WO2021048806A1 - Methods for treating ocular diseases - Google Patents
Methods for treating ocular diseases Download PDFInfo
- Publication number
- WO2021048806A1 WO2021048806A1 PCT/IB2020/058459 IB2020058459W WO2021048806A1 WO 2021048806 A1 WO2021048806 A1 WO 2021048806A1 IB 2020058459 W IB2020058459 W IB 2020058459W WO 2021048806 A1 WO2021048806 A1 WO 2021048806A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- vegf antagonist
- patient
- disease activity
- weeks
- dose
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/22—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0048—Eye, e.g. artificial tears
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/54—Medicinal preparations containing antigens or antibodies characterised by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the invention relates to methods for treating ocular disease with a VEGF antagonist.
- the invention relates to treating neovascular ocular disease, such as diabetic retinopathy and proliferative diabetic retinopathy, with less frequent dosing than currently approved treatment regimens.
- DM Diabetes mellitus
- DR Diabetic retinopathy
- DME diabetic macular edema
- VA visual acuity
- DR is the most common cause of vision loss among people with diabetes and the leading cause of vision impairment and blindness in working aged adults. DR occurs when high blood glucose levels cause damage to blood vessels in the retina. These blood vessels can swell and leak or they can close, stopping blood from passing through. Sometimes abnormal new blood vessels can also grow on the retina. Diabetic retinopathy includes both non proliferative diabetic retinopathy (nPDR) and proliferative diabetic retinopathy (PDR), the more advanced form of the disease. DME is a frequent manifestation of DR (Riordan-Eva, 2004, Eye (Lond). 2004, 18:1161-8) and is the major cause of visual loss in patients with DR.
- nPDR non proliferative diabetic retinopathy
- PDR proliferative diabetic retinopathy
- DME diabetic macular edema
- PDR diabetic macular edema
- EYLEA® the recommended dose of EYLEA® is 2 mg (0.05 mL) administered every 4 weeks for 5 injections followed by an injection once every 8 weeks.
- the recommended dose of LUCENTIS® is 0.3 mg (0.05 mL) administered once a month.
- PRP panretinal photocoagulation
- the invention provides a method of administering a therapeutic VEGF antagonist for treating proliferative diabetic retinopathy (PDR).
- PDR proliferative diabetic retinopathy
- the invention provides methods for treating PDR comprising administering to a mammal at least two individual doses of a VEGF antagonist at 6-week intervals (q6w) in a loading phase, followed by additional doses in a maintenance phase, wherein at least 6 weeks separate the doses administered in the maintenance phase.
- doses in the maintenance phase are administered no less than once every 12 weeks (ql2w).
- the dosing frequency is adjusted based on the outcome of disease activity assessments, for example using pre-defmed visual and anatomic criteria. In one aspect, at any time during the maintenance phase (e.g.
- the treatment interval may be extended by 6 weeks at a time up to 24 weeks, at the treatment provider’s discretion based on an assessment of diabetic activity.
- dosing frequency in the maintenance phase can be adjusted by decreasing the dosing interval from once every 12 weeks (ql2w) to once every 6 weeks (q6w) if disease activity is detected at any scheduled treatment visit.
- the invention also provides a VEGF antagonist for use in a method of treating ocular diseases, particularly ocular neovascular diseases, more particularly diabetic retinopathy (DR) and proliferative diabetic retinopathy (PDR), in a patient, wherein the VEGF antagonist is first provided in a loading phase, during which the patient receives three individual doses of the VEGF antagonist at 6-week intervals, and then the VEGF antagonist is provided in a maintenance phase, during which the patient receives an additional dose of the VEGF antagonist once every 12 weeks (ql2w).
- dosing frequency can be extended by increasing the dosing interval 6 weeks at a time to once every 24 weeks (q24w) if disease activity is not detected at a scheduled treatment visit.
- dosing frequency can be adjusted by decreasing the dosing interval from once every 12 weeks (ql2w) to once every 6 weeks (q6w) if disease activity is detected at scheduled treatment visits.
- the invention also provides methods for treating DR comprising administering to a mammal at least two individual doses of a VEGF antagonist at 6-week intervals (q6w) in a loading phase, followed by additional doses in a maintenance phase, wherein at least 6 weeks separate the doses administered in the maintenance phase.
- doses in the maintenance phase are administered no less than once every 12 weeks (ql2w).
- the dosing frequency is adjusted based on the outcome of disease activity assessments, for example using pre-defmed visual and anatomic criteria.
- at any time during the maintenance phase e.g.
- the treatment interval may be extended by 6 weeks at a time up to 24 weeks, at the treatment provider’s discretion based on an assessment of diabetic activity.
- dosing frequency in the maintenance phase can be adjusted by decreasing the dosing interval from once every 12 weeks (ql2w) to once every 6 weeks (q6w) if disease activity is detected at any scheduled treatment visit.
- the patient also has macular edema (e.g., diabetic macular edema).
- the invention further provides methods for preventing progression of proliferative diabetic retinopathy (PDR) to non-proliferative diabetic retinopathy (NPDR) in a patient, comprising administering to a mammal at least two individual doses of a VEGF antagonist at 6-week intervals (q6w) in a loading phase, followed by additional doses in a maintenance phase, wherein at least 6 weeks separate the doses administered in the maintenance phase.
- doses in the maintenance phase are administered no less than once every 12 weeks (ql2w).
- the dosing frequency is adjusted based on the outcome of disease activity assessments, for example using pre-defmed visual and anatomic criteria. In one aspect, at any time during the maintenance phase (e.g.
- the treatment interval may be extended by 6 weeks at a time up to 24 weeks, at the treatment provider’s discretion based on an assessment of diabetic activity.
- dosing frequency in the maintenance phase can be adjusted by decreasing the dosing interval from once every 12 weeks (ql2w) to once every 6 weeks (q6w) if disease activity is detected at any scheduled treatment visit.
- the patient is initially treated for NPDR. In other aspects, the patient is initially treated for DR.
- the invention also provides a kit, comprising: a drug container comprising a VEGF antagonist, and instructions for using the VEGF antagonist for treating a patient diagnosed with DR, NPDR, or PDR, three doses of the VEGF antagonist administered at 6-week intervals (q6w), the last of which is followed by additional individual doses of the VEGF antagonist at 12-week intervals (ql2w).
