM, a NNNNCCGGPAM, aNNNNCCCA PAM, aNNNNCCCT PAM, a NNNNCCCC PAM, a NNNNCCAT PAM, a NNNNCCAG PAM, a NNNNCCAT PAM, or aNNNGATT PAM.
  • the NmeCas9 is aNme3Cas9.
  • the NmeCas9 has specificity for a NNNNCAAA PAM, a NNNNCC PAM, or a NNNNCNNN PAM. Additional NmeCas9 features and PAM sequences as described in Edraki et al. Mol. Cell. (2019) 73(4): 714-726 is incorporated herein by reference in its entirety.
  • aNmelCas9 An exemplary amino acid sequence of aNmelCas9 is provided below: type II CRISPR RNA-guided endonuclease Cas9 [Neisseria meningitidis] WP_002235162.1
  • Nme2Cas9 An exemplary amino acid sequence of a Nme2Cas9 is provided below: type II CRISPR RNA-guided endonuclease Cas9 [Neisseria meningitidis ] WP_002230835.1
  • microbial CRISPR-Cas systems are divided into Class 1 and Class 2 systems.
  • Class 1 systems have multisubunit effector complexes
  • Class 2 systems have a single protein effector.
  • Cas9 and Cpfl are Class 2 effectors, albeit different types (Type II and Type V, respectively).
  • Type V CRISPR-Cas systems also comprise Casl2a/Cpfl, Casl2b/C2cl, Casl2c/C2c3, Casl2d/CasY,
  • Casl2e/CasX Casl2g, Casl2h, Casl2i and Casl2j/Cas ⁇ F).
  • Shmakov etal. “Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems,” Mol. Cell, 2015 Nov. 5; 60(3): 385-397; Makarova etal., “Classification and Nomenclature of CRISPR-Cas Systems: Where from Here?” CRISPR Journal, 2018, 1(5): 325-336; and Yan et al, “Functionally Diverse Type V CRISPR-Cas Systems,” Science, 2019 Jan.
  • Type V Cas proteins contain a RuvC (or RuvC-like) endonuclease domain. While production of mature CRISPR RNA (crRNA) is generally tracrRNA-independent, Casl2b/C2cl, for example, requires tracrRNA for production of crRNA. Casl2b/C2cl depends on both crRNA and tracrRNA for DNA cleavage.
  • crRNA CRISPR RNA
  • Nucleic acid programmable DNA binding proteins contemplated in the present invention include Cas proteins that are classified as Class 2, Type V (Cas 12 proteins).
  • Cas Class 2, Type V proteins include Casl2a/Cpfl, Casl2b/C2cl, Casl2c/C2c3, Casl2d/CasY, Casl2e/CasX, Casl2g, Casl2h, Casl2i, and Cas 12j/Cas ⁇ I) homologues thereof, or modified versions thereof.
  • a Cas 12 protein can also be referred to as a Casl2 nuclease, a Casl2 domain, or a Casl2 protein domain.
  • the Casl2 proteins of the present invention comprise an amino acid sequence interrupted by an internally fused protein domain such as a deaminase domain.
  • the Casl2 domain is a nuclease inactive Casl2 domain or a Casl2 nickase.
  • the Casl2 domain is a nuclease active domain.
  • the Cas 12 domain may be a Cas 12 domain that nicks one strand of a duplexed nucleic acid (e.g., duplexed DNA molecule).
  • the Casl2 domain comprises any one of the amino acid sequences as set forth herein.
  • the Casl2 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth herein.
  • the Casl2 domain comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more mutations compared to any one of the amino acid sequences set forth herein.
  • the Casl2 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth herein.
  • proteins comprising fragments of Casl2 are provided.
  • a protein comprises one of two Casl2 domains: (1) the gRNA binding domain of Casl2; or (2) the DNA cleavage domain of Casl2.
  • proteins comprising Casl2 or fragments thereof are referred to as “Casl2 variants.”
  • a Casl2 variant shares homology to Casl2, or a fragment thereof.
  • a Casl2 variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to wild type Casl2.
  • the Cast 2 variant may have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46,
  • the Casl2 variant comprises a fragment of Casl2 (e.g., a gRNA binding domain or a DNA cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to the corresponding fragment of wild type Casl2.
  • a fragment of Casl2 e.g., a gRNA binding domain or a DNA cleavage domain
  • the fragment is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the amino acid length of a corresponding wild type Casl2.
  • the fragment is at least 100 amino acids in length.
  • the fragment is at least 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, or at least 1300 amino acids in length.
  • Casl2 corresponds to, or comprises in part or in whole, a Casl2 amino acid sequence having one or more mutations that alter the Casl2 nuclease activity.
  • Such mutations include amino acid substitutions within the RuvC nuclease domain of Casl2.
  • variants or homologues of Casl2 are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to a wild type Casl2.
  • variants of Casl2 are provided having amino acid sequences which are shorter, or longer, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids or more.
  • Casl2 fusion proteins as provided herein comprise the full- length amino acid sequence of a Casl2 protein, e.g., one of the Casl2 sequences provided herein. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length Casl2 sequence, but only one or more fragments thereof. Exemplary amino acid sequences of suitable Casl2 domains are provided herein, and additional suitable sequences of Casl2 domains and fragments will be apparent to those of skill in the art.
  • the class 2, Type V Cas proteins have a single functional RuvC endonuclease domain (See, e.g., Chen etal, “CRISPR-Cas 12a target binding unleashes indiscriminate single-stranded DNase activity,” Science 360:436-439 (2016)).
  • the Cas 12 protein is a variant Cas 12b protein. (See Strecker et al, Nature Communications, 2019, 10(1): Art. No.: 212).
  • a variant Casl2 polypeptide has an amino acid sequence that is different by 1, 2, 3, 4, 5 or more amino acids (e.g., has a deletion, insertion, substitution, fusion) when compared to the amino acid sequence of a wild type Cas 12 protein.
  • the variant Cas 12 polypeptide has an amino acid change (e.g., deletion, insertion, or substitution) that reduces the activity of the Casl2 polypeptide.
  • the variant Casl2 is a Casl2b polypeptide that has less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, or less than 1% of the nickase activity of the corresponding wild-type Casl2b protein.
  • the variant Casl2b protein has no substantial nickase activity.
  • a variant Casl2b protein has reduced nickase activity.
  • a variant Casl2b protein exhibits less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 1%, or less than about 0.1%, of the nickase activity of a wild-type Casl2b protein.
  • the Casl2 protein includes RNA-guided endonucleases from the Casl2a/Cpfl family that displays activity in mammalian cells.
  • CRISPR from Prevotella and Francisella 1 (CRISPR/Cpfl) is a DNA editing technology analogous to the CRISPR/Cas9 system.
  • Cpfl is an RNA-guided endonuclease of a class II CRISPR/Cas system. This acquired immune mechanism is found in Prevotella and Francisella bacteria.
  • Cpfl genes are associated with the CRISPR locus, coding for an endonuclease that use a guide RNA to find and cleave viral DNA.
  • Cpfl is a smaller and simpler endonuclease than Cas9, overcoming some of the CRISPR/Cas9 system limitations. Unlike Cas9 nucleases, the result of Cpfl -mediated DNA cleavage is a double-strand break with a short 3' overhang. Cpfl’s staggered cleavage pattern can open up the possibility of directional gene transfer, analogous to traditional restriction enzyme cloning, which can increase the efficiency of gene editing. Like the Cas9 variants and orthologues described above, Cpfl can also expand the number of sites that can be targeted by CRISPR to AT-rich regions or AT-rich genomes that lack the NGG PAM sites favored by SpCas9.
  • the Cpfl locus contains a mixed alpha/beta domain, a RuvC-I followed by a helical region, a RuvC-II and a zinc fmger-like domain.
  • the Cpfl protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9.
  • Cpfl unlike Cas9, does not have a HNH endonuclease domain, and the N-terminal of Cpfl does not have the alpha-helical recognition lobe of Cas9.
  • Cpfl CRISPR- Cas domain architecture shows that Cpfl is functionally unique, being classified as Class 2, type V CRISPR system.
  • the Cpfl -crRNA complex cleaves target DNA or RNA by identification of a protospacer adjacent motif 5’- YTN-3’ or 5’-TTTN-3’ in contrast to the G-rich PAM targeted by Cas9. After identification of PAM, Cpfl introduces a sticky-end-bke DNA double-stranded break having an overhang of 4 or 5 nucleotides.
  • a vector encodes a CRISPR enzyme that is mutated to with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence
  • Casl2 can refer to a polypeptide with at least or at least about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild type exemplary Casl2 polypeptide (e.g., Casl2 from Bacillus hisashii).
  • Casl2 can refer to a polypeptide with at most or at most about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild type exemplary Casl2 polypeptide (e.g., from Bacillus hisashii (BhCasl2b), Bacillus sp. V3-13 (BvCasl2b), and Alicyclobacillus acidiphilus (AaCasl2b)).
  • Casl2 can refer to the wild type or a modified form of the Casl2 protein that can comprise an amino acid change such as a deletion, insertion, substitution, variant, mutation, fusion, chimera, or any combination thereof.
  • BhCasl2b guide polynucleotide has the following sequence: BhCasl2b sgRNA scaffold (underlined) + 20nt to 23nt guide sequence (denoted by N n )
  • BvCasl2b and AaCasl2b guide polynucleotides have the following sequences:
  • BvCasl2b sgRNA scaffold (underlined) + 20nt to 23nt guide sequence (denoted by N n )
  • AaCasl2b sgRNA scaffold (underlined) + 20nt to 23nt guide sequence (denoted by N n )
  • fusion proteins comprising domains that act as nucleic acid programmable DNA binding proteins, which may be used to guide a protein, such as a base editor, to a specific nucleic acid (e.g., DNA or RNA) sequence.
  • a fusion protein comprises a nucleic acid programmable DNA binding protein domain and a deaminase domain.
  • Non-limiting examples of nucleic acid programmable DNA binding proteins include, Cas9 (e.g., dCas9 and nCas9), Casl2a/Cpfl, Casl2b/C2cl, Casl2c/C2c3, Casl2d/CasY, Casl2e/CasX, Casl2g, Casl2h, Casl2i and Cas 12j/Cas ⁇ I).
  • Non limiting examples of Cas enzymes include Casl, CaslB, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas8a, Cas8b, Cas8c, Cas9 (also known as Csnl or Csxl2), CaslO, CaslOd, Casl2a/Cpfl, Casl2b/C2cl, Casl2c/C2c3, Casl2d/CasY, Casl2e/CasX, Casl2g, Casl2h, Casl2i, Casl2j/Cas ⁇ D, Csyl , Csy2, Csy3, Csy4, Csel, Cse2, Cse3, Cse4, Cse5e, Cscl, Csc2, Csa5, Csnl, Csn2, Csml
  • nucleic acid programmable DNA binding proteins are also within the scope of this disclosure, although they may not be specifically listed in this disclosure. See, e.g., Makarova et al. “Classification and Nomenclature of CRISPR-Cas Systems: Where from Here?” CRISPR J. 2018 Oct;l:325-336. doi: 10.1089/crispr.2018.0033; Yan etal, “Functionally diverse type V CRISPR-Cas systems” Science. 2019 Jan 4;363(6422):88-91. doi: 10.1126/science.aav7271, the entire contents of each are hereby incorporated by reference.
  • Cpfl Clustered Regularly Interspaced Short Palindromic Repeats from Prevotella and Francisella 1
  • Cpfl is also a class 2 CRISPR effector. It has been shown that Cpfl mediates robust DNA interference with features distinct from Cas9.
  • Cpfl is a single RNA-guided endonuclease lacking tracrRNA, and it utilizes a T- rich protospacer-adjacent motif (TTN, TTTN, or YTN).
  • TTN T- rich protospacer-adjacent motif
  • TTTN TTN
  • YTN T- rich protospacer-adjacent motif
  • Cpfl proteins are known in the art and have been described previously, for example Yamano etal, “Crystal structure of Cpfl in complex with guide RNA and target DNA.” Cell (165) 2016, p. 949-962; the entire contents of which is hereby incorporated by reference.
  • nuclease-inactive Cpfl (dCpfl) variants that may be used as a guide nucleotide sequence-programmable DNA-binding protein domain.
  • the Cpfl protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9 but does not have a HNH endonuclease domain, and the N-terminal of Cpfl does not have the alfa-helical recognition lobe of Cas9.
  • the RuvC-like domain of Cpfl is responsible for cleaving both DNA strands and inactivation of the RuvC- like domain inactivates Cpfl nuclease activity.
  • mutations corresponding to D917A, E1006A, or D1255A in Francisella novicida Cpfl inactivate Cpfl nuclease activity.
  • the dCpfl of the present disclosure comprises mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A. It is to be understood that any mutations, e.g., substitution mutations, deletions, or insertions that inactivate the RuvC domain of Cpfl, may be used in accordance with the present disclosure.
  • the nucleic acid programmable DNA binding protein (napDNAbp) of any of the fusion proteins provided herein may be a Cpfl protein.
  • the Cpfl protein is a Cpfl nickase (nCpfl).
  • the Cpfl protein is a nuclease inactive Cpfl (dCpfl).
  • the Cpfl, the nCpfl, or the dCpfl comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a Cpfl sequence disclosed herein.
  • the dCpfl comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a Cpfl sequence disclosed herein, and comprises mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A. It should be appreciated that Cpfl from other bacterial species may also be used in accordance with the present disclosure.
  • one of the Cas9 domains present in the fusion protein may be replaced with a guide nucleotide sequence-programmable DNA-binding protein domain that has no requirements for a PAM sequence.
  • the Cas9 domain is a Cas9 domain from Staphylococcus aureus (SaCas9).
  • the SaCas9 domain is a nuclease active SaCas9, a nuclease inactive SaCas9 (SaCas9d), or a SaCas9 nickase (SaCas9n).
  • the SaCas9 comprises aN579A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM. In some embodiments, the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a NNGRRT or a NNGRRT PAM sequence. In some embodiments, the SaCas9 domain comprises one or more of a E781X, aN967X, and a R1014X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SaCas9 domain comprises one or more of a E781K, aN967K, and a R1014H mutation, or one or more corresponding mutation in any of the amino acid sequences provided herein. In some embodiments, the SaCas9 domain comprises a E781K, aN967K, or a R1014H mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • Residue N579 above which is underlined and in bold, may be mutated ( e.g to a A579) to yield a SaCas9 nickase.
  • Exemplary SaCas9n sequence Residue A579 above which can be mutated from N579 to yield a SaCas9 nickase, is underlined and in bold.
  • Residue A579 above which can be mutated from N579 to yield a SaCas9 nickase, is underlined and in bold.
  • Residues K781, K967, and H1014 above which can be mutated from E781, N967, and R1014 to yield a SaKKH Cas9 are underlined and in italics.
  • the napDNAbp is a circular permutant.
  • the plain text denotes an adenosine deaminase sequence
  • bold sequence indicates sequence derived from Cas9
  • the italicized sequence denotes a linker sequence
  • the underlined sequence denotes a bipartite nuclear localization sequence
  • double underlined sequence indicates mutations.
  • the nucleic acid programmable DNA binding protein is a single effector of a microbial CRISPR-Cas system.
  • Single effectors of microbial CRISPR-Cas systems include, without limitation, Cas9, Cpfl, Casl2b/C2cl, and Casl2c/C2c3.
  • microbial CRISPR-Cas systems are divided into Class 1 and Class 2 systems. Class 1 systems have multisubunit effector complexes, while Class 2 systems have a single protein effector. For example, Cas9 and Cpfl are Class 2 effectors.
  • Casl2b/C2cl Production of mature CRISPR RNA is tracrRNA-independent, unlike production of CRISPR RNA by Casl2b/C2cl.
  • Casl2b/C2cl depends on both CRISPR RNA and tracrRNA for DNA cleavage.
  • the crystal structure of Alicyclobaccillus acidoterrastris Casl2b/C2cl has been reported in complex with a chimeric single-molecule guide RNA (sgRNA).
  • sgRNA single-molecule guide RNA
  • the crystal structure has also been reported in Alicyclobacillus acidoterrestris C2cl bound to target DNAs as ternary complexes. See e.g., Yang et al,
  • the nucleic acid programmable DNA binding protein (napDNAbp) of any of the fusion proteins provided herein may be a Casl2b/C2cl, or a Casl2c/C2c3 protein.
  • the napDNAbp is a Casl2b/C2cl protein.
  • the napDNAbp is a Casl2c/C2c3 protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally-occurring Casl2b/C2cl or Casl2c/C2c3 protein.
  • the napDNAbp is a naturally-occurring Casl2b/C2cl or Casl2c/C2c3 protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any one of the napDNAbp sequences provided herein. It should be appreciated that Casl2b/C2cl or Casl2c/C2c3 from other bacterial species may also be used in accordance with the present disclosure.
  • a Casl2b/C2cl ((uniprot.org/uniprot/T0D7 A2#2) sp
  • C2cl OS Alicyclobacillus acido-terrestris (strain ATCC 49025 / DSM 3922/ CIP 106132 /NCIMB 13137/GD3B)
  • the Casl2b is BvCasl2b (V4), which is a variant of BhCasl2b and comprises the following changes relative to BhCasl2b: S893R, K846R, and E837G. BhCasl2b (V4) is expressed as follows: 5' mRNA Cap— 5'UTR— bhCasl2b — STOP sequence — 3'UTR — 120polyA tail.
  • the Casl2b is BvCasl2B. In some embodiments, the Casl2b comprises amino acid substitutions S893R, K846R, and E837G as numbered in the BvCasl2b exemplary sequence provided below.
  • the Casl2b is BTCasl2b.BTCasl2b ⁇ Bacillus thermoamylovorans ) NCBI Reference Sequence: WP_041902512
  • a napDNAbp refers to Casl2c.
  • the Casl2c protein is a Casl2cl or a variant of Casl2cl.
  • the Casl2 protein is a Casl2c2 or a variant of Casl2c2.
  • the Casl2 protein is a Casl2c protein from Oleiphilus sp. HI0009 (i.e., OspCasl2c) or a variant of OspCasl2c.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring Casl2cl, Casl2c2, or OspCasl2c protein.
  • the napDNAbp is a naturally-occurring Casl2cl, Casl2c2, or OspCasl2c protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any Casl2cl, Casl2c2, or OspCasl2c protein described herein. It should be appreciated that Casl2cl, Casl2c2, or OspCasl2c from other bacterial species may also be used in accordance with the present disclosure.
  • a napDNAbp refers to Casl2g, Casl2h, or Casl2i, which have been described in, for example, Yan et al, “Functionally Diverse Type V CRISPR-Cas Systems,” Science, 2019 Jan. 4; 363: 88-91; the entire contents of each is hereby incorporated by reference.
  • the Casl2 protein is a Casl2g or a variant of Casl2g.
  • the Casl2 protein is a Casl2h or a variant of Casl2h. In some embodiments, the Casl2 protein is a Casl2i or a variant of Casl2i. It should be appreciated that other RNA-guided DNA binding proteins may be used as a napDNAbp, and are within the scope of this disclosure.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring Casl2g, Casl2h, or Casl2i protein.
  • the napDNAbp is a naturally-occurring Casl2g, Casl2h, or Casl2i protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any Casl2g, Casl2h, or Casl2i protein described herein. It should be appreciated that Casl2g, Casl2h, or Casl2i from other bacterial species may also be used in accordance with the present disclosure. In some embodiments, the Casl2i is a Casl2il or a
  • Cas ⁇ D-l is also termed Casl2j ortholog 1.
  • Cas ⁇ D-l- Cas ⁇ D-10 may also be referred to as Casl2j orthologs 1-10, respectively.
  • the guide polynucleotide is a guide RNA.
  • guide RNA gRNA
  • gRNA guide RNA
  • the term “guide RNA (gRNA)” and its grammatical equivalents can refer to an RNA which can be specific for a target DNA and can form a complex with Cas protein.
  • An RNA/Cas complex can assist in “guiding” Cas protein to a target DNA.
  • RNA-binding and cleavage typically requires protein and both RNAs.
  • single guide RNAs (“sgRNA”, or simply “gRNA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M. et al, Science 337:816-821(2012), the entire contents of which is hereby incorporated by reference.
  • Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self-versus-non-self.
  • Cas9 nuclease sequences and structures are well known to those of skill in the art (see e.g., “Complete genome sequence of an Ml strain of Streptococcus pyogenes ” Ferretti, J.J. et al, Proc. Natl. Acad. Sci. U.S.A. 98:4658-4663(2001); “CRISPR RNA maturation by trans- encoded small RNA and host factor RNase III.” Deltcheva E. et al.