- the kit comprises one or more 6 mg doses of brolucizumab, each dose provided in a single use vial containing sufficient brolucizumab to deliver a 6 mg dose when administering a volume of 0.05 mL or in a prefilled syringe containing 6 mg of brolucizumab.
- the instructions further indicate the ql2w dosing interval be adjusted to once every 6 weeks if PDR disease activity is observed in the treated eye. In another aspect, the instructions further indicate the ql2w dosing interval be extended to once every 24 weeks, if no PDR disease activity is observed in the treated eye. In still another aspect, the instructions further indicate the VEGF antagonist is administered on an as needed basis, i.e., pro re nata (PRN), at the discretion of a treatment provider (e.g., a physician or other qualified medical professional) based on visual and/or anatomical outcomes to determine disease activity before or after any ql2w dose.
- a treatment provider e.g., a physician or other qualified medical professional
- the VEGF antagonist used in a method of the invention is an anti- VEGF antibody.
- the anti-VEGF antibody is a single chain antibody (scFv) or Fab fragment.
- the anti-VEGF antibody is brolucizumab.
- a method for treating proliferative diabetic retinopathy (PDR) in a patient comprising: a) administering to the patient three individual doses of a VEGF antagonist at 6- week intervals; and b) administering to the patient one or more additional doses of the VEGF antagonist once every 12 weeks (ql2w regimen), wherein the first additional dose is administered 12 weeks after the third individual dose of step a).
- PDR proliferative diabetic retinopathy
- a method for treating diabetic retinopathy (DR) or proliferative diabetic retinopathy (PDR) comprising administering to a patient three individual doses at 6-week intervals in a loading phase, followed by additional doses every 12 weeks (ql2w regimen) in a maintenance phase, of about 3 mg or about 6 mg of a VEGF antagonist that is an anti- VEGF antibody, optionally a DR patient also has macular edema (such as diabetic macular edema).
- a VEGF antagonist that is an anti- VEGF antibody
- macular edema such as diabetic macular edema
- DR diabetic retinopathy
- PDR proliferative diabetic retinopathy
- 21 The VEGF antagonist for use according to embodiment 20, wherein the method further comprises assessing the patient for DR or PDR disease activity before or after administering every ql2w dose.
- VEGF antagonist for use according to embodiment 21, wherein disease activity is assessed based on identifying best corrected visual acuity (BCVA), ETDRS DRSS score, retinal neovascularization status, and peripheral visual field.
- BCVA best corrected visual acuity
- ETDRS DRSS score retinal neovascularization status
- peripheral visual field identifying best corrected visual acuity
- VEGF antagonist for use according to embodiment 21 or 22, wherein if worsening of disease activity is identified after a ql2w dose, the patient is switched to a q6w regimen, wherein the additional doses are administered once every 6 weeks instead of once every 12 weeks.
- VEGF antagonist for use according to embodiment 23, wherein the worsening of disease activity is new or worsening retinal neovascularization, reperfusion of retinal neovascularization, increase in ETDRS DRSS score (such as an increase of 2 or more steps), loss in peripheral visual field, and/or developing complications that impact visual acuity compared to any previous assessment.
- VEGF antagonist for use according to any one of embodiments 20 to 22, wherein at any time during the maintenance phase the dosing intervals are extended to 24 weeks (q24w) if disease activity is improved or stable relative to the prior disease activity assessment.
- VEGF antagonist for use according to any one of embodiments 20-25, wherein the patient is a human.
- VEGF antagonist for use according to any one of embodiments 20-26, wherein the anti-VEGF antagonist is brolucizumab.
- VEGF antagonist for use according to any one of embodiments 20-27, wherein the VEGF antagonist is administered by intravitreal injection. 29. The VEGF antagonist for use according to any one of embodiments 20-28, wherein the dose of the VEGF antagonist is about 3 mg to about 6 mg.
- a VEGF antagonist for use in a method of treating diabetic retinopathy (DR) or proliferative diabetic retinopathy (PDR) in a patient wherein the VEGF antagonist is first provided in a loading phase, during which the patient receives three individual doses of about 3 mg or about 6 mg of the VEGF antagonist at 6-week intervals, and then the VEGF antagonist is provided in a maintenance phase, during which the patient receives an additional about 3 mg or about 6 mg dose of the VEGF antagonist once every 12 weeks (ql2w regimen).
- DR diabetic retinopathy
- PDR proliferative diabetic retinopathy
- VEGF antagonist for use according to embodiment 30, wherein the method further comprises assessing the patient for DR or PDR disease activity before or after administering every ql2w dose.
- VEGF antagonist for use according to embodiment 31, wherein disease activity is assessed based on identifying best corrected visual acuity (BCVA), ETDRS DRSS score, retinal neovascularization status, and peripheral visual field.
- BCVA best corrected visual acuity
- ETDRS DRSS score retinal neovascularization status
- peripheral visual field identifying best corrected visual acuity
- VEGF antagonist for use according to embodiment 31 or 32, wherein if worsening of disease activity is new or worsening retinal neovascularization, reperfusion of retinal neovascularization, increase in ETDRS DRSS score(such as an increase of 2 or more steps), loss in peripheral visual field, and/or developing complications that impact visual acuity compared to any previous assessment.
- VEGF antagonist for use according to embodiment 33, wherein the worsening of PDR disease activity is new or worsening retinal neovascularization, reperfusion of retinal neovascularization, increase in ETDRS DRSS score, loss in peripheral visual field, and/or developing complications that impact visual acuity compared to any previous assessment.
- VEGF antagonist for use according to any one of embodiments 30 to 32, wherein at any time during the maintenance phase the dosing intervals are extended to 24 weeks (q24w) if disease activity is improved or stable relative to the prior disease activity assessment.
- VEGF antagonist for use according to any one of embodiments 30-35, wherein the patient is a human.
- VEGF antagonist for use according to any one of embodiments 30-36, wherein the anti-VEGF antagonist is brolucizumab.
- VEGF antagonist for use according to any one of embodiments 30-37, wherein the VEGF antagonist is administered by intravitreal injection.