  • Cas9 nucleases and sequences can be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier, “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference.
  • a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase.
  • the guide polynucleotide is at least one single guide RNA (“sgRNA” or “gRNA”). In some embodiments, the guide polynucleotide is at least one tracrRNA. In some embodiments, the guide polynucleotide does not require PAM sequence to guide the polynucleotide-programmable DNA-binding domain (e.g., Cas9 or Cpfl) to the target nucleotide sequence.
  • the polynucleotide programmable nucleotide binding domain (e.g., a CRISPR- derived domain) of the base editors disclosed herein can recognize a target polynucleotide sequence by associating with a guide polynucleotide.
  • a guide polynucleotide e.g., gRNA
  • a guide polynucleotide is typically single-stranded and can be programmed to site-specifically bind (i.e., via complementary base pairing) to a target sequence of a polynucleotide, thereby directing a base editor that is in conjunction with the guide nucleic acid to the target sequence.
  • a guide polynucleotide can be DNA.
  • a guide polynucleotide can be RNA.
  • uracil (U) replaces thymine (T) in the sequence.
  • the guide polynucleotide comprises natural nucleotides (e.g., adenosine).
  • the guide polynucleotide comprises non-natural (or unnatural) nucleotides (e.g., peptide nucleic acid or nucleotide analogs).
  • the targeting region of a guide nucleic acid sequence can be at least 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length.
  • a targeting region of a guide nucleic acid can be between 10-30 nucleotides in length, or between 15-25 nucleotides in length, or between 15-20 nucleotides in length.
  • a guide polynucleotide may be truncated by 1, 2, 3, 4, etc. nucleotides, particularly at the 5' end.
  • a guide polynucleotide of 20 nucleotides in length may be truncated by 1, 2, 3, 4, etc. nucleotides, particularly at the 5' end.
  • a guide polynucleotide comprises two or more individual polynucleotides, which can interact with one another via for example complementary base pairing (e.g., a dual guide polynucleotide).
  • a guide polynucleotide can comprise a CRISPR RNA (crRNA) and a trans-activating CRISPR RNA (tracrRNA).
  • a guide polynucleotide can comprise one or more trans-activating CRISPR RNA (tracrRNA).
  • RNA molecules comprising a sequence that recognizes the target sequence
  • trRNA second RNA molecule
  • Such dual guide RNA systems can be employed as a guide polynucleotide to direct the base editors disclosed herein to a target polynucleotide sequence.
  • the base editor provided herein utilizes a single guide polynucleotide (e.g., sgRNA). In some embodiments, the base editor provided herein utilizes a dual guide polynucleotide (e.g., dual gRNAs). In some embodiments, the base editor provided herein utilizes one or more guide polynucleotide (e.g., multiple gRNA). In some embodiments, a single guide polynucleotide is utilized for different base editors described herein. For example, a single guide polynucleotide can be utilized for a cytidine base editor and an adenosine base editor.
  • a single guide polynucleotide can be utilized for a cytidine base editor and an adenosine base editor.
  • a guide polynucleotide can comprise both the polynucleotide targeting portion of the nucleic acid and the scaffold portion of the nucleic acid in a single molecule (i.e., a single-molecule guide nucleic acid).
  • a single-molecule guide polynucleotide can be a single guide RNA (sgRNA or gRNA).
  • sgRNA or gRNA single guide RNA
  • guide polynucleotide sequence contemplates any single, dual or multi-molecule nucleic acid capable of interacting with and directing a base editor to a target polynucleotide sequence.
  • a guide polynucleotide (e.g., crRNA/trRNA complex or a gRNA) comprises a “polynucleotide-targeting segment” that includes a sequence capable of recognizing and binding to a target polynucleotide sequence, and a “protein-binding segment” that stabilizes the guide polynucleotide within a polynucleotide programmable nucleotide binding domain component of a base editor.
  • the polynucleotide targeting segment of the guide polynucleotide recognizes and binds to a DNA polynucleotide, thereby facilitating the editing of a base in DNA.
  • the polynucleotide targeting segment of the guide polynucleotide recognizes and binds to an RNA polynucleotide, thereby facilitating the editing of a base in RNA.
  • a “segment” refers to a section or region of a molecule, e.g., a contiguous stretch of nucleotides in the guide polynucleotide.
  • a segment can also refer to a region/section of a complex such that a segment can comprise regions of more than one molecule.
  • a protein-binding segment of a DNA-targeting RNA that comprises two separate molecules can comprise (i) base pairs 40-75 of a first RNA molecule that is 100 base pairs in length; and (ii) base pairs 10-25 of a second RNA molecule that is 50 base pairs in length.
  • segment unless otherwise specifically defined in a particular context, is not limited to a specific number of total base pairs, is not limited to any particular number of base pairs from a given RNA molecule, is not limited to a particular number of separate molecules within a complex, and can include regions of RNA molecules that are of any total length and can include regions with complementarity to other molecules.
  • a guide RNA or a guide polynucleotide can comprise two or more RNAs, e.g., CRISPR RNA (crRNA) and transactivating crRNA (tracrRNA).
  • a guide RNA or a guide polynucleotide can sometimes comprise a single-chain RNA, or single guide RNA (sgRNA) formed by fusion of a portion (e.g., a functional portion) of crRNA and tracrRNA.
  • sgRNA single guide RNA
  • a guide RNA or a guide polynucleotide can also be a dual RNA comprising a crRNA and a tracrRNA.
  • a crRNA can hybridize with a target DNA.
  • a guide RNA or a guide polynucleotide can be an expression product.
  • a DNA that encodes a guide RNA can be a vector comprising a sequence coding for the guide RNA.
  • a guide RNA or a guide polynucleotide can be transferred into a cell by transfecting the cell with an isolated guide RNA or plasmid DNA comprising a sequence coding for the guide RNA and a promoter.
  • a guide RNA or a guide polynucleotide can also be transferred into a cell in other way, such as using virus-mediated gene delivery.
  • a guide RNA or a guide polynucleotide can be isolated.
  • a guide RNA can be transfected in the form of an isolated RNA into a cell or organism.
  • a guide RNA can be prepared by in vitro transcription using any in vitro transcription system known in the art.
  • a guide RNA can be transferred to a cell in the form of isolated RNA rather than in the form of plasmid comprising encoding sequence for a guide RNA.
  • a guide RNA or a guide polynucleotide can comprise three regions: a first region at the 5’ end that can be complementary to a target site in a chromosomal sequence, a second internal region that can form a stem loop structure, and a third 3’ region that can be single- stranded.
  • a first region of each guide RNA can also be different such that each guide RNA guides a fusion protein to a specific target site.
  • second and third regions of each guide RNA can be identical in all guide RNAs.
  • a first region of a guide RNA or a guide polynucleotide can be complementary to sequence at a target site in a chromosomal sequence such that the first region of the guide RNA can base pair with the target site.
  • a first region of a guide RNA can comprise from or from about 10 nucleotides to 25 nucleotides (i.e.. from 10 nucleotides to nucleotides; or from about 10 nucleotides to about 25 nucleotides; or from 10 nucleotides to about 25 nucleotides; or from about 10 nucleotides to 25 nucleotides) or more.
  • a region of base pairing between a first region of a guide RNA and a target site in a chromosomal sequence can be or can be about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22,
  • a first region of a guide RNA can be or can be about 19, 20, or 21 nucleotides in length.
  • a guide RNA or a guide polynucleotide can also comprise a second region that forms a secondary structure.
  • a secondary structure formed by a guide RNA can comprise a stem (or hairpin) and a loop.
  • a length of a loop and a stem can vary.
  • a loop can range from or from about 3 to 10 nucleotides in length
  • a stem can range from or from about 6 to 20 base pairs in length.
  • a stem can comprise one or more bulges of 1 to 10 or about 10 nucleotides.
  • the overall length of a second region can range from or from about 16 to 60 nucleotides in length.
  • a loop can be or can be about 4 nucleotides in length and a stem can be or can be about 12 base pairs.
  • a guide RNA or a guide polynucleotide can also comprise a third region at the 3' end that can be essentially single-stranded.
  • a third region is sometimes not complementarity to any chromosomal sequence in a cell of interest and is sometimes not complementarity to the rest of a guide RNA.
  • the length of a third region can vary.
  • a third region can be more than or more than about 4 nucleotides in length.
  • the length of a third region can range from or from about 5 to 60 nucleotides in length.
  • a guide RNA or a guide polynucleotide can target any exon or intron of a gene target.
  • a guide can target exon 1 or 2 of a gene, in other cases; a guide can target exon 3 or 4 of a gene.
  • a composition can comprise multiple guide RNAs that all target the same exon or in some cases, multiple guide RNAs that can target different exons. An exon and an intron of a gene can be targeted.
  • a guide RNA or a guide polynucleotide can target a nucleic acid sequence of or of about 20 nucleotides.
  • a target nucleic acid can be less than or less than about 20 nucleotides.
  • a target nucleic acid can be at least or at least about 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23,
  • a target nucleic acid can be at most or at most about 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 40, 50, or anywhere between 1-100 nucleotides in length.
  • a target nucleic acid sequence can be or can be about 20 bases immediately 5’ of the first nucleotide of the PAM.
  • a guide RNA can target a nucleic acid sequence.
  • a target nucleic acid can be at least or at least about 1-10, 1-20, 1-30, 1-40, 1-50, 1-60, 1-70, 1-80, 1-90, or 1-100 nucleotides.
  • a guide polynucleotide for example, a guide RNA, can refer to a nucleic acid that can hybridize to another nucleic acid, for example, the target nucleic acid or protospacer in a genome of a cell.
  • a guide polynucleotide can be RNA.
  • a guide polynucleotide can be DNA.
  • the guide polynucleotide can be programmed or designed to bind to a sequence of nucleic acid site-specifically.
  • a guide polynucleotide can comprise a polynucleotide chain and can be called a single guide polynucleotide.
  • a guide polynucleotide can comprise two polynucleotide chains and can be called a double guide polynucleotide.
  • a guide RNA can be introduced into a cell or embryo as an RNA molecule.
  • a RNA molecule can be transcribed in vitro and/or can be chemically synthesized.
  • An RNA can be transcribed from a synthetic DNA molecule, e.g., a gBlocks® gene fragment.
  • a guide RNA can then be introduced into a cell or embryo as an RNA molecule.
  • a guide RNA can also be introduced into a cell or embryo in the form of a non-RNA nucleic acid molecule, e.g., DNA molecule.
  • a DNA encoding a guide RNA can be operably linked to promoter control sequence for expression of the guide RNA in a cell or embryo of interest.
  • a RNA coding sequence can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III).
  • Plasmid vectors that can be used to express guide RNA include, but are not limited to, px330 vectors and px333 vectors.
  • a plasmid vector (e.g., px333 vector) can comprise at least two guide RNA-encoding DNA sequences.
  • RNAs and targeting sequences are described herein and known to those skilled in the art.
  • the number of residues that could unintentionally be targeted for deamination e.g., off-target C residues that could potentially reside on ssDNA within the target nucleic acid locus
  • software tools can be used to optimize the gRNAs corresponding to a target nucleic acid sequence, e.g., to minimize total off-target activity across the genome.
  • all off-target sequences may be identified across the genome that contain up to certain number (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of mismatched base-pairs.
  • First regions of gRNAs complementary to a target site can be identified, and all first regions (e.g., crRNAs) can be ranked according to its total predicted off-target score; the top-ranked targeting domains represent those that are likely to have the greatest on-target and the least off-target activity.
  • Candidate targeting gRNAs can be functionally evaluated by using methods known in the art and/or as set forth herein.
  • target DNA hybridizing sequences in crRNAs of a guide RNA for use with Cas9s may be identified using a DNA sequence searching algorithm.
  • gRNA design may be carried out using custom gRNA design software based on the public tool cas-offmder as described in Bae S., Park I, & Kim J.-S. Cas-OFFinder: A fast and versatile algorithm that searches for potential off-target sites of Cas9 RNA-guided endonucleases. Bioinformatics 30, 1473-1475 (2014). This software scores guides after calculating their genome-wide off-target propensity. Typically matches ranging from perfect matches to 7 mismatches are considered for guides ranging in length from 17 to 24.
  • an aggregate score is calculated for each guide and summarized in a tabular output using a web-interface.
  • the software also identifies all PAM adjacent sequences that differ by 1, 2, 3 or more than 3 nucleotides from the selected target sites.
  • Genomic DNA sequences for a target nucleic acid sequence e.g., a target gene may be obtained and repeat elements may be screened using publicly available tools, for example, the RepeatMasker program. RepeatMasker searches input DNA sequences for repeated elements and regions of low complexity. The output is a detailed annotation of the repeats present in a given query sequence.
  • first regions of guide RNAs may be ranked into tiers based on their distance to the target site, their orthogonality and presence of 5’ nucleotides for close matches with relevant PAM sequences (for example, a 5' G based on identification of close matches in the human genome containing a relevant PAM e.g., NGG PAM for S. pyogenes, NNGRRT or NNGRRV PAM for S. aureus).
  • relevant PAM for example, a 5' G based on identification of close matches in the human genome containing a relevant PAM e.g., NGG PAM for S. pyogenes, NNGRRT or NNGRRV PAM for S. aureus.
  • orthogonality refers to the number of sequences in the human genome that contain a minimum number of mismatches to the target sequence.
  • a “high level of orthogonality” or “good orthogonality” may, for example, refer to 20-mer targeting domains that have no identical sequences in the human genome besides the intended target, nor any sequences that contain one or two mismatches in the target sequence. Targeting domains with good orthogonality may be selected to minimize off-target DNA cleavage.
  • a reporter system may be used for detecting base-editing activity and testing candidate guide polynucleotides.
  • a reporter system may comprise a reporter gene based assay where base editing activity leads to expression of the reporter gene.
  • a reporter system may include a reporter gene comprising a deactivated start codon, e.g., a mutation on the template strand from 3'-TAC-5' to 3'-CAC-5'.
  • a deactivated start codon e.g., a mutation on the template strand from 3'-TAC-5' to 3'-CAC-5'.
  • the corresponding mRNA Upon successful deamination of the target C, the corresponding mRNA will be transcribed as 5'-AUG-3' instead of 5'-GUG-3', enabling the translation of the reporter gene.
  • Suitable reporter genes will be apparent to those of skill in the art.
  • Non-limiting examples of reporter genes include gene encoding green fluorescence protein (GFP), red fluorescence protein (RFP), luciferase, secreted alkaline phosphatase (SEAP), or any other gene whose expression are detectable and apparent to those skilled in the art.
  • the reporter system can be used to test many different gRNAs, e.g., in order to determine which residue(s) with respect to the target DNA sequence the respective deaminase will target.
  • sgRNAs that target non-template strand can also be tested in order to assess off-target effects of a specific base editing protein, e.g., a Cas9 deaminase fusion protein.
  • gRNAs can be designed such that the mutated start codon will not be base-paired with the gRNA.
  • the guide polynucleotides can comprise standard ribonucleotides, modified ribonucleotides (e.g., pseudouridine), ribonucleotide isomers, and/or ribonucleotide analogs.
  • the guide polynucleotide can comprise at least one detectable label.
  • the detectable label can be a fluorophore (e.g., FAM, TMR, Cy3, Cy5, Texas Red, Oregon Green, Alexa Fluors, Halo tags, or suitable fluorescent dye), a detection tag (e.g., biotin, digoxigenin, and the like), quantum dots, or gold particles.
  • the guide polynucleotides can be synthesized chemically, synthesized enzymatically, or a combination thereof.
  • the guide RNA can be synthesized using standard phosphoramidite-based solid-phase synthesis methods.
  • the guide RNA can be synthesized in vitro by operably linking DNA encoding the guide RNA to a promoter control sequence that is recognized by a phage RNA polymerase. Examples of suitable phage promoter sequences include T7, T3, SP6 promoter sequences, or variations thereof.
  • the guide RNA comprises two separate molecules (e.g.., crRNA and tracrRNA)
  • the crRNA can be chemically synthesized and the tracrRNA can be enzymatically synthesized.
  • a base editor system may comprise multiple guide polynucleotides, e.g., gRNAs.
  • the gRNAs may target to one or more target loci (e.g., at least 1 gRNA, at least 2 gRNA, at least 5 gRNA, at least 10 gRNA, at least 20 gRNA, at least 30 g RNA, at least 50 gRNA) comprised in a base editor system.
  • the multiple gRNA sequences can be tandemly arranged and are preferably separated by a direct repeat.
  • a DNA sequence encoding a guide RNA or a guide polynucleotide can also be part of a vector. Further, a vector can comprise additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., GFP or antibiotic resistance genes such as puromycin), origins of replication, and the like.
  • a DNA molecule encoding a guide RNA can also be linear.
  • a DNA molecule encoding a guide RNA or a guide polynucleotide can also be circular.
  • one or more components of a base editor system may be encoded by DNA sequences.
  • DNA sequences may be introduced into an expression system, e.g., a cell, together or separately.
  • DNA sequences encoding a polynucleotide programmable nucleotide binding domain and a guide RNA may be introduced into a cell, each DNA sequence can be part of a separate molecule (e.g., one vector containing the polynucleotide programmable nucleotide binding domain coding sequence and a second vector containing the guide RNA coding sequence) or both can be part of a same molecule (e.g., one vector containing coding (and regulatory) sequence for both the polynucleotide programmable nucleotide binding domain and the guide RNA).
  • a guide polynucleotide can comprise one or more modifications to provide a nucleic acid with a new or enhanced feature.
  • a guide polynucleotide can comprise a nucleic acid affinity tag.
  • a guide polynucleotide can comprise synthetic nucleotide, synthetic nucleotide analog, nucleotide derivatives, and/or modified nucleotides.
  • a gRNA or a guide polynucleotide can comprise modifications.
  • a modification can be made at any location of a gRNA or a guide polynucleotide. More than one modification can be made to a single gRNA or a guide polynucleotide.
  • a gRNA or a guide polynucleotide can undergo quality control after a modification. In some cases, quality control can include PAGE, HPLC, MS, or any combination thereof.
  • a modification of a gRNA or a guide polynucleotide can be a substitution, insertion, deletion, chemical modification, physical modification, stabilization, purification, or any combination thereof.
  • a gRNA or a guide polynucleotide can also be modified by 5 ’adenylate, 5’ guanosine-triphosphate cap, 5’N7-Methylguanosine-triphosphate cap, 5 ’triphosphate cap, 3’phosphate, 3’thiophosphate, 5’phosphate, 5’thiophosphate, Cis-Syn thymidine dimer, trimers, C12 spacer, C3 spacer, C6 spacer, dSpacer, PC spacer, rSpacer, Spacer 18, Spacer 9,3 ’-3’ modifications, 5 ’-5’ modifications, abasic, acridine, azobenzene, biotin, biotin BB, biotin TEG, cholesteryl TEG, desthiobiotin TEG, DNP TEG, DNP-X, DOTA, dT-Biotin, dual biotin, PC biotin, psoralen C2, psoralen C6, TINA
  • a modification is permanent. In other cases, a modification is transient. In some cases, multiple modifications are made to a gRNA or a guide polynucleotide.
  • a gRNA or a guide polynucleotide modification can alter physiochemical properties of a nucleotide, such as their conformation, polarity, hydrophobicity, chemical reactivity, base-pairing interactions, or any combination thereof.
  • a modification can also be a phosphorothioate substitute.
  • a natural phosphodiester bond can be susceptible to rapid degradation by cellular nucleases and; a modification of intemucleotide linkage using phosphorothioate (PS) bond substitutes can be more stable towards hydrolysis by cellular degradation.
  • PS phosphorothioate
  • a modification can increase stability in a gRNA or a guide polynucleotide.
  • a modification can also enhance biological activity.
  • a phosphorothioate enhanced RNA gRNA can inhibit RNase A, RNase Tl, calf serum nucleases, or any combinations thereof.
  • PS- RNA gRNAs can be used in applications where exposure to nucleases is of high probability in vivo or in vitro.
  • phosphorothioate (PS) bonds can be introduced between the last 3-5 nucleotides at the 5’- or ‘'-end of a gRNA which can inhibit exonuclease degradation.
  • phosphorothioate bonds can be added throughout an entire gRNA to reduce attack by endonucleases.
  • PAM protospacer adjacent motif
  • PAM-like motif refers to a 2-6 base pair DNA sequence immediately following the DNA sequence targeted by the Cas9 nuclease in the CRISPR bacterial adaptive immune system.
  • the PAM can be a 5’ PAM (i.e., located upstream of the 5’ end of the protospacer).
  • the PAM can be a 3’ PAM (i.e., located downstream of the 5’ end of the protospacer).
  • the PAM sequence is essential for target binding, but the exact sequence depends on a type of Cas protein.
  • the PAM sequence can be any PAM sequence known in the art. Suitable PAM sequences include, but are not limited to, NGG, NGA, NGC, NGN, NGT, NGTT, NGCG, NGAG, NGAN, NGNG, NGCN, NGCG, NGTN, NNGRRT, NNNRRT, NNGRR(N), TTTV, TYCV, TYCV, TATV, NNNNGATT, NNAGAAW, or NAAAAC.
  • Y is a pyrimidine; N is any nucleotide base; W is A or T.
  • a base editor provided herein can comprise a CRISPR protein-derived domain that is capable of binding a nucleotide sequence that contains a canonical or non-canonical protospacer adjacent motif (PAM) sequence.
  • a PAM site is a nucleotide sequence in proximity to a target polynucleotide sequence.
  • Cas9 proteins such as Cas9 from A pyogenes (spCas9)
  • spCas9 Cas9 from A pyogenes
  • a PAM can be CRISPR protein-specific and can be different between different base editors comprising different CRISPR protein-derived domains.
  • a PAM can be 5’ or 3’ of a target sequence.
  • a PAM can be upstream or downstream of a target sequence.
  • a PAM can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more nucleotides in length. Often, a PAM is between 2-6 nucleotides in length.
  • the PAM is an “NRN” PAM where the “N” in “NRN” is adenine (A), thymine (T), guanine (G), or cytosine (C), and the R is adenine (A) or guanine (G); or the PAM is an “NYN” PAM, wherein the “N” in NYN is adenine (A), thymine (T), guanine (G), or cytosine (C), and the Y is cytidine (C) or thymine (T), for example, as described in R.T. Walton et cil, 2020, Science, 10.1126/science.aba8853 (2020), the entire contents of which are incorporated herein by reference.
  • the PAM is NGC.
  • the NGC PAM is recognized by a Cas9 variant, e.g., an SpCas9 variant.
  • the NGC PAM variant includes one or more amino acid substitutions selected from D1135M, SI 136Q, G1218K, E1219F, A1322R, D1332A, R1335E, and T1337R (collectively termed “MQKFRAER”).
  • the PAM is NGT. In some embodiments, the NGT PAM is recognized by a Cas9 variant. In some embodiments, the NGT PAM variant is generated through targeted mutations at one or more residues 1335, 1337, 1135, 1136, 1218, and/or 1219. In some embodiments, the NGT PAM variant is created through targeted mutations at one or more residues 1219, 1335, 1337, 1218. In some embodiments, the NGT PAM variant is created through targeted mutations at one or more residues 1135, 1136, 1218, 1219, and 1335. In some embodiments, the NGT PAM variant is selected from the set of targeted mutations provided in Tables 2 and 3 below.
  • the NGT PAM variant is selected from variant 5, 7, 28, 31, or 36 in Tables 2 and 3. In some embodiments, the variants have improved NGT PAM recognition. In some embodiments, the NGT PAM variants have mutations at residues 1219, 1335,
  • the NGT PAM variant is selected with mutations for improved recognition from the variants provided in Table 4 below.
  • NGT PAM Variant Mutations at residues 1219, 1335, 1337, and 1218 are selected from the variants provided in Table 4.
  • the NGTN variant is variant 1. In some embodiments, the NGTN variant is variant 2. In some embodiments, the NGTN variant is variant 3. In some embodiments, the NGTN variant is variant 4. In some embodiments, the NGTN variant is variant 5. In some embodiments, the NGTN variant is variant 6.
  • the Cas9 domain is a Cas9 domain from Streptococcus pyogenes (SpCas9).
  • the SpCas9 domain is a nuclease active SpCas9, a nuclease inactive SpCas9 (SpCas9d), or a SpCas9 nickase (SpCas9n).
  • the SpCas9 comprises a D9X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid except for D.
  • the SpCas9 comprises a D9A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM.
  • the SpCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having an NGG, aNGA, or a NGCG PAM sequence.
  • the SpCas9 domain comprises one or more of a D1135X, a R1335X, and a T1337X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135E, R1335Q, and T1337R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135E, a R1335Q, and a T1337R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises one or more of a D1135X, a R1335X, and a T1337X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135V, a R1335Q, and a T1337R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135V, a R1335Q, and a T1337R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises one or more of a D1135X, a G1218X, aR1335X, and a T1337X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135V, a G1218R, a R1335Q, and a T1337R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises aD1135V, a G1218R, a R1335Q, and a T1337R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • the Cas9 domains of any of the fusion proteins provided herein comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a Cas9 polypeptide described herein.
  • the Cas9 domains of any of the fusion proteins provided herein comprises the amino acid sequence of any Cas9 polypeptide described herein.
  • the Cas9 domains of any of the fusion proteins provided herein consists of the amino acid sequence of any Cas9 polypeptide described herein.
  • a PAM recognized by a CRISPR protein-derived domain of a base editor disclosed herein can be provided to a cell on a separate oligonucleotide to an insert (e.g., an AAV insert) encoding the base editor.
  • an insert e.g., an AAV insert
  • providing PAM on a separate oligonucleotide can allow cleavage of a target sequence that otherwise would not be able to be cleaved, because no adjacent PAM is present on the same polynucleotide as the target sequence.
  • S. pyogenes Cas9 can be used as a CRISPR endonuclease for genome engineering. However, others can be used. In some embodiments, a different endonuclease can be used to target certain genomic targets. In some embodiments, synthetic SpCas9-derived variants with non-NGG PAM sequences can be used. Additionally, other Cas9 orthologues from various species have been identified and these “non-SpCas9s” can bind a variety of PAM sequences that can also be useful for the present disclosure.
  • the relatively large size of SpCas9 can lead to plasmids carrying the SpCas9 cDNA that cannot be efficiently expressed in a cell.
  • the coding sequence for Staphylococcus aureus Cas9 (SaCas9) is approximately 1 kilobase shorter than SpCas9, possibly allowing it to be efficiently expressed in a cell.
  • the SaCas9 endonuclease is capable of modifying target genes in mammalian cells in vitro and in mice in vivo.
  • a Cas protein can target a different PAM sequence.
  • a target gene can be adjacent to a Cas9 PAM, 5’-NGG, for example.
  • Cas9 orthologs can have different PAM requirements.
  • other PAMs such as those of S. thermophilus (5’-NNAGAA for CRISPR1 and 5’-NGGNG for CRISPR3) and Neisseria meningitidis (5’-NNNNGATT) can also be found adjacent to a target gene.
  • a target gene sequence can precede (i.e., be 5’ to) a 5’-NGG PAM, and a 20-nt guide RNA sequence can base pair with an opposite strand to mediate a Cas9 cleavage adjacent to a PAM.
  • an adjacent cut can be or can be about 3 base pairs upstream of a PAM. In some embodiments, an adjacent cut can be or can be about 10 base pairs upstream of a PAM. In some embodiments, an adjacent cut can be or can be about 0-20 base pairs upstream of a PAM.
  • an adjacent cut can be next to, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 base pairs upstream of a PAM.
  • An adjacent cut can also be downstream of a PAM by 1 to 30 base pairs.
  • amino acid sequence of an exemplary PAM-binding SpCas9 is as follows:
  • amino acid sequence of an exemplary P AM-binding SpCas9n is as follows:
  • amino acid sequence of an exemplary PAM-binding SpEQR Cas9 is as follows:
  • amino acid sequence of an exemplary PAM-binding SpVQR Cas9 is as follows:
  • engineered SpCas9 variants are capable of recognizing protospacer adjacent motif (PAM) sequences flanked by a 3 ⁇ (non-G PAM) (see Tables 1A-1E).
  • the SpCas9 variants recognize NRNH PAMs (where R is A or G and H is A, C or T).
  • the non-G PAM is NRRH, NRTH, or NRCH (see e.g.. Miller, S.M., et al. Continuous evolution of SpCas9 variants compatible with non-G PAMs, Nat. Biotechnol. (2020), the contents of which is incorporated herein by reference in its entirety).
  • the Cas9 domain is a recombinant Cas9 domain. In some embodiments, the recombinant Cas9 domain is a SpyMacCas9 domain. In some embodiments, the SpyMacCas9 domain is a nuclease active SpyMacCas9, a nuclease inactive SpyMacCas9 (SpyMacCas9d), or a SpyMacCas9 nickase (SpyMacCas9n). In some embodiments, the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM. In some embodiments, the SpyMacCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having a NAA PAM sequence.
  • a variant Cas9 protein harbors, H840A, P475A, W476A, N477A,
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g, a single stranded target DNA).
  • the variant Cas9 protein harbors D10A, H840A, P475A, W476A, N477A, D1125 A, W1126A, and D1218A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • a target DNA e.g., a single stranded target DNA
  • the variant Cas9 protein does not bind efficiently to a PAM sequence.
  • the method does not require a PAM sequence.
  • the method when such a variant Cas9 protein is used in a method of binding, can include a guide RNA, but the method can be performed in the absence of a PAM sequence (and the specificity of binding is therefore provided by the targeting segment of the guide RNA).
  • Other residues can be mutated to achieve the above effects (i.e., inactivate one or the other nuclease portions).
  • residues D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or A987 can be altered (i.e., substituted).
  • mutations other than alanine substitutions are suitable.
  • a CRISPR protein-derived domain of a base editor can comprise all or a portion of a Cas9 protein with a canonical PAM sequence (NGG).
  • a Cas9-derived domain of a base editor can employ a non-canonical PAM sequence.
  • Such sequences have been described in the art and would be apparent to the skilled artisan.
  • Cas9 domains that bind non-canonical PAM sequences have been described in Kleinstiver, B. P., et al, “Engineered CRISPR-Cas9 nucleases with altered PAM specificities” Nature 523, 481-485 (2015); and Kleinstiver, B.
  • Fusion proteins comprising a Cas9 domain and a Cytidine Deaminase and/or Adenosine Deaminase
  • Some aspects of the disclosure provide fusion proteins comprising a Cas9 domain or other nucleic acid programmable DNA binding protein and one or more adenosine deaminase domain, cytidine deaminase domain, and/or DNA glycosylase domains.
  • the Cas9 domain may be any of the Cas9 domains or Cas9 proteins (e.g., dCas9 or nCas9) provided herein.
  • any of the Cas9 domains or Cas9 proteins may be fused with any of the adenosine deaminases and cytidine deaminases described herein.
  • the domains of the base editors disclosed herein can be arranged in any order.
  • the fusion protein comprises the following domains A-C, A-D, or A-E:
  • the fusion protein comprises the following structure: NH 2 -[An-Bo-Cn]-COOH;
  • a and C or A, C, and E each comprises one or more of the following: an adenosine deaminase domain or an active fragment thereof, a cytidine deaminase domain or an active fragment thereof, a DNA glycosylase domain or an active fragment thereof; and wherein n is an integer: 1, 2, 3, 4, or 5, wherein p is an integer: 0, 1, 2, 3, 4, or 5; wherein q is an integer 0, 1, 2, 3, 4, or 5; and wherein B or B and D each comprises a domain having nucleic acid sequence specific binding activity; and wherein o is an integer: 1, 2, 3, 4, or 5.
  • the fusion protein comprises the structure:
  • any of the Casl2 domains or Casl2 proteins provided herein may be fused with any of the cytidine or adenosine deaminases provided herein.
  • the fusion protein comprises the structure:
  • the adenosine deaminase of the fusion protein comprises a TadA*8 and a cytidine deaminase.
  • the TadA*8 is TadA*8.1, TadA*8.2, TadA*8.3, TadA*8.4, TadA*8.5, TadA*8.6, TadA*8.7, TadA*8.8, TadA*8.9, TadA*8.10, TadA*8.11, TadA*8.12, TadA*8.13, TadA*8.14, TadA*8.15, TadA*8.16, TadA*8.17, TadA*8.18, TadA*8.19, TadA*8.20, TadA*8.21, TadA*8.22, TadA*8.23, or TadA*8.24.
  • the adenosine deaminase of the fusion protein comprises a TadA*8.21, TadA*8.
  • Exemplary fusion protein structures include the following:
  • the fusion proteins comprising a cytidine deaminase, abasic editor, and/or adenosine deaminase and a napDNAbp do not include a linker sequence.
  • a linker is present between the cytidine deaminase and adenosine deaminase domains and the napDNAbp.
  • the used in the general architecture above indicates the presence of an optional linker.
  • the cytidine deaminase and adenosine deaminase and the napDNAbp are fused via any of the linkers provided herein.
  • the cytidine deaminase and adenosine deaminase and the napDNAbp are fused via any of the linkers provided herein.
  • the fusion proteins of the present disclosure may comprise one or more additional features.
  • the fusion protein may comprise inhibitors, cytoplasmic localization sequences, export sequences, such as nuclear export sequences, or other localization sequences, as well as sequence tags that are useful for solubilization, purification, or detection of the fusion proteins.
  • Suitable protein tags include, but are not limited to, biotin carboxylase carrier protein (BCCP) tags, myc-tags, calmodulin-tags, FLAG-tags, hemagglutinin (HA)-tags, polyhistidine tags, also referred to as histidine tags or His-tags, maltose binding protein (MBP)-tags, nus-tags, glutathione-S-transferase (GST)-tags, green fluorescent protein (GFP)-tags, thioredoxin-tags, S-tags, Softags (e.g., Softag 1, Softag 3), strep-tags , biotin ligase tags, FlAsH tags, V5 tags, and SBP-tags. Additional suitable sequences will be apparent to those of skill in the art.
  • the fusion protein comprises one or more His tags.
  • fusion proteins are described in International PCT Application Nos. PCT/2017/044935, PCT/US2019/044935 and PCT/US2020/016288, each of which is incorporated herein by reference in its entirety.
  • Fusion proteins comprising a nuclear localization sequence (NLS)
  • the fusion proteins provided herein further comprise one or more (e.g., 2, 3, 4, 5) nuclear targeting sequences, for example a nuclear localization sequence (NLS).
  • a nuclear localization sequence for example a nuclear localization sequence (NLS).
  • a bipartite NLS is used.
  • a NLS comprises an amino acid sequence that facilitates the importation of a protein, that comprises an NLS, into the cell nucleus (e.g., by nuclear transport).
  • any of the fusion proteins provided herein further comprise a nuclear localization sequence (NLS).
  • the NLS is fused to the N-terminus of the fusion protein.
  • the NLS is fused to the C-terminus of the fusion protein.
  • the NLS is fused to the N-terminus of the Cas9 domain. In some embodiments, the NLS is fused to the C-terminus of an nCas9 domain or a dCas9 domain. In some embodiments, the NLS is fused to the N-terminus of the deaminase. In some embodiments, the NLS is fused to the C-terminus of the deaminase. In some embodiments, the NLS is fused to the fusion protein via one or more linkers. In some embodiments, the NLS is fused to the fusion protein without a linker. In some embodiments, the NLS comprises an amino acid sequence of any one of the NLS sequences provided or referenced herein.
  • an NLS comprises the amino acid sequence PKKKRKVEGADKRTADGSEFES PKKKRKV, KRTADGSEFES PKKKRKV, KRPAATKKAGQAKKKK, KKTELQTTNAENKTKKL , KRGINDRN FWRGENGRKTR, RKSGKIAAIWKRPRKPKKKRKV, or MDSLLMNRRKFLYQFKNVRWAKGRRETYLC.
  • the fusion proteins comprising a cytidine or adenosine deaminase, a Cas9 domain, and an NLS do not comprise a linker sequence.
  • linker sequences between one or more of the domains or proteins e.g cytidine or adenosine deaminase, Cas9 domain or NLS
  • a linker is present between the cytidine deaminase and adenosine deaminase domains and the napDNAbp.
  • the used in the general architecture below indicates the presence of an optional linker.
  • the cytidine deaminase and adenosine deaminase and the napDNAbp are fused via any of the linkers provided herein.
  • the cytidine deaminase and adenosine deaminase and the napDNAbp are fused via any of the linkers provided herein.
  • the general architecture of exemplary napDNAbp (e.g., Cas9 or Casl2) fusion proteins with a cytidine or adenosine deaminase and a napDNAbp (e.g., Cas9 or Casl2) domain comprises any one of the following structures, where NLS is a nuclear localization sequence (e.g., any NLS provided herein), NFh is the N-terminus of the fusion protein, and COOH is the C-terminus of the fusion protein:
  • NFh-NLS [napDNAbp domain] -[cytidine deaminase] -COOH;
  • the NLS is present in a linker or the NLS is flanked by linkers, for example, the linkers described herein.
  • the N-terminus or C- terminus NLS is a bipartite NLS.
  • a bipartite NLS comprises two basic amino acid clusters, which are separated by a relatively short spacer sequence (hence bipartite - 2 parts, while monopartite NLSs are not).
  • the NLS of nucleoplasmin, KR [ PAATKKAGQA] KKKK is the prototype of the ubiquitous bipartite signal: two clusters of basic amino acids, separated by a spacer of about 10 amino acids.
  • the sequence of an exemplary bipartite NLS follows: PKKKRKVEGADKRTADGSEFES PKKKRKV.
  • a vector that encodes a CRISPR enzyme comprising one or more nuclear localization sequences can be used.
  • NLSs nuclear localization sequences
  • a CRISPR enzyme can comprise the NLSs at or near the ammo-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 NLSs at or near the carboxy-terminus, or any combination of these (e.g., one or more NLS at the ammo-terminus and one or more NLS at the carboxy terminus).
  • each can be selected independently of others, such that a single NLS can be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies.
  • CRISPR enzymes used in the methods can comprise about 6 NLSs.