- a kit comprising: a) a drug container comprising a VEGF antagonist, and b) instructions for using the VEGF antagonist for treating a patient diagnosed with DR or PDR, three doses of the VEGF antagonist administered at 6-week intervals (q6w), the last of which is followed by additional individual doses of the VEGF antagonist at 12-week intervals (ql2w).
- the instructions further indicate the VEGF antagonist is administered on an as needed basis, i.e., pro re nata (PRN), at the discretion of a treatment provider (e.g., a physician or other qualified medical professional) based on visual and/or anatomical outcomes to determine disease activity before or after any ql2w dose.
- a treatment provider e.g., a physician or other qualified medical professional
- a method for preventing progression of proliferative diabetic retinopathy (PDR) to non-proliferative diabetic retinopathy (NPDR) in a patient comprising: a) administering to the patient three individual doses of a VEGF antagonist at 6- week intervals; and b) administering to the patient an additional dose of the VEGF antagonist once every 12 weeks (ql2w regimen) thereafter.
- PDR proliferative diabetic retinopathy
- NPDR non-proliferative diabetic retinopathy
- VEGF refers to the 165-amino acid vascular endothelial cell growth factor, and related 121-, 189-, and 206-amino acid vascular endothelial cell growth factors, as described by Leung et al, Science 246:1306 (1989), and Houck et al, Mol. Endocrin. 5:1806 (1991) together with the naturally occurring allelic and processed forms of those growth factors.
- VEGF receptor refers to a cellular receptor for VEGF, ordinarily a cell-surface receptor found on vascular endothelial cells, as well as variants thereof retaining the ability to bind hVEGF.
- a VEGF receptor is the fms-like tyrosine kinase (fit), a transmembrane receptor in the tyrosine kinase family. DeVries et al ., Science 255:989 (1992); Shibuya et al , Oncogene 5:519 (1990).
- the fit receptor comprises an extracellular domain, a transmembrane domain, and an intracellular domain with tyrosine kinase activity.
- VEGF receptor Another example of a VEGF receptor is the flk-1 receptor (also referred to as KDR).
- KDR flk-1 receptor
- Binding of VEGF to the fit receptor results in the formation of at least two high molecular weight complexes, having an apparent molecular weight of 205,000 and 300,000 Daltons. The 300,000 Dalton complex is believed to be a dimer comprising two receptor molecules bound to a single molecule of VEGF.
- a "VEGF antagonist” refers to a compound that can diminish or inhibit VEGF activity in vivo.
- a VEGF antagonist can bind to a VEGF receptor(s) or block VEGF protein(s) from binding to VEGF receptor(s).
- a VEGF antagonist can be, for example, a small molecule, an anti-VEGF antibody or antigen-binding fragments thereof, fusion protein (such as aflibercept or other such soluble decoy receptor), an aptamer, an antisense nucleic acid molecule, an interfering RNA, receptor proteins, and the like that can bind specifically to one or more VEGF proteins or one or more VEGF receptors.
- the VEGF antagonist is an anti-VEGF antibody (such as brolucizumab or ranibizumab or bevacizumab or a bi-specific antibody such as faricimab) or a soluble VEGF receptor (such as aflibercept).
- anti-VEGF antibody such as brolucizumab or ranibizumab or bevacizumab or a bi-specific antibody such as faricimab
- a soluble VEGF receptor such as aflibercept.
- antibody includes whole antibodies and any antigen binding fragment (i.e ., “antigen-binding portion,” “antigen binding polypeptide,” or “immunobinder”) or single chain thereof.
- An “antibody” includes a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds, or an antigen binding portion thereof.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region.
- the heavy chain constant region is comprised of three domains, CHI, CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- the light chain constant region is comprised of one domain, CL.
- the VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- Each VH and VL is composed of three CDRs and four FRs, arranged from amino-terminus to carboxy -terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g ., effector cells) and the first component (Clq) of the classical complement system.
- single chain antibody single chain Fv or single chain Fv
- scFv single chain Fv
- scFv single chain Fv
- Such scFv molecules can have the general structures: ME-VL-linker-VH-COOH or NH2-VH-linker-VL-COOH.
- antibody portion refers to one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g., VEGF). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- an antigen e.g., VEGF
- binding fragments encompassed within the term “antigen-binding portion” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a single domain or dAb fragment (Ward et al.
- Antigen-binding portions can be produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins.
- Antibodies can be of different isotype, for example, an IgG (e.g., an IgGl, IgG2, IgG3, or IgG4 subtype), IgAl, IgA2, IgD, IgE, or IgM antibody.
- IgG e.g., an IgGl, IgG2, IgG3, or IgG4 subtype
- IgAl IgA2, IgD, IgE, or IgM antibody.
- a “mammal” includes any animal classified as a mammal, including, but not limited to, humans, domestic animals, farm animals, and companion animals, etc.
- an “ocular disease” or “neovascular ocular disease” that can be treated using a method of the invention includes, a condition, disease, or disorder associated with ocular neovascularization, including, but not limited to, abnormal angiogenesis, choroidal neovascularization (CNV), retinal vascular permeability, retinal edema, diabetic retinopathy (particularly proliferative diabetic retinopathy (PDR) and non-proliferative diabetic retinopathy (NPDR)), diabetic macular edema (DME), neovascular (exudative) age-related macular degeneration (AMD), including CNV associated with nAMD (neovascular AMD), sequela associated with retinal ischemia, Central Retinal Vein Occlusion (CRVO), Branch Retinal Vein Occlusion (BRVO), and posterior segment neovascularization.
- the disease is PDR.
- the disease is NPDR.
- a subject or patient refers to human and non-human mammals, including but, not limited to, primates, pigs, horses, dogs, cats, sheep, and cows.
- a subject or patient is a human.
- the invention provides methods for treating a patient having diabetic retinopathy (DR), non-proliferative diabetic retinopathy (NPDR), and proliferative diabetic retinopathy (PDR), the method comprising administering to the patient a VEGF antagonist on a treatment schedule that includes a loading phase and a maintenance phase as described herein.
- DR diabetic retinopathy
- NPDR non-proliferative diabetic retinopathy
- PDR proliferative diabetic retinopathy
- the invention provides methods for preventing progression of NPDR to PDR, the comprising administering to the patient a VEGF antagonist on a treatment schedule that includes a loading phase and a maintenance phase as described herein.