  • An NLS is considered near the N- or C-terminus when the nearest amino acid to the NLS is within about 50 amino acids along a polypeptide chain from the N- or C-terminus, e.g., within 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, or 50 amino acids.
  • fusion proteins comprising a heterologous polypeptide fused to a nucleic acid programmable nucleic acid binding protein, for example, a napDNAbp.
  • a heterologous polypeptide can be a polypeptide that is not found in the native or wild-type napDNAbp polypeptide sequence.
  • the heterologous polypeptide can be fused to the napDNAbp at a C-terminal end of the napDNAbp, an N-terminal end of the napDNAbp, or inserted at an internal location of the napDNAbp.
  • the heterologous polypeptide is inserted at an internal location of the napDNAbp.
  • the heterologous polypeptide is a deaminase or a functional fragment thereof.
  • a fusion protein can comprise a deaminase flanked by an N- terminal fragment and a C-terminal fragment of a Cas9 or Casl2 (e.g., Casl2b/C2cl), polypeptide.
  • the deaminase in a fusion protein can be an adenosine deaminase.
  • the adenosine deaminase is a TadA (e.g., TadA*7.10, TadA*8 or TadA*9).
  • the TadA is a TadA*8.
  • TadA sequences e.g. , TadA7.10, TadA*8 or TadA*9 as described herein are suitable deaminases for the above-described fusion proteins.
  • the deaminase can be a circular permutant deaminase.
  • the deaminase can be a circular permutant adenosine deaminase.
  • the deaminase is a circular permutant TadA, circularly permutated at amino acid residue 116 as numbered in the TadA reference sequence.
  • the deaminase is a circular permutant TadA, circularly permutated at amino acid residue 136 as numbered in the TadA reference sequence.
  • the deaminase is a circular permutant TadA, circularly permutated at amino acid residue 65 as numbered in the TadA reference sequence.
  • the fusion protein can comprise more than one deaminase.
  • the fusion protein can comprise, for example, 1, 2, 3, 4, 5 or more deaminases.
  • the fusion protein comprises one deaminase.
  • the fusion protein comprises two deaminases.
  • the two or more deaminases in a fusion protein can be an adenosine deaminase cytidine deaminase, or a combination thereof.
  • the two or more deaminases can be homodimers.
  • the two or more deaminases can be heterodimers.
  • the two or more deaminases can be inserted in tandem in the napDNAbp. In some embodiments, the two or more deaminases may not be in tandem in the napDNAbp.
  • the napDNAbp in the fusion protein is a Cas9 polypeptide or a fragment thereof.
  • the Cas9 polypeptide can be a variant Cas9 polypeptide.
  • the Cas9 polypeptide is a Cas9 nickase (nCas9) polypeptide or a fragment thereof.
  • the Cas9 polypeptide is a nuclease dead Cas9 (dCas9) polypeptide or a fragment thereof.
  • the Cas9 polypeptide in a fusion protein can be a full- length Cas9 polypeptide. In some cases, the Cas9 polypeptide in a fusion protein may not be a full length Cas9 polypeptide.
  • the Cas9 polypeptide can be truncated, for example, at a N- terminal or C-terminal end relative to a naturally-occurring Cas9 protein.
  • the Cas9 polypeptide can be a circularly permuted Cas9 protein.
  • the Cas9 polypeptide can be a fragment, a portion, or a domain of a Cas9 polypeptide, that is still capable of binding the target polynucleotide and a guide nucleic acid sequence.
  • the Cas9 polypeptide is a Streptococcus pyogenes Cas9 (SpCas9), Staphylococcus aureus Cas9 (SaCas9), Streptococcus thermophilus 1 Cas9 (StlCas9), or fragments or variants thereof.
  • SpCas9 Streptococcus pyogenes Cas9
  • SaCas9 Staphylococcus aureus Cas9
  • StlCas9 Streptococcus thermophilus 1 Cas9
  • the Cas9 polypeptide of a fusion protein can comprise an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring Cas9 polypeptide.
  • the Cas9 polypeptide of a fusion protein can comprise an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the Cas9 amino acid sequence set forth below (called the “Cas9 reference sequence” below): LGGD (single underline: HNH domain; double underline: RuvC domain).
  • Fusion proteins comprising a heterologous catalytic domain flanked by N- and C- terminal fragments of a Cas9 polypeptide are also useful for base editing in the methods as described herein. Fusion proteins comprising Cas9 and one or more deaminase domains, e.g., adenosine deaminase, or comprising an adenosine deaminase domain flanked by Cas9 sequences are also useful for highly specific and efficient base editing of target sequences.
  • a chimeric Cas9 fusion protein contains a heterologous catalytic domain (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) inserted within a Cas9 polypeptide.
  • the fusion protein comprises an adenosine deaminase domain and a cytidine deaminase domain inserted within a Cas9.
  • an adenosine deaminase is fused within a Cas9 and a cytidine deaminase is fused to the C-terminus.
  • an adenosine deaminase is fused within Cas9 and a cytidine deaminase fused to the N-terminus.
  • a cytidine deaminase is fused within Cas9 and an adenosine deaminase is fused to the C- terminus.
  • a cytidine deaminase is fused within Cas9 and an adenosine deaminase fused to the N-terminus.
  • Exemplary structures of a fusion protein with an adenosine deaminase and a cytidine deaminase and a Cas9 are provided as follows:
  • the used in the general architecture above indicates the presence of an optional linker.
  • the catalytic domain has DNA modifying activity (e.g., deaminase activity), such as adenosine deaminase activity.
  • the adenosine deaminase is aTadA (e.g., TadA*7.10).
  • the TadA is a TadA*8 or TadA*9.
  • a TadA*8 or TadA*9 is fused within Cas9 and a cytidine deaminase is fused to the C-terminus.
  • a TadA*8 or TadA*9 is fused within Cas9 and a cytidine deaminase fused to the N-terminus.
  • a cytidine deaminase is fused within Cas9 and a TadA*8 or TadA*9is fused to the C- terminus.
  • a cytidine deaminase is fused within Cas9 and a TadA*8 or TadA*9 fused to the N-terminus.
  • Exemplary structures of a fusion protein with a TadA*8 or TadA*9 and a cytidine deaminase and a Cas9 are provided as follows:
  • the used in the general architecture above indicates the presence of an optional linker.
  • the heterologous polypeptide e.g., deaminase
  • the heterologous polypeptide can be inserted in the napDNAbp (e.g, Cas9 or Casl2 (e.g., Casl2b/C2cl)) at a suitable location, for example, such that the napDNAbp retains its ability to bind the target polynucleotide and a guide nucleic acid.
  • a deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a deaminase can be inserted into a napDNAbp without compromising function of the deaminase (e.g., base editing activity) or the napDNAbp (e.g., ability to bind to target nucleic acid and guide nucleic acid).
  • a deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a deaminase can be inserted in the napDNAbp at, for example, a disordered region or a region comprising a high temperature factor or B-factor as shown by crystallographic studies. Regions of a protein that are less ordered, disordered, or unstructured, for example solvent exposed regions and loops, can be used for insertion without compromising structure or function.
  • a deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase)can be inserted in the napDNAbp in a flexible loop region or a solvent-exposed region.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the insertion location of a deaminase is determined by B-factor analysis of the crystal structure of Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted in regions of the Cas9 polypeptide comprising higher than average B-factors (e.g., higher B factors compared to the total protein or the protein domain comprising the disordered region).
  • B-factor or temperature factor can indicate the fluctuation of atoms from their average position (for example, as a result of temperature-dependent atomic vibrations or static disorder in a crystal lattice).
  • a high B- factor (e.g., higher than average B-factor) for backbone atoms can be indicative of a region with relatively high local mobility. Such a region can be used for inserting a deaminase without compromising structure or function.
  • a deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) can be inserted at a location with a residue having a Ca atom with a B-factor that is 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200% or greater than 200% more than the average B-factor for a Cas9 protein domain comprising the residue.
  • a B-factor that is 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200% or greater than 200% more than the average B-factor for a Cas9 protein domain comprising the residue.
  • Cas9 polypeptide positions comprising a higher than average B-factor can include, for example, residues 768, 792, 1052, 1015, 1022, 1026, 1029, 1067, 1040, 1054, 1068, 1246, 1247, and 1248 as numbered in the above Cas9 reference sequence.
  • Cas9 polypeptide regions comprising a higher than average B-factor can include, for example, residues 792- 872, 792-906, and 2-791 as numbered in the above Cas9 reference sequence.
  • a heterologous polypeptide e.g., deaminase
  • the heterologous polypeptide is inserted between amino acid positions 768-769, 791-792, 792-793, 1015-1016, 1022-1023, 1026-1027, 1029-1030, 1040-1041, 1052-1053, 1054-1055, 1067-1068, 1068-1069, 1247-1248, or 1248-1249 as numbered in the above Cas9 reference sequence or corresponding amino acid positions thereof.
  • the heterologous polypeptide is inserted between amino acid positions 769-770, 792-793, 793-794, 1016-1017, 1023-1024, 1027-1028, 1030-1031, 1041- 1042, 1053-1054, 1055-1056, 1068-1069, 1069-1070, 1248-1249, or 1249-1250 as numbered in the above Cas9 reference sequence or corresponding amino acid positions thereof.
  • the heterologous polypeptide replaces an amino acid residue selected from the group consisting of: 768, 791, 792, 1015, 1016, 1022, 1023, 1026, 1029, 1040,
  • the insertions as discussed herein are not limited to the Cas9 polypeptide sequence of the above Cas9 reference sequence, but include insertion at corresponding locations in variant Cas9 polypeptides, for example a Cas9 nickase (nCas9), nuclease dead Cas9 (dCas9), a Cas9 variant lacking a nuclease domain, a truncated Cas9, or a Cas9 domain lacking partial or complete HNH domain.
  • nCas9 Cas9 nickase
  • dCas9 nuclease dead Cas9
  • Cas9 variant lacking a nuclease domain for example a Cas9 nickase (nCas9), nuclease dead Cas9 (dCas9), a Cas9 variant lacking a nuclease domain, a truncated Cas9, or a Cas9 domain lacking partial or complete HNH domain.
  • a heterologous polypeptide (e.g., deaminase) can be inserted in the napDNAbp at an amino acid residue selected from the group consisting of: 768, 792, 1022, 1026, 1040, 1068, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the heterologous polypeptide is inserted between amino acid positions 768-769, 792-793, 1022-1023, 1026-1027, 1029-1030, 1040-1041, 1068-1069, or 1247-1248 as numbered in the above Cas9 reference sequence or corresponding amino acid positions thereof.
  • the heterologous polypeptide is inserted between amino acid positions 769-770, 793-794, 1023-1024, 1027- 1028, 1030-1031, 1041-1042, 1069-1070, or 1248-1249 as numbered in the above Cas9 reference sequence or corresponding amino acid positions thereof.
  • the heterologous polypeptide replaces an amino acid residue selected from the group consisting of: 768, 792, 1022, 1026, 1040, 1068, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide (e.g., deaminase) can be inserted in the napDNAbp at an amino acid residue as described herein, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide e.g., deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) can be inserted at the N-terminus or the C-terminus of the residue or replace the residue.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • an adenosine deaminase e.g., TadA
  • an amino acid residue selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247,
  • an adenosine deaminase e.g., TadA
  • TadA adenosine deaminase
  • the adenosine deaminase is inserted at the N-terminus of an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the adenosine deaminase is inserted at the C-terminus of an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the adenosine deaminase is inserted to replace an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • an adenosine deaminase (e.g., TadA*9) is inserted at an amino acid residue selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the adenosine deaminase (e.g., TadA*9) is inserted at the N-terminus of an amino acid selected from the group consisting of: 1016,
  • the adenosine deaminase (e.g., TadA*9) is inserted at the C-terminus of an amino acid selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the adenosine deaminase (e.g., TadA*9) is inserted to replace an amino acid selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N- terminus of amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 791 or is inserted at amino acid residue 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 791 or is inserted at the N-terminus of amino acid 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid 791 or is inserted at the N- terminus of amino acid 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid 791, or is inserted to replace amino acid 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N- terminus of amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1022, or is inserted at amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 1022 or is inserted at the N-terminus of amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1022 or is inserted at the C-terminus of amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1022, or is inserted to replace amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1026, or is inserted at amino acid residue 1029, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 1026 or is inserted at the N-terminus of amino acid residue 1029, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1026 or is inserted at the C-terminus of amino acid residue 1029, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1026, or is inserted to replace amino acid residue 1029, as numbered in the above Cas9 reference sequence, or corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N- terminus of amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1052, or is inserted at amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 1052 or is inserted at the N-terminus of amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1052 or is inserted at the C-terminus of amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1052, or is inserted to replace amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at amino acid residue 1067, or is inserted at amino acid residue 1068, or is inserted at amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the N-terminus of amino acid residue 1067 or is inserted at the N-terminus of amino acid residue 1068 or is inserted at the N-terminus of amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the C-terminus of amino acid residue 1067 or is inserted at the C-terminus of amino acid residue 1068 or is inserted at the C-terminus of amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted to replace amino acid residue 1067, or is inserted to replace amino acid residue 1068, or is inserted to replace amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at amino acid residue 1246, or is inserted at amino acid residue 1247, or is inserted at amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the N-terminus of amino acid residue 1246 or is inserted at the N-terminus of amino acid residue 1247 or is inserted at the N-terminus of amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the C-terminus of amino acid residue 1246 or is inserted at the C-terminus of amino acid residue 1247 or is inserted at the C-terminus of amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted to replace amino acid residue 1246, or is inserted to replace amino acid residue 1247, or is inserted to replace amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a heterologous polypeptide e.g., deaminase
  • the flexible loop portions can be selected from the group consisting of 530-537, 569-570, 686-691, 943-947, 1002-1025, 1052-1077, 1232-1247, or 1298-1300 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the flexible loop portions can be selected from the group consisting of: 1-529, 538-568, 580-685, 692-942, 948-1001, 1026-1051, 1078-1231, or 1248-1297 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide e.g., adenine deaminase
  • a heterologous polypeptide can be inserted into a Cas9 polypeptide region corresponding to amino acid residues: 1017-1069, 1242-1247, 1052-1056, 1060-1077, 1002 - 1003, 943-947, 530-537, 568-579, 686-691, 1242-1247, 1298 - 1300, 1066-1077, 1052-1056, or 1060-1077 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide (e.g., adenine deaminase) can be inserted in place of a deleted region of a Cas9 polypeptide.
  • the deleted region can correspond to an N-terminal or C -terminal portion of the Cas9 polypeptide.
  • the deleted region corresponds to residues 792-872 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deleted region corresponds to residues 792-906 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deleted region corresponds to residues 2-791 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide. In some embodiments, the deleted region corresponds to residues 1017-1069 as numbered in the above Cas9 reference sequence, or corresponding amino acid residues thereof.
  • a heterologous polypeptide e.g., deaminase
  • a heterologous polypeptide can be inserted between two structural or functional domains of a Cas9 polypeptide.
  • a heterologous polypeptide e.g., deaminase
  • the structural or functional domains of a Cas9 polypeptide can include, for example, RuvC I, RuvC II, RuvC III, Reel, Rec2, PI, or HNH.
  • the Cas9 polypeptide lacks one or more domains selected from the group consisting of: RuvC I, RuvC II, RuvC III, Reel, Rec2, PI, or HNH domain. In some embodiments, the Cas9 polypeptide lacks a nuclease domain. In some embodiments, the Cas9 polypeptide lacks an HNH domain. In some embodiments, the Cas9 polypeptide lacks a portion of the HNH domain such that the Cas9 polypeptide has reduced or abolished HNH activity. In some embodiments, the Cas9 polypeptide comprises a deletion of the nuclease domain, and the deaminase is inserted to replace the nuclease domain. In some embodiments, the HNH domain is deleted and the deaminase is inserted in its place. In some embodiments, one or more of the RuvC domains is deleted and the deaminase is inserted in its place.
  • a fusion protein comprising a heterologous polypeptide can be flanked by aN- terminal and a C-terminal fragment of a napDNAbp.
  • the fusion protein comprises a deaminase flanked by a N- terminal fragment and a C-terminal fragment of a Cas9 polypeptide.
  • the N terminal fragment or the C terminal fragment can bind the target polynucleotide sequence.
  • the C-terminus of the N terminal fragment or the N- terminus of the C terminal fragment can comprise a part of a flexible loop of a Cas9 polypeptide.
  • the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment can comprise a part of an alpha-helix structure of the Cas9 polypeptide.
  • the N- terminal fragment or the C-terminal fragment can comprise a DNA binding domain.
  • the N- terminal fragment or the C-terminal fragment can comprise a RuvC domain.
  • the N-terminal fragment or the C-terminal fragment can comprise an HNH domain. In some embodiments, neither of the N-terminal fragment and the C-terminal fragment comprises an HNH domain.
  • the C-terminus of the N terminal Cas9 fragment comprises an amino acid that is in proximity to a target nucleobase when the fusion protein deaminates the target nucleobase.
  • the N-terminus of the C terminal Cas9 fragment comprises an amino acid that is in proximity to a target nucleobase when the fusion protein deaminates the target nucleobase.
  • the insertion location of different deaminases can be different in order to have proximity between the target nucleobase and an amino acid in the C-terminus of the N terminal Cas9 fragment or the N-terminus of the C terminal Cas9 fragment.
  • the insertion position of an adenosine deaminase can be at an amino acid residue selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247,
  • the N-terminal Cas9 fragment of a fusion protein (i.e. the N-terminal Cas9 fragment flanking the deaminase in a fusion protein) can comprise the N-terminus of a Cas9 polypeptide.
  • the N-terminal Cas9 fragment of a fusion protein can comprise a length of at least about: 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids.
  • the N-terminal Cas9 fragment of a fusion protein can comprise a sequence corresponding to amino acid residues: 1-56, 1-95, 1-200, 1-300, 1-400, 1-500, 1-600, 1-700, 1-718, 1-765, 1-780, 1-906, 1-918, or 1-1100 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N- terminal Cas9 fragment can comprise a sequence comprising at least: 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to amino acid residues: 1-56, 1- 95, 1-200, 1-300, 1-400, 1-500, 1-600, 1-700, 1-718, 1-765, 1-780, 1-906, 1-918, or 1-1100 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the C-terminal Cas9 fragment of a fusion protein (i.e. the C-terminal Cas9 fragment flanking the deaminase in a fusion protein) can comprise the C-terminus of a Cas9 polypeptide.
  • the C-terminal Cas9 fragment of a fusion protein can comprise a length of at least about: 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids.
  • the C-terminal Cas9 fragment of a fusion protein can comprise a sequence corresponding to amino acid residues: 1099-1368, 918-1368, 906-1368, 780-1368, 765-1368, 718-1368, 94-1368, or 56-1368 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N-terminal Cas9 fragment can comprise a sequence comprising at least: 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to amino acid residues: 1099-1368, 918-1368, 906-1368, 780-1368, 765-1368, 718-1368, 94-1368, or 56-1368 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N-terminal Cas9 fragment and C-terminal Cas9 fragment of a fusion protein taken together may not correspond to a full-length naturally occurring Cas9 polypeptide sequence, for example, as set forth in the above Cas9 reference sequence.
  • the fusion protein described herein can effect targeted deamination with reduced deamination at non-target sites (e.g ., off-target sites), such as reduced genome wide spurious deamination.
  • the fusion protein described herein can effect targeted deamination with reduced bystander deamination at non-target sites.
  • the undesired deamination or off-target deamination can be reduced by at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% compared with, for example, an end terminus fusion protein comprising the deaminase fused to a N terminus or a C terminus of a Cas9 polypeptide.
  • the undesired deamination or off-target deamination can be reduced by at least one-fold, at least two-fold, at least three-fold, at least four-fold, at least five-fold, at least tenfold, at least fifteen fold, at least twenty fold, at least thirty fold, at least forty fold, at least fifty fold, at least 60 fold, at least 70 fold, at least 80 fold, at least 90 fold, or at least hundred fold, compared with, for example, an end terminus fusion protein comprising the deaminase fused to a N terminus or a C terminus of a Cas9 polypeptide.
  • the deaminase (e.g ., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) of the fusion protein deaminates no more than two nucleobases within the range of an R-loop. In some embodiments, the deaminase of the fusion protein deaminates no more than three nucleobases within the range of the R-loop. In some embodiments, the deaminase of the fusion protein deaminates no more than 2, 3, 4,
  • An R-loop is a three-stranded nucleic acid structure including a DNA:RNA hybrid, a DNA:DNA or an RNA: RNA complementary structure and the associated with single-stranded DNA.
  • an R-loop may be formed when a target polynucleotide is contacted with a CRISPR complex or a base editing complex, wherein a portion of a guide polynucleotide, e.g. a guide RNA, hybridizes with and displaces with a portion of a target polynucleotide, e.g. a target DNA.
  • an R-loop comprises a hybridized region of a spacer sequence and a target DNA complementary sequence.
  • An R-loop region may be of about 5, 6, 7, 8, 9, 10, 11,
  • an R-loop region is not limited to the target DNA strand that hybridizes with the guide polynucleotide.
  • editing of a target nucleobase within an R-loop region may be to a DNA strand that comprises the complementary strand to a guide RNA, or may be to a DNA strand that is the opposing strand of the strand complementary to the guide RNA.
  • editing in the region of the R-loop comprises editing a nucleobase on non-complementary strand (protospacer strand) to a guide RNA in a target DNA sequence.
  • a target nucleobase is from about 1 to about 20 bases upstream of a PAM sequence in the target polynucleotide sequence. In some embodiments, a target nucleobase is from about 2 to about 12 bases upstream of a PAM sequence in the target polynucleotide sequence.
  • a target nucleobase is from about 1 to 9 base pairs, about 2 to 10 base pairs, about 3 to 11 base pairs, about 4 to 12 base pairs, about 5 to 13 base pairs, about 6 to 14 base pairs, about 7 to 15 base pairs, about 8 to 16 base pairs, about 9 to 17 base pairs, about 10 to 18 base pairs, about 11 to 19 base pairs, about 12 to 20 base pairs, about 1 to 7 base pairs, about 2 to 8 base pairs, about 3 to 9 base pairs, about 4 to 10 base pairs, about 5 to 11 base pairs, about 6 to 12 base pairs, about 7 to 13 base pairs, about 8 to 14 base pairs, about 9 to 15 base pairs, about 10 to 16 base pairs, about 11 to 17 base pairs, about 12 to 18 base pairs, about 13 to 19 base pairs, about 14 to 20 base pairs, about 1 to 5 base pairs, about 2 to 6 base pairs, about 3 to 7 base pairs, about 4 to 8 base pairs, about 5 to 9 base pairs, about 6 to 10 base pairs, about 7 to 11 base pairs, about 8 to 12 base pairs, about 9 to 15 base pairs,
  • a target nucleobase is about 1, 2, 3, 4, 5, 6, 7, 8, or 9 base pairs upstream of the PAM sequence. In some embodiments, a target nucleobase is about 2, 3, 4, or 6 base pairs upstream of the PAM sequence.
  • the fusion protein can comprise more than one heterologous polypeptide.
  • the fusion protein can additionally comprise one or more UGI domains and/or one or more nuclear localization signals.
  • the two or more heterologous domains can be inserted in tandem.
  • the two or more heterologous domains can be inserted at locations such that they are not in tandem in the NapDNAbp.
  • a fusion protein can comprise a linker between the deaminase and the napDNAbp polypeptide.
  • the linker can be a peptide or a non-peptide linker.
  • the linker can be an XTEN, (GGGS)n, (GGGGS)n, (G)n, (EAAAK)n, (GGS)n, SGSETPGTSESATPES.
  • the fusion protein comprises a linker between the N-terminal Cas9 fragment and the deaminase.
  • the fusion protein comprises a linker between the C-terminal Cas9 fragment and the deaminase.
  • the N- terminal and C-terminal fragments of napDNAbp are connected to the deaminase with a linker. In some embodiments, the N-terminal and C-terminal fragments are joined to the deaminase domain without a linker. In some embodiments, the fusion protein comprises a linker between the N-terminal Cas9 fragment and the deaminase, but does not comprise a linker between the C-terminal Cas9 fragment and the deaminase. In some embodiments, the fusion protein comprises a linker between the C-terminal Cas9 fragment and the deaminase, but does not comprise a linker between the N-terminal Cas9 fragment and the deaminase.
  • the napDNAbp in the fusion protein is a Casl2 polypeptide, e.g., Casl2b/C2cl, or a fragment thereof.
  • the Casl2 polypeptide can be a variant Casl2 polypeptide.
  • the N- or C-terminal fragments of the Casl2 polypeptide comprise a nucleic acid programmable DNA binding domain or a RuvC domain.
  • the fusion protein contains a linker between the Casl2 polypeptide and the catalytic domain.
  • the amino acid sequence of the linker is GGSGGS or GSSGSETPGTSESATPESSG.
  • the linker is a rigid linker.
  • the linker is encoded by GGAGGCTCTGGAGGAAGC or GGCTCTTCTGGATCTGAAACACCTGGCACAAGCGAGAGCGCCACCCCTGAGAGCTCTGGC.
  • Fusion proteins comprising a heterologous catalytic domain flanked by N- and C- terminal fragments of a Casl2 polypeptide are also useful for base editing in the methods as described herein. Fusion proteins comprising Casl2 and one or more deaminase domains, e.g., adenosine deaminase, or comprising an adenosine deaminase domain flanked by Casl2 sequences are also useful for highly specific and efficient base editing of target sequences.
  • a chimeric Casl2 fusion protein contains a heterologous catalytic domain (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) inserted within a Casl2 polypeptide.
  • the fusion protein comprises an adenosine deaminase domain and a cytidine deaminase domain inserted within a Casl2.
  • an adenosine deaminase is fused within Casl2 and a cytidine deaminase is fused to the C-terminus. In some embodiments, an adenosine deaminase is fused within Casl2 and a cytidine deaminase fused to the N-terminus. In some embodiments, a cytidine deaminase is fused within Casl2 and an adenosine deaminase is fused to the C-terminus.
  • a cytidine deaminase is fused within Casl2 and an adenosine deaminase fused to the N-terminus.
  • Exemplary structures of a fusion protein with an adenosine deaminase and a cytidine deaminase and a Casl2 are provided as follows:
  • the used in the general architecture above indicates the presence of an optional linker.
  • the catalytic domain has DNA modifying activity (e.g., deaminase activity), such as adenosine deaminase activity.
  • the adenosine deaminase is aTadA (e.g., TadA*7.10).
  • the TadA is a TadA*8 or TadA*9.
  • a TadA*8 or TadA*9 is fused within Casl2 and a cytidine deaminase is fused to the C-terminus.
  • a TadA*8 or TadA*9 is fused within Casl2 and a cytidine deaminase fused to the N-terminus.
  • a cytidine deaminase is fused within Casl2 and a TadA*8 or TadA*9 is fused to the C-terminus.
  • a cytidine deaminase is fused within Casl2 and a TadA*8 or TadA*9 fused to the N-terminus.
  • Exemplary structures of a fusion protein with a TadA*8 or TadA*9 and a cytidine deaminase and a Casl2 are provided as follows:
  • the used in the general architecture above indicates the presence of an optional linker.
  • the fusion protein contains one or more catalytic domains. In other embodiments, at least one of the one or more catalytic domains is inserted within the Casl2 polypeptide or is fused at the Casl2 N- terminus or C-terminus. In other embodiments, at least one of the one or more catalytic domains is inserted within a loop, an alpha helix region, an unstructured portion, or a solvent accessible portion of the Casl2 polypeptide.
  • the Casl2 polypeptide is Casl2a, Casl2b, Casl2c, Casl2d, Casl2e, Casl2g, Casl2h, Casl2i, or Casl2j/Cas ⁇ D.
  • the Casl2 polypeptide has at least about 85% amino acid sequence identity to Bacillus hisashii Casl2b, Bacillus thermoamylovorans Casl2b, Bacillus sp. V3-13 Casl2b, or Alicyclobacillus acidiphilus Casl2b.
  • the Casl2 polypeptide has at least about 90% amino acid sequence identity to Bacillus hisashii Casl2b, Bacillus thermoamylovorans Casl2b, Bacillus sp. V3-13 Casl2b, or Alicyclobacillus acidiphilus Casl2b. In other embodiments, the Casl2 polypeptide has at least about 95% amino acid sequence identity to Bacillus hisashii Casl2b, Bacillus thermoamylovorans Casl2b, Bacillus sp. V3-13 Casl2b, ox Alicyclobacillus acidiphilus Casl2b.
  • the Casl2 polypeptide contains or consists essentially of a fragment of Bacillus hisashii Casl2b, Bacillus thermoamylovorans Casl2b, Bacillus sp. V3-13 Casl2b, ox Alicyclobacillus acidiphilus Casl2b.
  • the catalytic domain is inserted between amino acid positions 153-154, 255-256, 306-307, 980-981, 1019-1020, 534-535, 604-605, or 344-345 of BhCasl2b or a corresponding amino acid residue of Casl2a, Casl2c, Casl2d, Casl2e, Casl2g, Casl2h, Casl2i, or Casl2j/Cas ⁇ D.
  • the catalytic domain is inserted between amino acids PI 53 and SI 54 of BhCasl2b.
  • the catalytic domain is inserted between amino acids K255 and E256 of BhCasl2b.
  • the catalytic domain is inserted between amino acids D980 and G981 of BhCasl2b. In other embodiments, the catalytic domain is inserted between amino acids K1019 and L1020 of BhCasl2b. In other embodiments, the catalytic domain is inserted between amino acids F534 and P535 of BhCasl2b. In other embodiments, the catalytic domain is inserted between amino acids K604 and G605 of BhCasl2b. In other embodiments, the catalytic domain is inserted between amino acids H344 and F345 of BhCasl2b.
  • catalytic domain is inserted between amino acid positions 147 and 148, 248 and 249, 299 and 300, 991 and 992, or 1031 and 1032 of BvCasl2b or a corresponding amino acid residue of Casl2a, Casl2c, Casl2d, Casl2e, Casl2g, Casl2h, Casl2i, or Cas 12j/Cas ⁇ I).
  • the catalytic domain is inserted between amino acids P147 and D148 of BvCasl2b.
  • the catalytic domain is inserted between amino acids G248 and G249 of BvCasl2b.
  • the catalytic domain is inserted between amino acids P299 and E300 of BvCasl2b. In other embodiments, the catalytic domain is inserted between amino acids G991 and E992 of BvCasl2b. In other embodiments, the catalytic domain is inserted between amino acids K1031 and M1032 of BvCasl2b.
  • the catalytic domain is inserted between amino acid positions 157 and 158, 258 and 259, 310 and 311, 1008 and 1009, or 1044 and 1045 of AaCasl2b or a corresponding amino acid residue of Casl2a, Casl2c, Casl2d, Casl2e, Casl2g, Casl2h, Casl2i, or Casl2j/Cas ⁇ F.
  • the catalytic domain is inserted between amino acids P157 and G158 of AaCasl2b.
  • the catalytic domain is inserted between amino acids V258 and G259 of AaCasl2b.
  • the catalytic domain is inserted between amino acids D310 and P311 of AaCasl2b. In other embodiments, the catalytic domain is inserted between amino acids G1008 and E1009 of AaCasl2b. In other embodiments, the catalytic domain is inserted between amino acids G1044 and K1045 at of AaCasl2b.
  • the fusion protein contains a nuclear localization signal (e.g., a bipartite nuclear localization signal).
  • the amino acid sequence of the nuclear localization signal is MAPKKKRKVGIHGVPAA.
  • the nuclear localization signal is encoded by the following sequence: ATGGCCCCAAAGAAGAAGCGGAAGGTCGGTATCCACGGAGTCCCAGCAGCC.
  • the Casl2b polypeptide contains a mutation that silences the catalytic activity of a RuvC domain.
  • the Casl2b polypeptide contains D574A, D829A and/or D952A mutations.
  • the fusion protein further contains a tag (e.g., an influenza hemagglutinin tag).
  • the fusion protein comprises a napDNAbp domain (e.g., Casl2-derived domain) with an internally fused nucleobase editing domain (e.g., all or a portion of a deaminase domain, e.g., an adenosine deaminase domain).
  • the napDNAbp is a Casl2b.
  • the base editor comprises a BhCasl2b domain with an internally fused TadA*8 domain inserted at the loci provided in Table 7 below.
  • an adenosine deaminase (e.g., ABE8.13) may be inserted into a BhCasl2b to produce a fusion protein (e.g., ABE8.13-BhCasl2b) that effectively edits a nucleic acid sequence.
  • the base editing system described herein comprises an ABE with TadA inserted into a Cas9.
  • ABEs having a TadA inserted into a Cas9 protein are described in International PCT Application No. PCT/US2020/048586, filed August 28, 2020, the contents of which are incorporated by reference herein in their entirety.
  • Cas9 proteins such as Cas9 from S. pyogenes (spCas9)
  • spCas9 require a canonical NGG PAM sequence to bind a particular nucleic acid region, where the “N” in “NGG” is adenosine (A), thymidine (T), or cytosine (C), and the G is guanosine.
  • NGG adenosine
  • T thymidine
  • C cytosine
  • the base editing fusion proteins provided herein may need to be placed at a precise location, for example a region comprising a target base that is upstream of the PAM.
  • any of the fusion proteins provided herein may contain a Cas9 domain that is capable of binding a nucleotide sequence that does not contain a canonical (e.g., NGG) PAM sequence.
  • Cas9 domains that bind to non-canonical PAM sequences have been described in the art and would be apparent to the skilled artisan. For example, Cas9 domains that bind non-canonical PAM sequences have been described in Kleinstiver, B.
  • base editors comprising a fusion protein that includes a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain (e.g ., a deaminase domain).
  • the base editor can be programmed to edit one or more bases in a target polynucleotide sequence by interacting with a guide polynucleotide capable of recognizing the target sequence. Once the target sequence has been recognized, the base editor is anchored on the polynucleotide where editing is to occur and the deaminase domain components of the base editor can then edit a target base.
  • the nucleobase editing domain includes a deaminase domain.
  • base editors include cytidine base editors (e.g., BE4) that convert target OG base pairs to T ⁇ A.
  • base editors include adenine base editors (e.g., ABE7.10) that convert A ⁇ T to G*C.
  • the deaminase domain includes an adenosine deaminase.
  • the terms “adenine deaminase” and “adenosine deaminase” can be used interchangeably. Details of nucleobase editing proteins are described in International PCT Application Nos.
  • a base editor described herein can comprise a deaminase domain which includes an adenosine deaminase.
  • Such an adenosine deaminase domain of a base editor can facilitate the editing of an adenine (A) nucleobase to a guanine (G) nucleobase by deaminating the A to form inosine (I), which exhibits base pairing properties of G.
  • Adenosine deaminase is capable of deaminating (i.e., removing an amine group) adenine of a deoxyadenosine residue in deoxyribonucleic acid (DNA).
  • the nucleobase editors provided herein can be made by fusing together one or more protein domains, thereby generating a fusion protein.
  • the fusion proteins provided herein comprise one or more features that improve the base editing activity (e.g., efficiency, selectivity, and specificity) of the fusion proteins.
  • the fusion proteins provided herein can comprise a Cas9 domain that has reduced nuclease activity.
  • the fusion proteins provided herein can have a Cas9 domain that does not have nuclease activity (dCas9), or a Cas9 domain that cuts one strand of a duplexed DNA molecule, referred to as a Cas9 nickase (nCas9).
  • the presence of the catalytic residue maintains the activity of the Cas9 to cleave the non-edited (e.g., non-deaminated) strand containing a T opposite the targeted A.
  • Mutation of the catalytic residue (e.g., D10 to A10) of Cas9 prevents cleavage of the edited strand containing the targeted A residue.
  • Such Cas9 variants are able to generate a single-strand DNA break (nick) at a specific location based on the gRNA-defmed target sequence, leading to repair of the non-edited strand, ultimately resulting in a T to C change on the non-edited strand.
  • an A-to-G base editor further comprises an inhibitor of inosine base excision repair, for example, a uracil glycosylase inhibitor (UGI) domain or a catalytically inactive inosine specific nuclease.
  • a uracil glycosylase inhibitor UGI domain
  • a catalytically inactive inosine specific nuclease can inhibit or prevent base excision repair of a deaminated adenosine residue (e.g., inosine), which can improve the activity or efficiency of the base editor.
  • a base editor comprising an adenosine deaminase can act on any polynucleotide, including DNA, RNA and DNA-RNA hybrids.
  • a base editor comprising an adenosine deaminase can deaminate a target A of a polynucleotide comprising RNA.
  • the base editor can comprise an adenosine deaminase domain capable of deaminating a target A of an RNA polynucleotide and/or a DNA-RNA hybrid polynucleotide.
  • an adenosine deaminase incorporated into a base editor comprises all or a portion of adenosine deaminase acting on RNA (ADAR, e.g., ADAR1 or ADAR2).
  • ADAR adenosine deaminase acting on RNA
  • an adenosine deaminase incorporated into a base editor comprises all or a portion of adenosine deaminase acting on tRNA (AD AT).
  • a base editor comprising an adenosine deaminase domain can also be capable of deaminating an A nucleobase of a DNA polynucleotide.
  • an adenosine deaminase domain of a base editor comprises all or a portion of an AD AT comprising one or more mutations which permit the AD AT to deaminate a target A in DNA.