- a patient is at least 18 years of age, and has been diagnosed with diabetes mellitus (DM) type 1 or 2, and HbAlc ⁇ 12%.
- a patient has PDR as assessed by a treatment provider, and has a BCVA > 34 ETDRS letters (Snellen equivalent 20/200).
- a patient is diagnosed with PDR by a treatment provider, for example, using standard or wide-field Color Fundus Photographs (CFP), optionally fluorescein angiography (FA).
- CFP Color Fundus Photographs
- FA optionally fluorescein angiography
- a patient has not received panretinal photocoagulation (PRP) laser treatment.
- PRP panretinal photocoagulation
- the loading phase consists of at least two individual doses, administered at 6-week intervals (q6w), e.g., at day 0, at week 6, and at week 12.
- the maintenance phase starts with a dosing regimen wherein the VEGF antagonist is administered once every 12-weeks (ql2w), and the dosing interval is adjusted plus or minus 6-weeks depending a disease activity assessment conducted before a dose is administered.
- the patient if disease activity is observed prior to administering a ql2w dose, the patient will receive the ql2w dose as planned, and receive the next dose 6 weeks later, thus being placed on a q6w dosing regimen until disease activity is no longer observed.
- the dosing regimen When disease activity is no longer observed, the dosing regimen will be adjusted back to a ql2w schedule.
- the treatment interval may be extended by 6 weeks to a ql8w, and an additional 6 weeks thereafter to 24 weeks (q24w) interval. If disease activity is observed in a patient on a q24w dosing regimen, the treatment interval may be adjusted back to a ql8w or ql2w dosing regimen.
- the invention provides methods for treating ocular neovascular diseases, including PDR, in a mammal, the methods comprising administering multiple doses of a VEGF antagonist (e.g., anti-VEGF antibody or fragment thereof) to the mammal at various intervals for at least two years.
- a VEGF antagonist e.g., anti-VEGF antibody or fragment thereof
- the doses are administered at two or three 6- week intervals, the “loading phase,” followed by administering additional doses at 6-week, 7- week, 8-week, 9-week, 10-week, 11-week, 12-week, 13-week, 14-week, 15-week, 16-week, 17-week, 18-week, 19-week, 20-week, 21-week, 22-week, 23-week, or 24-week intervals during the “maintenance phase.”
- Disease activity assessments are conducted at least at every additional scheduled administration during the maintenance phase. When disease activity is identified as described herein, the treatment regimen can be changed from every 12 weeks to every 6 weeks (i.e., q6w).
- the invention provides specific criteria established by the inventors based on disease activity assessments to determine when an 6-week interval should be used and when a 12-week interval should be continued. In some cases, a patient might be on a 12- week interval regimen for some time, and then switch to a 6-week interval, and then switch back to the 12-week interval. Thus, patients may not stay on one interval regimen, and may go back and forth depending on assessments according to the criteria set forth herein.
- the treatment provider can extend treatment an additional one to 24 weeks. For example, if a patient is being treated every 12 weeks, the treatment provider may extend treatments to every 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 weeks; or if a patient is being treated every 6 weeks, the treatment provider may extend treatments to every 7, 8, 9, 10, 11, or 12 weeks. If disease activity is identified at any treatment visit, the treatment schedule is adjusted back to the 12 week or 6 week treatment regimen.
- disease activity refers to worsening of the ocular disease based on criteria provided herein.
- the invention provides a method for treating ocular diseases, particularly ocular neovascular diseases, more particularly PDR, comprising administering a VEGF antagonist to a mammal in need thereof according to the following schedule: a “loading phase” of 3 doses administered at 6-week (i.e., “q6” or “q6w”) intervals (e.g., day 0, week 6, week 12), and a “maintenance phase” of additional doses administered at 12-week (i.e., “ql2” or “ql2w”) intervals.
- the “maintenance phase” can be additional doses at 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 week intervals, and can be adjusted as described herein based on Disease Activity Assessments as described herein.
- the “loading phase” can be 2, 3, 4, 5, or 6 doses administered at q6w intervals. In other embodiments, the “loading phase can be 2, 3, 4, 5, or 6 doses administered once every four weeks (q4w intervals).
- a Disease Activity Assessment (“DAA”) is conducted at all scheduled treatment visits.
- DAA Disease Activity Assessment
- a patient is reassigned to q6w or ql2w dosing regimen based on the presence of disease activity as determined by a treatment provider, for example new or worsening retinal neovascularization, reperfusion of retinal neovascularization, increase in ETDRS DRSS score (such as an increase of 2 or more steps for DR disease activity), loss in peripheral visual field, and/or developing complications that impact visual acuity compared to any previous assessment.
- the patients can be currently on, for example, a 6-week or 12- week or 24-week interval regimen.
- the assessment can determine if a patient stays on the current interval or switches to a different interval.
- the VEGF antagonist used in a method of the invention is brolucizumab, and is administered at a dose of 1, 2, 3, 4, 5, or 6 mg (e.g., 6 mg/0.05 mL) as an intravitreal injection.
- An assessment as described herein preferably includes one or more of the following tests to assess activity of a VEGF antagonist (e.g., brolucizumab) on visual function, retinal structure and leakage:
- a VEGF antagonist e.g., brolucizumab
- OCT Optical Coherence Tomography
- FA standard or wide-field Fluorescein Angiography
- CFP/FA wide-field CFP/FA
- BCVA protocol refraction
- OCT Optical Coherence Tomography
- color fundus photography and fluorescein angiography can be assessed according to methods known to those of skill in the art.
- CST central subfield thickness
- RPE retinal pigment epithelium
- ILM internal limiting membrane
- SD-OCT spectral domain Optical Coherence Tomography
- Disease activity is assessed for clinically relevant improvements of BCVA, reduction of central subfield thickness (CST), reduction of fluid accumulation (e.g., retinal fluid) and/or decreased severity of diabetic retinopathy.
- CST central subfield thickness
- fluid accumulation e.g., retinal fluid
- severity of diabetic retinopathy e.g., diabetic retinopathy.
- a more frequent dosing interval is prescribed going forward.
- improvement of disease activity is observed, a less frequent dosing interval is prescribed.
- the dosing interval is maintained or extended (less frequent).
- Fluid measured in the eye can be intraretinal and/or subretinal fluid.
- Assessing status of disease activity can be based, for example, on dynamic changes (e.g., a decreased measurement compared with a previous assessment, such as the baseline assessment) in diabetic retinopathy severity (e.g. retinal neovascularization) based on ophthalmoscopy, standard or wide-field color fundus photography and/or standard or wide- field Fluorescein Angiography (FA) and/or OCT angiography, BCVA, ETDRS DRSS score based on 7-field stereo Color Fundus Photography (CFP), anatomical retinal evaluation by Optical Coherence Tomography (OCT), peripheral visual field assessed by perimetry and/or contrast sensitivity.
- dynamic changes e.g., a decreased measurement compared with a previous assessment, such as the baseline assessment
- diabetic retinopathy severity e.g. retinal neovascularization
- FA Fluorescein Angiography
- BCVA ETDRS DRSS score based on 7-field stereo Color Fundus Photography (CFP
- disease activity assessments can include both visual acuity and anatomical criteria.
- disease activity is assessed when the following are observed: new or worsening retinal neovascularization, reperfusion of retinal neovascularization, increase in ETDRS DRSS score (such as an increase of 2 or more steps for DR disease activity), loss in peripheral visual field, and/or developing complications that impact visual acuity compared to any previous assessment.
- assessments of disease activity to establish the patient’s disease status occurs at baseline (Week 0; first treatment).
- the assessment of the disease activity (DAA) during treatment regimens is at the discretion of the person making the assessment (e.g., the treatment provider), and is based on changes in vision and anatomical and morphological and clinical parameters with reference to the patients’ baseline disease status (at Week 0).
- the VEGF antagonist is administered on an as needed basis, i.e., pro re nata (PRN), at the discretion of a treatment provider (e.g., a physician or other qualified medical professional) based on visual and/or anatomical outcomes to determine disease activity.
- a treatment provider e.g., a physician or other qualified medical professional
- a VEGF antagonist used in a method of the invention is an anti-VEGF antibody, particularly anti-VEGF antibodies described in WO 2009/155724, the entire contents of which are hereby incorporated by reference.
- an anti-VEGF antibody used in a method of the invention comprises a variable heavy chain having the sequence as set forth in SEQ ID NO: 1 and a variable light chain having the sequence as set forth in SEQ ID NO: 2.
- VH SEQ ID NO. 1
- VL SEQ ID NO. 2
- the anti-VEGF antibody used in a method of the invention comprises the sequence as set forth in SEQ ID NO: 3.
- EIVMTQSPSTLSASVGDRVIITCQASElIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGA EFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVES
- the anti-VEGF antibody used in a method of the invention is brolucizumab (which comprises the sequence of SEQ ID NO: 3).
- the sequence of brolucizumab is set forth in SEQ ID NO: 4.
- a methionine derived from the start codon in an expression vector is present in the final protein in cases where it has not been cleaved posttranslationally as follows.
- an anti-VEGF antibody used in a method of the invention comprises three light chain CDRs (CDRLl, CDRL2, and CDRL3) and three heavy chain CDRs (CDRH1, a CDRH2, a CDRH3) as follows:
- CDRL1 QASEIIHSWLA SEQ ID NO: 5
- Brolucizumab is a humanized single-chain Fv (scFv) antibody fragment inhibitor of VEGF with a molecular weight of ⁇ 26 kDa. It is an inhibitor of VEGF-A and works by binding to the receptor binding site of the VEGF-A molecule, thereby preventing the interaction of VEGF-A with its receptors VEGFR1 and VEGFR2 on the surface of endothelial cells. Increased levels of signaling through the VEGF pathway are associated with pathologic ocular angiogenesis and retinal edema. Inhibition of the VEGF pathway has been shown to inhibit the growth of neovascular lesions and resolve retinal edema in patients with nAMD. Pharmaceutical Preparations
- the methods of the invention comprise the use of pharmaceutical formulations comprising anti-VEGF antibodies.
- pharmaceutical formulation refers to preparations which are in such form as to permit the biological activity of the antibody or antibody derivative to be unequivocally effective, and which contain no additional components which are toxic to the subjects to which the formulation would be administered.
- “Pharmaceutically acceptable” excipients are those which can reasonably be administered to a subject mammal to provide an effective dose of the active ingredient employed.
- a “stable" formulation is one in which a therapeutic agent, e.g. an anti-VEGF antibody or antibody derivative thereof essentially retains its physical stability and/or chemical stability and/or biological activity upon storage.
- a therapeutic agent e.g. an anti-VEGF antibody or antibody derivative thereof essentially retains its physical stability and/or chemical stability and/or biological activity upon storage.
- Various analytical techniques for measuring protein stability are available in the art and are reviewed in Peptide and Protein Drug Delivery, 247- 301, Vincent Lee Ed., Marcel Dekker, Inc., New York, N.Y., Pubs. (1991) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993), for example. Stability can be measured at a selected temperature for a selected time period.
- the formulation is stable at room temperature (about 30° C) or at 40° C for at least 1 week and/or stable at about 2-8° C for at least 3 months to 2 years.
- the formulation is preferably stable following freezing (to, e.g., -70° C) and thawing of the formulation.
- An antibody or antibody derivative "retains its physical stability" in a pharmaceutical formulation if it meets the defined release specifications for aggregation, degradation, precipitation and/or denaturation upon visual examination of color and/or clarity, or as measured by UV light scattering or by size exclusion chromatography, or other suitable art recognized methods.
- An antibody or antibody derivative "retains its chemical stability" in a pharmaceutical formulation, if the chemical stability at a given time is such that the protein is considered to still retain its biological activity as defined below.
- Chemical stability can be assessed by detecting and quantifying chemically altered forms of the protein.
- Chemical alteration may involve size modification (e.g. clipping) which can be evaluated using size exclusion chromatography, SDS-PAGE and/or matrix-assisted laser desorption ionization/time-of-flight mass spectrometry (MALDI/TOF MS), for example.
- Other types of chemical alteration include charge alteration (e.g. occurring as a result of deamidation) which can be evaluated by ion- exchange chromatography, for example.
- An antibody or antibody derivative "retains its biological activity" in a pharmaceutical formulation, if the biological activity of the antibody at a given time is within about 10% (within the errors of the assay) of the biological activity exhibited at the time the pharmaceutical formulation was prepared as determined in an antigen binding assay, for example.