  • the base editor can comprise all or a portion of an AD AT from Escherichia coli (EcTadA) comprising one or more of the following mutations: D108N, A106V, D147Y, E155V, L84F, H123Y, I156F, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase can be derived from any suitable organism (e.g., E . coli).
  • the adenine deaminase is a naturally-occurring adenosine deaminase that includes one or more mutations corresponding to any of the mutations provided herein (e.g., mutations in ecTadA).
  • the corresponding residue in any homologous protein can be identified by e.g., sequence alignment and determination of homologous residues.
  • the mutations in any naturally-occurring adenosine deaminase e.g., having homology to ecTadA
  • any of the mutations identified in ecTadA can be generated accordingly.
  • fusion proteins described herein can comprise a deaminase domain which includes an adenosine deaminase.
  • adenosine deaminase domain of a base editor can facilitate the editing of an adenine (A) nucleobase to a guanine (G) nucleobase by deaminating the A to form inosine (I), which exhibits base pairing properties of G.
  • Adenosine deaminase is capable of deaminating (i.e., removing an amine group) adenine of a deoxyadenosine residue in deoxyribonucleic acid (DNA).
  • the adenosine deaminases provided herein are capable of deaminating adenine. In some embodiments, the adenosine deaminases provided herein are capable of deaminating adenine in a deoxyadenosine residue of DNA. In some embodiments, the adenine deaminase is a naturally-occurring adenosine deaminase that includes one or more mutations corresponding to any of the mutations provided herein (e.g., mutations in ecTadA). One of skill in the art will be able to identify the corresponding residue in any homologous protein, e.g., by sequence alignment and determination of homologous residues.
  • adenosine deaminase e.g., having homology to ecTadA
  • the adenosine deaminase is from a prokaryote.
  • the adenosine deaminase is from a bacterium.
  • the adenosine deaminase is from Escherichia coli, Staphylococcus aureus, Salmonella typhi, Shewanella putrefaciens, Haemophilus influenzae, Caulobacter crescentus, or Bacillus subtilis. In some embodiments, the adenosine deaminase is from E. coli.
  • the disclosure provides adenosine deaminase variants that have increased efficiency (>50-60%) and specificity.
  • the adenosine deaminase variants described herein are more likely to edit a desired base within a polynucleotide, and are less likely to edit bases that are not intended to be altered (i.e., “bystanders”).
  • the TadA is any one of the TadA described in PCT/US2017/045381 (WO 2018/027078), which is incorporated herein by reference in its entirety.
  • the wild-type TadA (TadA(wt)) or “the TadA reference sequence” is as follows:
  • the fusion proteins comprise a single (e.g., provided as a monomer) TadA*8 variant.
  • the TadA*8 is linked to a Cas9 nickase.
  • the fusion proteins of the disclosure comprise as a heterodimer of a wild-type TadA (TadA(wt)) linked to a TadA*8 variant. In other embodiments, the fusion proteins of the disclosure comprise as a heterodimer of a TadA*7.10 linked to a TadA*8 variant.
  • the base editor is ABE8 comprising a TadA* 8 variant monomer. In some embodiments, the base editor is ABE8 comprising a heterodimer of a TadA*8 variant and a TadA(wt). In some embodiments, the base editor is ABE8 comprising a heterodimer of a TadA*8 variant and TadA*7.10. In some embodiments, the base editor is ABE8 comprising a heterodimer of a TadA*8 variant. In some embodiments, the TadA*8 variant is selected from one or more of Table 8, 10, 11, 12. or 13.
  • the base editor is ABE9 comprising a TadA*9 variant. In some embodiments, the base editor is ABE9 comprising a TadA*9 variant monomer. In some embodiments, the base editor is ABE9 comprising a heterodimer of a TadA*9 variant and a TadA(wt). In some embodiments, the base editor is ABE9 comprising a heterodimer of a TadA*9 variant and another TadA variant (e.g. , TadA*7.10). In some embodiments, the base editor is ABE9 comprising a homodimer of a TadA*9 variant. In some embodiments, the TadA*9 variant is as provided in Tables 14 and 18 herein. In some embodiments, the
  • TadA*9 variant is selected from the variants described below and with reference to the following sequence (termed TadA* 7.10):
  • an adenosine deaminase (e.g., TadA*9) comprises an alteration at an amino acid position selected from the group consisting of 21, 23, 25, 38, 51, 54, 70, 71, 72, 73, 94, 124, 133, 139, 146, and 158 of SEQ ID NO: 1, or a corresponding alteration in another adenosine deaminase.
  • an adenosine deaminase (e.g., TadA*9) comprises one or more of the following alterations: R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, V82T, M94V, P124W, T133K, D139L, D139M, C146R, and A158K, or a corresponding alteration in another adenosine deaminase.
  • the relevant bases altered in the reference sequence are shown by underlining and bold font.
  • an adenosine deaminase comprises one or more of the following combinations of alterations: V82S + Q154R + Y147R; V82S + Q154R + Y123H; V82S + Q154R + Y147R+ Y123H; Q154R + Y147R + Y123H + I76Y+ V82S; V82S +
  • an adenosine deaminase comprises one or more of the following combinations of alterations: E25F + V82S + Y123H, T133K + Y147R + Q154R; E25F + V82S + Y123H + Y147R + Q154R; L51W + V82S + Y123H + C146R + Y147R + Q154R; Y73S + V82S + Y123H + Y147R + Q154R; P54C + V82S + Y123H + Y147R + Q154R; N38G + V82T + Y123H + Y147R + Q154R; N72K + V82S + Y123H + D139L + Y147R + Q154R; E25F + V82S + Y123H + D139M + Y147R + Q154R; Q71M + V82S + Y123H + Y147R + Q154R; E25F + V82S + Y123H + D
  • an adenosine deaminase comprises one or more of the following combinations of alterations: Q71M + V82S + Y123H + Y147R + Q154R; E25F + I76Y+ V82S + Y123H + Y147R + Q154R; I76Y + V82T + Y123H + Y147R + Q154R; N38G + I76Y + V82S + Y123H + Y147R + Q154R; R23H + I76Y + V82S + Y123H + Y147R + Q154R; P54C + I76Y + V82S + Y123H + Y147R + Q154R; R21N + I76Y + V82S + Y123H + Y147R + Q154R; I76Y + V82S + Y123H + D139M + Y147R + Q154R; Y73S + I76Y + V82S + Y123H + D139M + Y147R + Q154
  • the adenosine deaminase is expressed as a monomer. In other embodiments, the adenosine deaminase is expressed as a heterodimer. In some embodiments, the deaminase or other polypeptide sequence lacks a methionine, for example when included as a component of a fusion protein. This can alter the numbering of positions. However, the skilled person will understand that such corresponding mutations refer to the same mutation, e.g., Y73S and Y72S and D139M and D138M.
  • the adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth in any of the adenosine deaminases provided herein.
  • adenosine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein).
  • the disclosure provides any deaminase domains with a certain percent identity plus any of the mutations or combinations thereof described herein.
  • the adenosine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13,
  • the adenosine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
  • the TadA deaminase is a full-length E. coli TadA deaminase.
  • the adenosine deaminase comprises the amino acid sequence:
  • the adenosine deaminase may be a homolog of adenosine deaminase acting on tRNA (AD AT).
  • AD AT tRNA
  • amino acid sequences of exemplary AD AT homologs include the following:
  • E. Coli TadA includes the following:
  • the adenosine deaminase is from a prokaryote. In some embodiments, the adenosine deaminase is from a bacterium. In some embodiments, the adenosine deaminase is from Escherichia coli, Staphylococcus aureus, Salmonella typhi, Shewanella putrefaciens , Haemophilus influenzae, Caulobacter crescentus, or Bacillus subtilis. In some embodiments, the adenosine deaminase is from E. coli.
  • a fusion protein of the disclosure comprises a wild-type TadA linked to TadA*7.10, which is linked to Cas9 nickase.
  • the fusion proteins comprise a single TadA*7.10 domain (e.g., provided as a monomer).
  • the ABE7.10 editor comprises TadA*7.10 and TadA(wt), which are capable of forming heterodimers.
  • the adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth in any of the adenosine deaminases provided herein.
  • adenosine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein).
  • the disclosure provides any deaminase domains with a certain percent identity plus any of the mutations or combinations thereof described herein.
  • the adenosine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13,
  • the adenosine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
  • any of the mutations provided herein can be introduced into other adenosine deaminases, such as E. coli TadA (ecTadA), S. aureus TadA (saTadA), or other adenosine deaminases (e.g., bacterial adenosine deaminases). It would be apparent to the skilled artisan that additional deaminases may similarly be aligned to identify homologous amino acid residues that can be mutated as provided herein.
  • adenosine deaminases such as E. coli TadA (ecTadA), S. aureus TadA (saTadA), or other adenosine deaminases (e.g., bacterial adenosine deaminases). It would be apparent to the skilled artisan that additional deaminases may similarly be aligned to identify homologous amino acid residues that can be mutated as provided herein
  • any of the mutations identified in the TadA reference sequence can be made in other adenosine deaminases (e.g., ecTada) that have homologous amino acid residues. It should also be appreciated that any of the mutations provided herein can be made individually or in any combination in the TadA reference sequence or another adenosine deaminase.
  • the adenosine deaminase comprises a D108X mutation in the TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a D108G, D108N, D108V, D108A, or D108Y mutation, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an A106X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A106V mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., wild type TadA or ecTadA).
  • the adenosine deaminase comprises a E155X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a E155D, E155G, or E155V mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises a D147X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a D147Y, mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an A106X, E155X, or D147X, mutation in the TadA reference sequence, or a corresponding mutation in another adenosine deaminase ( e.g ., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an E155D, E155G, or E155V mutation.
  • the adenosine deaminase comprises aD147Y.
  • an adenosine deaminase can contain a D108N, a A106V, a E155V, and/or a D147Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • an adenosine deaminase comprises the following group of mutations (groups of mutations are separated by a in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA): D108N and A106V; D108N and E155V; D108N and D147Y; A106V and E155V; A106V and D147Y; E155V and D147Y; D108N, A106V, and E155V; D108N, A106V, and D147Y; D108N, E155V, and D147Y; A106V, E155V, and D147Y; and D108N, A106V, E155V, and D147Y. It should be appreciated, however, that any combination of corresponding mutations provided herein can be made in an adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of a H8X, T17X, L18X, W23X, L34X, W45X, R51X, A56X, E59X, E85X, M94X, I95X, V102X, F104X, A106X, R107X, D108X, K110X, M118X, N127X, A138X, F149X, M151X, R153X, Q154X, I156X, and/or K157X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one or more of H8Y, T17S, L18E, W23L, L34S, W45L, R51H, A56E, or A56S, E59G, E85K, or E85G, M94L, I95L, V102A, F104L, A106V, R107C, or R107H, or R107P, D108G, or D108N, or D108V, or D108A, or D108Y, K110I, M118K, N127S, A138V, F149Y, M151V, R153C, Q154L, I156D, and/or K157R mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one or more of a H8X, D108X, and/or N127X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid.
  • the adenosine deaminase comprises one or more of a H8Y, D108N, and/or N127S mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of H8X, R26X, M61X, L68X, M70X, A106X, D108X, A109X, N127X, D147X, R152X, Q154X, E155X, K161X, Q163X, and/or T166X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g ., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • H8X, R26X, M61X, L68X, M70X, A106X, D108X, A109X, N127X, D147X, R152X, Q154X, E155X, K161X, Q163X, and/or T166X mutation in TadA reference sequence or one or more corresponding mutations in another
  • the adenosine deaminase comprises one or more of H8Y, R26W, M61I, L68Q, M70V, A106T, D108N, A109T, N127S, D147Y, R152C, Q154H or Q154R, E155G or E155V or E155D, K161Q, Q163H, and/or T166P mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8X, D108X, N127X, D147X,
  • R152X, and Q154X in TadA reference sequence or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • adenosine deaminase e.g., ecTadA
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8X, M61X, M70X, D108X, N127X, Q154X, E155X, and Q163X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8X, D108X, N127X, E155X, and T166X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8X, A106X and D108X, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8X, R26X, L68X, D108X, N127X, D147X, and E155X, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of H8X, R126X, L68X, D108X, N127X, D147X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, or five mutations selected from the group consisting of H8X, D108X, A109X, N127X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8Y, D108N, N127S, D147Y, R152C, and Q154H in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase ( e.g ., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8Y, M61I, M70V, D108N, N127S, Q154R, E155G and Q163H in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, D108N, N127S, E155V, and T166P in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8Y, A106T, D108N, N127S, E155D, and K161Q in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8Y, R26W, L68Q, D108N, N127S, D147Y, and E155V in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, D108N, A109T, N127S, and E155G in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase ( e.g ., ecTadA).
  • any of the mutations provided herein and any additional mutations can be introduced into any other adenosine deaminases.
  • Any of the mutations provided herein can be made individually or in any combination in TadA reference sequence or another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA). In some embodiments, the adenosine deaminase comprises a D108N, D108G, or D 108V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises a A106V and D108N mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA). In some embodiments, the adenosine deaminase comprises R107C and D108N mutations in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises a H8Y, D108N, N127S, D147Y, and Q154H mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA). In some embodiments, the adenosine deaminase comprises aH8Y, D108N, N127S, D147Y, and El 55V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises a D108N, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA). In some embodiments, the adenosine deaminase comprises aH8Y, D108N, andN127S mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises a A106V, D108N, D147Y and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of a S2X, H8X, I49X, L84X, H123X, N127X, I156X and/or K160X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of S2A, H8Y, I49F, L84F, H123Y, N127S, I156F and/or K160S mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase ( e.g ., ecTadA).
  • the adenosine deaminase comprises an L84X mutation adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an L84F mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an H123X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an H123Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an I156X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an I156F mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of L84X, A106X, D108X, H123X, D147X, E155X, and I156X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of S2X, 149X, A106X, D108X, D147X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase ( e.g ., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8X, A106X, D108X, N127X, and K160X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of L84F, A106V, D108N, H123Y, D147Y, E155V, and I156F in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of S2A, I49F, A106V, D108N, D147Y, and E155V in TadA reference sequence.
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting ofH8Y, A106T, D108N, N127S, and K160S in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of a E25X, R26X, R107X, A142X, and/or A143X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • adenosine deaminase comprises one or more of a E25X, R26X, R107X, A142X, and/or A143X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of E25M, E25D, E25A, E25R, E25V, E25S, E25Y, R26G, R26N, R26Q, R26C, R26L, R26K, R107P, R107K, R107A, R107N, R107W, R107H, R107S, A142N, A142D, A142G, A143D, A143G, A143E, A143L, A143W, A143M, A143S, A143Q and/or A143R mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • another adenosine deaminase e.g., ecTadA
  • the adenosine deaminase comprises one or more of the mutations described herein corresponding to TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an E25X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an E25M, E25D, E25A, E25R, E25V, E25S, or E25Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase ( e.g ., ecTadA).
  • the adenosine deaminase comprises an R26X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises R26G, R26N, R26Q, R26C, R26L, or R26K mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an R107X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an R107P, R107K, R107A, R107N, R107W, R107H, or R107S mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an A142X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A142N, A142D, A142G, mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an A143X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A143D, A143G, A143E, A143L, A143W, A143M, A143S, A143Q and/or A143R mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of aH36X, N37X, P48X, I49X, R51X, M70X, N72X, D77X, E134X, S146X, Q154X, K157X, and/or K161X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA), where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of H36L, N37T, N37S, P48T, P48L, I49V, R51H, R51L, M70L, N72S, D77G, E134G, S146R, S146C, Q154H, K157N, and/or K161T mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g ., ecTadA).
  • the adenosine deaminase comprises an H36X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an H36L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an N37X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an N37T, or N37S mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an P48X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an P48T, or P48L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an R51X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an R51H, or R51L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an S146X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an S146R, or S146C mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase ( e.g ., ecTadA).
  • the adenosine deaminase comprises an K157X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a K157N mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an P48X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a P48S, P48T, or P48A mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an A142X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a A142N mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an W23X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a W23R, or W23L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • General Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Medicinal Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Biophysics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Crystallography & Structural Chemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Enzymes And Modification Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2020/049975 2019-09-09 2020-09-09 Novel nucleobase editors and methods of using same Ceased WO2021050571A1 (en)

Priority Applications (8)

Application Number Priority Date Filing Date Title
KR1020227011386A KR20220076467A (ko) 2019-09-09 2020-09-09 신규 핵염기 편집기 및 이의 사용 방법
CA3153624A CA3153624A1 (en) 2019-09-09 2020-09-09 Nucleobase editors and methods of using same
AU2020344547A AU2020344547A1 (en) 2019-09-09 2020-09-09 Novel nucleobase editors and methods of using same
US17/641,343 US20230075877A1 (en) 2019-09-09 2020-09-09 Novel nucleobase editors and methods of using same
JP2022514994A JP7717684B2 (ja) 2019-09-09 2020-09-09 新規核酸塩基エディター及びその使用方法
EP20863422.0A EP4028026A4 (en) 2019-09-09 2020-09-09 NOVEL NUCLEOBASE EDITORS AND METHODS OF USING THE SAME
CN202080077983.2A CN114667149A (zh) 2019-09-09 2020-09-09 新型核碱基编辑器及其使用方法
JP2025122950A JP2025170240A (ja) 2019-09-09 2025-07-23 新規核酸塩基エディター及びその使用方法

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201962897777P 2019-09-09 2019-09-09
US62/897,777 2019-09-09
USPCT/US2020/018195 2020-02-13
PCT/US2020/018195 WO2020168135A1 (en) 2019-02-13 2020-02-13 Compositions and methods for treating alpha-1 antitrypsin deficiency