- Other "biological activity” assays for antibodies are elaborated herein below.
- isotonic is meant that the formulation of interest has essentially the same osmotic pressure as human blood. Isotonic formulations will generally have an osmotic pressure from about 250 to 350 mOsm. Isotonicity can be measured using a vapor pressure or ice-freezing type osmometer, for example.
- a “polyol” is a substance with multiple hydroxyl groups, and includes sugars (reducing and non-reducing sugars), sugar alcohols and sugar acids. Preferred polyols herein have a molecular weight which is less than about 600 kD (e.g. in the range from about 120 to about 400 kD).
- a "reducing sugar” is one which contains a hemiacetal group that can reduce metal ions or react covalently with lysine and other amino groups in proteins and a "non-reducing sugar” is one which does not have these properties of a reducing sugar.
- reducing sugars are fructose, mannose, maltose, lactose, arabinose, xylose, ribose, rhamnose, galactose and glucose.
- Non-reducing sugars include sucrose, trehalose, sorbose, melezitose and raffmose.
- Mannitol, xylitol, erythritol, threitol, sorbitol and glycerol are examples of sugar alcohols.
- sugar acids these include L-gluconate and metallic salts thereof.
- the polyol is preferably one which does not crystallize at freezing temperatures (e.g.
- Non-reducing sugars such as sucrose and trehalose are the preferred polyols herein, with trehalose being preferred over sucrose, because of the superior solution stability of trehalose.
- buffer refers to a buffered solution that resists changes in pH by the action of its acid-base conjugate components.
- the buffer of this invention has a pH in the range from about 4.5 to about 8.0; preferably from about 5.5 to about 7.
- buffers that will control the pH in this range include acetate (e.g. sodium acetate), succinate (such as sodium succinate), gluconate, histidine, citrate and other organic acid buffers.
- the buffer is preferably not phosphate.
- a "therapeutically effective amount" of a therapeutic agent e.g.
- an anti-VEGF antibody or antibody derivative refers to an amount effective in the prevention or treatment of a disorder for the treatment of which the antibody or antibody derivative is effective. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question.
- a "preservative" is a compound which can be included in the formulation to essentially reduce bacterial action therein, thus facilitating the production of a multi-use formulation, for example.
- potential preservatives include octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride (a mixture of alkylbenzyldimethylammonium chlorides in which the alkyl groups are long-chain compounds), and benzethonium chloride.
- preservatives include aromatic alcohols such as phenol, butyl and benzyl alcohol, alkyl parabens such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m-cresol.
- aromatic alcohols such as phenol, butyl and benzyl alcohol
- alkyl parabens such as methyl or propyl paraben
- catechol resorcinol
- cyclohexanol 3-pentanol
- m-cresol m-cresol
- compositions used in present invention comprise a VEGF antagonist, preferably an anti-VEGF antibody (e.g., an anti-VEGF antibody comprising the variable light chain sequence of SEQ ID NO: 1 and the variable heavy chain sequence of SEQ ID NO: 2, such as brolucizumab), together with at least one physiologically acceptable carrier or excipient.
- an anti-VEGF antibody e.g., an anti-VEGF antibody comprising the variable light chain sequence of SEQ ID NO: 1 and the variable heavy chain sequence of SEQ ID NO: 2, such as brolucizumab
- compositions may comprise, for example, one or more of water, buffers (e.g., neutral buffered saline or phosphate buffered saline), ethanol, mineral oil, vegetable oil, dimethylsulfoxide, carbohydrates (e.g, glucose, mannose, sucrose or dextrans), mannitol, proteins, adjuvants, polypeptides or amino acids such as glycine, antioxidants, chelating agents such as EDTA or glutathione and/or preservatives.
- buffers e.g., neutral buffered saline or phosphate buffered saline
- ethanol e.g., mineral oil, vegetable oil, dimethylsulfoxide
- carbohydrates e.g, glucose, mannose, sucrose or dextrans
- mannitol e.glycine
- proteins e.glycine
- adjuvants e.glycine
- polypeptides or amino acids such as glycine
- antioxidants e.
- a carrier is a substance that may be associated with an antibody or antibody derivative prior to administration to a patient, often for the purpose of controlling stability or bioavailability of the compound.
- Carriers for use within such formulations are generally biocompatible, and may also be biodegradable.
- Carriers include, for example, monovalent or multivalent molecules such as serum albumin (e.g, human or bovine), egg albumin, peptides, polylysine and polysaccharides such as aminodextran and polyamidoamines.
- Carriers also include solid support materials such as beads and microparticles comprising, for example, polylactate polyglycolate, poly(lactide-co-glycolide), polyacrylate, latex, starch, cellulose or dextran.
- a carrier may bear the compounds in a variety of ways, including covalent bonding (either directly or via a linker group), noncovalent interaction or admixture.
- compositions may be formulated for any appropriate manner of administration, including, for example, topical, intraocular, oral, nasal, rectal or parenteral administration.
- compositions in a form suitable for intraocular injection such as intravitreal injection, are preferred.
- Other forms include, for example, pills, tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsion, hard or soft capsules, or syrups or elixirs.
- compositions provided herein may be formulated as a lyophilizate.
- parenteral as used herein includes subcutaneous, intradermal, intravascular (e.g intravenous), intramuscular, spinal, intracranial, intrathecal and intraperitoneal injection, as well as any similar injection or infusion technique.
- the pharmaceutical composition may be prepared as a sterile injectible aqueous or oleaginous suspension in which the active agent (i.e. VEGF antagonist), depending on the vehicle and concentration used, is either suspended or dissolved in the vehicle.
- the active agent i.e. VEGF antagonist
- Such a composition may be formulated according to the known art using suitable dispersing, wetting agents and/or suspending agents such as those mentioned above.
- suitable dispersing, wetting agents and/or suspending agents such as those mentioned above.
- the acceptable vehicles and solvents that may be employed are water, 1,3-butanediol, Ringer's solution and isotonic sodium chloride solution.
- sterile, fixed oils may be employed as a solvent or suspending medium.
- any bland fixed oil may be employed, including synthetic mono- or diglycerides.
- fatty acids such as oleic acid may be used in the preparation of injectible compositions, and adjuvants such as local anesthetics, preservatives and
- a dose used in a method of the invention is based on the specific disease or condition being treated.
- the term “therapeutically effective dose” is defined as an amount sufficient to achieve or at least partially achieve the desired effect (e.g. the partial or complete regression of retinal neovascularization, a change of BCVA > 1, > 2, > 3, > 4 or > 5 letters, or a DRSS score ⁇ 61).
- a therapeutically effective dose is sufficient if it can produce even an incremental change in the symptoms or conditions associated with the disease.
- the therapeutically effective dose does not have to completely cure the disease or completely eliminate symptoms.
- the therapeutically effective dose can at least partially arrest the disease and/or its complications in a patient already suffering from the disease. Amounts effective for this use will depend upon the severity of the disorder being treated and the general state of the patient’s own immune system.
- the dose amount can be readily determined using known dosage adjustment techniques by a physician having ordinary skill in treatment of the disease or condition.
- the therapeutically effective amount of a VEGF antagonist used in a method of the invention is determined by taking into account the desired dose volumes and mode(s) of administration, for example.
- therapeutically effective compositions are administered in a dosage ranging from 0.001 mg/ml to about 200 mg/ml per dose.
- a dosage used in a method of the invention is about 60 mg/ml to about 120 mg/ml (for example, a dosage is 60, 70, 80, 90, 100, 110, or 120 mg/ml).
- the dosage of an anti-VEGF antibody used in a method of the invention is 60 mg/ml or 120 mg/ml.
- a dose is administered directly to an eye of a patient.
- a dose per eye is at least about 0.5 mg up to about 6 mg.
- Preferred doses per eye include about 0.5 mg, 0.6 mg, 0.7 mg, 0.8 mg, 0.9 mg, 1.0 mg, 1.2 mg, 1.4 mg, 1.6 mg, 1.8 mg, 2.0 mg, 2.5 mg, 3.0 mg, 3.5 mg, 4.0 mg, 4.5 mg, 5.0 mg, 5.5 mg, and 6.0 mg.
- a dose per eye is at least about 3 mg up to about 6 mg, in particular about 3 mg or about 6 mg.
- Doses can be administered in various volumes suitable for ophthalmic administration, such as 50 pi or 100 m ⁇ , for example, including 3 mg/50 m ⁇ or 6 mg/50 m ⁇ . Smaller volumes can also be used, including 20 m ⁇ or less, for example about 20 m ⁇ , about 10 m ⁇ , or about 8.0 m ⁇ . In certain embodiments, a dose of 2.4 mg/20 m ⁇ , 1.2 mg/10 m ⁇ or 1 mg/8.0 m ⁇ (e.g., 1 mg/8.3 m ⁇ ) is delivered to an eye of a patient for treating or ameliorating one or more of the diseases and disorders described above. Delivery can be, for example, by intravitreal injection.
- the term “about” includes and describes the value or parameter per se.
- “about x” includes and describes "x" per se.
- the term “about” when used in association with a measurement, or used to modify a value, a unit, a constant, or a range of values refers to variations of ⁇ 1-10% in addition to including the value or parameter per se.
- the term “about” when used in association with a measurement, or used to modify a value, a unit, a constant, or a range of values refers to variations of ⁇ 1, ⁇ 2, ⁇ 3, ⁇ 4, ⁇ 5, ⁇ 6, ⁇ 7, ⁇ 8, ⁇ 9, or ⁇ 10%.
- an aqueous formulation of an anti-VEGF antibody used in a method of the invention is prepared in a pH-buffered solution.
- the buffer of such aqueous formulation has a pH in the range from about 4.5 to about 8.0, preferably from about 5.5 to about 7.0, most preferably about 6.75.
- the pH of an aqueous pharmaceutical composition of the invention is about 7.0-7.5, or about 7.0-7.4, about 7.0-7.3, about 7.0-7.2, about 7.1-7.6, about 7.2-7.6, about 7.3-7.6 or about 7.4-7.6.
- an aqueous pharmaceutical composition of the invention has a pH of about 7.0, about 7.1, about 7.2, about 7.3, about 7.4, about 7.5 or about 7.6.
- the aqueous pharmaceutical composition has a pH of >7.0
- the aqueous pharmaceutical composition has a pH of about 7.2.
- the aqueous pharmaceutical composition has a pH of about 7.4.
- the aqueous pharmaceutical composition has a pH of about 7.6.
- buffers that will control the pH within this range include acetate ( e.g . sodium acetate), succinate (such as sodium succinate), gluconate, histidine, citrate and other organic acid buffers.
- the buffer concentration can be from about 1 mM to about 50 mM, preferably from about 5 mM to about 30 mM, depending, for example, on the buffer and the desired isotonicity of the formulation.
- a polyol which acts as a tonicifier, may be used to stabilize an antibody in an aqueous formulation.
- the polyol is a non-reducing sugar, such as sucrose or trehalose.
- the polyol is added to the formulation in an amount that may vary with respect to the desired isotonicity of the formulation.
- the aqueous formulation is isotonic, in which case suitable concentrations of the polyol in the formulation are in the range from about 1% to about 15% w/v, preferably in the range from about 2% to about 10% w/v, for example.
- hypertonic or hypotonic formulations may also be suitable.
- the amount of polyol added may also alter with respect to the molecular weight of the polyol. For example, a lower amount of a monosaccharide (e.g. mannitol) may be added, compared to a disaccharide (such as trehalose).
- a monosaccharide e.g. mannitol
- a disaccharide such as trehalose
- a surfactant is also added to an aqueous antibody formulation.
- exemplary surfactants include nonionic surfactants such as polysorbates (e.g. polysorbates 20, 80 etc) or poloxamers (e.g. poloxamer 188).
- the amount of surfactant added is such that it reduces aggregation of the formulated antibody/antibody derivative and/or minimizes the formation of particulates in the formulation and/or reduces adsorption.
- the surfactant may be present in the formulation in an amount from about 0.001% to about 0.5%, preferably from about 0.005% to about 0.2% and most preferably from about 0.01% to about 0.1%.
- an aqueous antibody formulation used in a method of the invention is essentially free of one or more preservatives, such as benzyl alcohol, phenol, m-cresol, chlorobutanol and benzethonium Cl.