Publications (1)

Publication Number Publication Date
WO2021050571A1 true WO2021050571A1 (en) 2021-03-18

Family

ID=74867196

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/049975 Ceased WO2021050571A1 (en) 2019-09-09 2020-09-09 Novel nucleobase editors and methods of using same

Country Status (8)

Country Link
US (1) US20230075877A1 (https=)
EP (1) EP4028026A4 (https=)
JP (2) JP7717684B2 (https=)
KR (1) KR20220076467A (https=)
CN (1) CN114667149A (https=)
AU (1) AU2020344547A1 (https=)
CA (1) CA3153624A1 (https=)
WO (1) WO2021050571A1 (https=)

Cited By (28)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3923994A4 (en) * 2019-02-13 2023-01-25 Beam Therapeutics, Inc. COMPOSITIONS AND METHODS FOR TREATMENT OF ALPHA-1 ANTITRYPSIN DEFICIENCY
WO2023052366A1 (en) 2021-09-28 2023-04-06 INSERM (Institut National de la Santé et de la Recherche Médicale) Base editing approaches for the treatment of beta-hemoglobinopathies
WO2023099591A1 (en) 2021-12-01 2023-06-08 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for increasing fetal hemoglobin content by editing the +55-kb region of the erythroid-specific bcl11a enhancer
WO2023144104A1 (en) 2022-01-25 2023-08-03 INSERM (Institut National de la Santé et de la Recherche Médicale) Base editing approaches for the treatment of βeta-thalassemia
WO2023196802A1 (en) 2022-04-04 2023-10-12 The Broad Institute, Inc. Cas9 variants having non-canonical pam specificities and uses thereof
WO2023212715A1 (en) 2022-04-28 2023-11-02 The Broad Institute, Inc. Aav vectors encoding base editors and uses thereof
US11814620B2 (en) 2021-05-10 2023-11-14 Mammoth Biosciences, Inc. Effector proteins and methods of use
WO2023217888A1 (en) 2022-05-10 2023-11-16 Institut National de la Santé et de la Recherche Médicale Base editing approaches for correcting the cd39 (cag>tag) mutation in patients suffering from βeta-thalassemia
WO2023217904A1 (en) 2022-05-10 2023-11-16 Institut National de la Santé et de la Recherche Médicale Syncitin-1 fusion proteins and uses thereof for cargo delivery into target cells
WO2024018056A1 (en) 2022-07-22 2024-01-25 Institut National de la Santé et de la Recherche Médicale Base editing approaches for correcting the ivs2-1 (g>a) mutation in patients suffering from βeta-thalassemia
WO2024040083A1 (en) 2022-08-16 2024-02-22 The Broad Institute, Inc. Evolved cytosine deaminases and methods of editing dna using same
JP2024511163A (ja) * 2021-03-26 2024-03-12 ビーム セラピューティクス インク. アデノシンデアミナーゼバリアント及びその使用
WO2024063273A1 (en) * 2022-09-23 2024-03-28 Institute For Basic Science Novel adenine deaminase variants and a method for base editing using the same
US20240252682A1 (en) * 2021-09-08 2024-08-01 Flagship Pioneering Innovations Vi, Llc Hbb-modulating compositions and methods
WO2024165484A1 (en) 2023-02-06 2024-08-15 Institut National de la Santé et de la Recherche Médicale Enrichment of genetically modified hematopoietic stem cells through multiplex base editing
US12077775B2 (en) 2022-01-21 2024-09-03 Mammoth Biosciences, Inc. Effector proteins and methods of use
US12133884B2 (en) 2018-05-11 2024-11-05 Beam Therapeutics Inc. Methods of substituting pathogenic amino acids using programmable base editor systems
WO2025024486A2 (en) 2023-07-25 2025-01-30 Flagship Pioneering Innovations Vii, Llc Cas endonucleases and related methods
WO2025072331A1 (en) 2023-09-26 2025-04-03 Flagship Pioneering Innovations Vii, Llc Cas nucleases and related methods
WO2025117877A2 (en) 2023-12-01 2025-06-05 Flagship Pioneering Innovations Vii, Llc Cas nucleases and related methods
EP4396207A4 (en) * 2021-09-03 2025-07-16 Univ Chicago POLYPEPTIDES AND METHODS FOR MODIFYING NUCLEIC ACIDS
US12454694B2 (en) 2018-09-07 2025-10-28 Beam Therapeutics Inc. Compositions and methods for improving base editing
EP4363568A4 (en) * 2021-06-29 2025-12-03 Council Scient Ind Res MODIFIED FNCAS9 AND ITS USES
US12529041B2 (en) 2018-09-07 2026-01-20 Beam Therapeutics Inc. Compositions and methods for delivering a nucleobase editing system
US12576151B2 (en) 2020-09-25 2026-03-17 Beam Therapeutics Inc. Fratricide resistant modified immune cells and methods of using the same
US12594301B2 (en) 2019-09-27 2026-04-07 Beam Therapeutics Inc. Compositions and methods for treatment of liquid cancers
US12600971B2 (en) 2019-02-13 2026-04-14 Beam Therapeutics Inc. Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence
US12612618B2 (en) 2019-01-31 2026-04-28 Beam Therapeutics Inc. Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors

Families Citing this family (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3128755C (en) 2019-02-13 2024-06-04 Beam Therapeutics Inc. Compositions and methods for treating hemoglobinopathies
CN115820691B (zh) * 2022-07-25 2023-08-22 安徽农业大学 一种基于LbCpf1变体的水稻碱基编辑系统和应用
WO2024040874A1 (zh) * 2022-08-22 2024-02-29 山东舜丰生物科技有限公司 突变的Cas12j蛋白及其应用
WO2024230760A1 (zh) * 2023-05-09 2024-11-14 北京齐禾生科生物科技有限公司 一种可作用于dna的腺苷脱氨酶及其应用
CN117965505A (zh) * 2023-06-28 2024-05-03 微光基因(苏州)有限公司 工程化的腺苷脱氨酶及碱基编辑器
WO2025059520A1 (en) * 2023-09-15 2025-03-20 Beam Therapeutics Inc. Compositions and methods for base editing a phenylalanine hydroxylase polynucleotide
CN120536418A (zh) * 2024-02-26 2025-08-26 尧唐(上海)生物科技有限公司 一种脱氨酶变体、包含其的碱基编辑器及其应用

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180073012A1 (en) * 2016-08-03 2018-03-15 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
WO2018089664A1 (en) * 2016-11-11 2018-05-17 The Regents Of The University Of California Variant rna-guided polypeptides and methods of use
US20180216095A1 (en) * 2014-10-14 2018-08-02 Halozyme, Inc. Compositions of adenosine deaminase-2 (ada2), variants thereof and methods of using same
WO2019120310A1 (en) * 2017-12-22 2019-06-27 Institute Of Genetics And Developmental Biology, Chinese Academy Of Sciences Base editing system and method based on cpf1 protein

Family Cites Families (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11242542B2 (en) * 2016-10-07 2022-02-08 Integrated Dna Technologies, Inc. S. pyogenes Cas9 mutant genes and polypeptides encoded by same
KR102622411B1 (ko) * 2016-10-14 2024-01-10 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 핵염기 에디터의 aav 전달
KR20250107288A (ko) * 2017-10-16 2025-07-11 더 브로드 인스티튜트, 인코퍼레이티드 아데노신 염기 편집제의 용도
CN109295186B (zh) * 2018-09-30 2023-10-03 中山大学 一种基于全基因组测序检测腺嘌呤单碱基编辑系统脱靶效应的方法及其在基因编辑中的应用

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20180216095A1 (en) * 2014-10-14 2018-08-02 Halozyme, Inc. Compositions of adenosine deaminase-2 (ada2), variants thereof and methods of using same
US20180073012A1 (en) * 2016-08-03 2018-03-15 President And Fellows Of Harvard College Adenosine nucleobase editors and uses thereof
WO2018089664A1 (en) * 2016-11-11 2018-05-17 The Regents Of The University Of California Variant rna-guided polypeptides and methods of use
WO2019120310A1 (en) * 2017-12-22 2019-06-27 Institute Of Genetics And Developmental Biology, Chinese Academy Of Sciences Base editing system and method based on cpf1 protein

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP4028026A4 *

Cited By (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12133884B2 (en) 2018-05-11 2024-11-05 Beam Therapeutics Inc. Methods of substituting pathogenic amino acids using programmable base editor systems
US12454694B2 (en) 2018-09-07 2025-10-28 Beam Therapeutics Inc. Compositions and methods for improving base editing
US12529041B2 (en) 2018-09-07 2026-01-20 Beam Therapeutics Inc. Compositions and methods for delivering a nucleobase editing system
US12612618B2 (en) 2019-01-31 2026-04-28 Beam Therapeutics Inc. Nucleobase editors having reduced non-target deamination and assays for characterizing nucleobase editors
EP3923994A4 (en) * 2019-02-13 2023-01-25 Beam Therapeutics, Inc. COMPOSITIONS AND METHODS FOR TREATMENT OF ALPHA-1 ANTITRYPSIN DEFICIENCY
US12600971B2 (en) 2019-02-13 2026-04-14 Beam Therapeutics Inc. Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence
US12594301B2 (en) 2019-09-27 2026-04-07 Beam Therapeutics Inc. Compositions and methods for treatment of liquid cancers
US12576151B2 (en) 2020-09-25 2026-03-17 Beam Therapeutics Inc. Fratricide resistant modified immune cells and methods of using the same
JP2024511163A (ja) * 2021-03-26 2024-03-12 ビーム セラピューティクス インク. アデノシンデアミナーゼバリアント及びその使用
EP4313118A4 (en) * 2021-03-26 2025-06-18 Beam Therapeutics Inc. ADENOSINE DEAMINASE VARIANTS AND THEIR USES
US11814620B2 (en) 2021-05-10 2023-11-14 Mammoth Biosciences, Inc. Effector proteins and methods of use
EP4363568A4 (en) * 2021-06-29 2025-12-03 Council Scient Ind Res MODIFIED FNCAS9 AND ITS USES
EP4396207A4 (en) * 2021-09-03 2025-07-16 Univ Chicago POLYPEPTIDES AND METHODS FOR MODIFYING NUCLEIC ACIDS
US20240252682A1 (en) * 2021-09-08 2024-08-01 Flagship Pioneering Innovations Vi, Llc Hbb-modulating compositions and methods
WO2023052366A1 (en) 2021-09-28 2023-04-06 INSERM (Institut National de la Santé et de la Recherche Médicale) Base editing approaches for the treatment of beta-hemoglobinopathies
WO2023099591A1 (en) 2021-12-01 2023-06-08 INSERM (Institut National de la Santé et de la Recherche Médicale) Methods for increasing fetal hemoglobin content by editing the +55-kb region of the erythroid-specific bcl11a enhancer
US12077775B2 (en) 2022-01-21 2024-09-03 Mammoth Biosciences, Inc. Effector proteins and methods of use
WO2023144104A1 (en) 2022-01-25 2023-08-03 INSERM (Institut National de la Santé et de la Recherche Médicale) Base editing approaches for the treatment of βeta-thalassemia
WO2023196802A1 (en) 2022-04-04 2023-10-12 The Broad Institute, Inc. Cas9 variants having non-canonical pam specificities and uses thereof
WO2023212715A1 (en) 2022-04-28 2023-11-02 The Broad Institute, Inc. Aav vectors encoding base editors and uses thereof
WO2023217888A1 (en) 2022-05-10 2023-11-16 Institut National de la Santé et de la Recherche Médicale Base editing approaches for correcting the cd39 (cag>tag) mutation in patients suffering from βeta-thalassemia
WO2023217904A1 (en) 2022-05-10 2023-11-16 Institut National de la Santé et de la Recherche Médicale Syncitin-1 fusion proteins and uses thereof for cargo delivery into target cells
WO2024018056A1 (en) 2022-07-22 2024-01-25 Institut National de la Santé et de la Recherche Médicale Base editing approaches for correcting the ivs2-1 (g>a) mutation in patients suffering from βeta-thalassemia
WO2024040083A1 (en) 2022-08-16 2024-02-22 The Broad Institute, Inc. Evolved cytosine deaminases and methods of editing dna using same
WO2024063273A1 (en) * 2022-09-23 2024-03-28 Institute For Basic Science Novel adenine deaminase variants and a method for base editing using the same
WO2024165484A1 (en) 2023-02-06 2024-08-15 Institut National de la Santé et de la Recherche Médicale Enrichment of genetically modified hematopoietic stem cells through multiplex base editing
WO2025024486A2 (en) 2023-07-25 2025-01-30 Flagship Pioneering Innovations Vii, Llc Cas endonucleases and related methods
WO2025072331A1 (en) 2023-09-26 2025-04-03 Flagship Pioneering Innovations Vii, Llc Cas nucleases and related methods
WO2025117877A2 (en) 2023-12-01 2025-06-05 Flagship Pioneering Innovations Vii, Llc Cas nucleases and related methods

Also Published As

Publication number Publication date
JP7717684B2 (ja) 2025-08-04
JP2025170240A (ja) 2025-11-18
US20230075877A1 (en) 2023-03-09
AU2020344547A1 (en) 2022-03-24
EP4028026A1 (en) 2022-07-20
CN114667149A (zh) 2022-06-24
JP2022546608A (ja) 2022-11-04
KR20220076467A (ko) 2022-06-08
CA3153624A1 (en) 2021-03-18
EP4028026A4 (en) 2023-09-06

Similar Documents

Publication Publication Date Title
JP7717684B2 (ja) 新規核酸塩基エディター及びその使用方法
US20250108098A1 (en) Methods of substituting pathogenic amino acids using programmable base editor systems
US12016908B2 (en) Compositions and methods for treating hemoglobinopathies
JP7646554B2 (ja) アルファ-1アンチトリプシン不全を治療するための組成物および方法
JP7679311B2 (ja) プログラム可能塩基エディターシステムを用いた一塩基多型編集法
CN114026237B (zh) 用于治疗1a型糖原贮积病的组成物和方法
WO2019217944A1 (en) Methods of editing single nucleotide polymorphism using programmable base editor systems
AU2020223297A1 (en) Splice acceptor site disruption of a disease-associated gene using adenosine deaminase base editors, including for the treatment of genetic disease
US20220290164A1 (en) Recombinant rabies viruses for gene therapy
EP4022050A2 (en) Compositions and methods for editing a mutation to permit transcription or expression
US20240360433A1 (en) Compositions and methods for the treatment of hereditary angioedema (hae)
AU2020276218A1 (en) Compositions and methods for treating hepatitis B

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20863422

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2022514994

Country of ref document: JP

Kind code of ref document: A

Ref document number: 3153624

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2020344547

Country of ref document: AU

Date of ref document: 20200909

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2020863422

Country of ref document: EP

Effective date: 20220411