- a preservative may be included in the formulation, particularly where the formulation is a multidose formulation.
- the concentration of preservative may be in the range from about 0.1% to about 2%, most preferably from about 0.5% to about 1%.
- One or more other pharmaceutically acceptable carriers, excipients or stabilizers such as those described in Remington's Pharmaceutical Sciences 21st edition, Osol, A. Ed. (2006) may be included in the formulation provided that they do not adversely affect the desired characteristics of the formulation.
- Acceptable carriers, excipients or stabilizers are non-toxic to recipients at the dosages and concentrations employed and include: additional buffering agents, co-solvents, antioxidants including ascorbic acid and methionine, chelating agents such as EDTA, metal complexes (e.g. Zn-protein complexes), biodegradable polymers such as polyesters, and/or salt-forming counterions such as sodium.
- Formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes, prior to, or following, preparation of the formulation.
- a VEGF antagonist is administered to an eye of a mammal in need of treatment in accordance with known methods for ocular delivery.
- the mammal is a human
- the VEGF antagonist is an anti-VEGF antibody (preferably brolucizumab)
- the antibody is administered directly to an eye.
- Administration to a patient can be accomplished, for example, by intravitreal injection.
- the VEGF antagonist in a method of the invention can be administered as the sole treatment or in conjunction with other drugs or therapies useful in treating the condition in question.
- a preferred formulation for brolucizumab for intravitreal injection comprises about 4.5% to 11% (w/v) sucrose, 5-20 mM sodium citrate, and 0.001% to 0.05% (w/v) polysorbate 80, wherein the pH of the formulation is about 7.0 to about 7.4.
- One such formulation comprises 5.9% (w/v) sucrose, 10 mM sodium citrate, 0.02% (w/v) polysorbate 80, pH of 7.2, and 6 mg of brolucizumab.
- Another such formulation comprises 6.4% (w/v) or 5.8% sucrose, 12 mM or 10 mM sodium citrate, 0.02% (w/v) polysorbate 80, pH of 7.2, and 3 mg of brolucizumab.
- Preferred concentrations of brolucizumab are about 120 mg/ml and about 60 mg/ml. Doses can be delivered, for example as 6 mg/50 pL and 3 mg/50 pL concentrations.
- the invention also provides a kit, comprising: a drug container (e.g., a vial or a pre filled syringe) comprising a VEGF antagonist drug (e.g., brolucizumab), and instructions for using the drug for treating a patient diagnosed with PDR.
- a drug container e.g., a vial or a pre filled syringe
- a VEGF antagonist drug e.g., brolucizumab
- the instructions indicate the drug is to be administered to the patient’s eye in need thereof as follows: 3 doses of about 6 mg of VEGF antagonist administered at 6-week intervals followed by additional about 6 mg doses of the VEGF antagonist every 12 weeks.
- the instructions indicate the first 3 doses are administered in a “loading phase” and the additional doses are administered during a “maintenance phase.”
- the kit comprises one or more 6 mg doses of brolucizumab, each dose provided in a single use vial containing sufficient brolucizumab to deliver a 6 mg dose when administering a volume of 0.05 mL or in a prefilled syringe containing 6 mg of brolucizumab.
- the instructions further indicate a treatment provider (e.g., a physician or other qualified medical professional) can adjust the dosing interval during the maintenance phase from once every 12 weeks to once every 6 weeks if disease activity is observed in the treated eye.
- a treatment provider e.g., a physician or other qualified medical professional
- the instructions further indicate a treatment provider (e.g., a physician or other qualified medical professional) can extend the dosing interval during the maintenance phase from once every 12 weeks to once every 24 weeks, 6 weeks at a time, if no disease activity is observed in the treated eye.
- a treatment provider e.g., a physician or other qualified medical professional
- the instructions further indicate the VEGF antagonist is administered on an as needed basis, i.e., pro re nata (PRN), at the discretion of a treatment provider (e.g., a physician or other qualified medical professional) based on visual and/or anatomical outcomes to determine disease activity during the maintenance phase.
- a treatment provider e.g., a physician or other qualified medical professional
- the study is a 96-week, two-arm, randomized, single-masked, multi-center, active- controlled, non-inferiority study in patients with proliferative diabetic retinopathy (PDR).
- PDR proliferative diabetic retinopathy
- PRP initial treatment in 1-3 sessions up to Week 12, followed with additional PRP treatment as needed up to Week 90.
- Visits will occur every 6 weeks throughout the study, regardless of treatment or not.
- treatment with brolucizumab occurs every 6 weeks for three (3) consecutive injections (Day 0 (Baseline), Week 6, and Week 12).
- the treatment interval during the maintenance phase is as follows:
- the additional visits e.g. Week 30
- additional injections may be administered at these visits at the treatment provider’s discretion only if disease worsens, e.g. new or expanding retinal neovascularization compared to the previous visit. No injection should be administered if retinal neovascularization has been stable.
- the treatment interval may be extended by 6 weeks at a time, up to 24 weeks, at the treatment provider’s discretion if, based on the treatment provider’s assessment of disease activity, there is disease stability or regression, e.g. regressed or stabilized retinal neovascularization from the previous injection visit.
- the treatment provider may elect to extend the treatment interval from 12 weeks to 18 weeks and treat the study eye at Week 66, if the disease did not worsen between Week 36 and Week 48 and there was no injection at Week 42.
- the treatment provider may elect to further extend the treatment interval from 18 weeks to 24 weeks, and treat the study eye at Week 90, if the disease did not worsen between Week 48 and Week 66, and there were no injections at Week 54 and Week 60.
- the treatment provider may opt to revert to ql2w injections if, in the treatment provider’s opinion based on disease activity assessment, the patient needs more frequent treatment.
- Brolucizumab will be provided either in a single use, sterile glass vial containing sufficient brolucizumab to deliver a 6 mg dose when administering a volume of 0.05 mL or in a prefilled syringe (PFS).
- PFS prefilled syringe
- Brolucizumab is administered in the diseased eye on day 0 (Baseline). When assessments and treatments take place on the same day, treatment must occur after completion of the efficacy assessments described below.
- DM diabetes mellitus
- BCVA 34 ETDRS letters (Snellen equivalent 20/200).
- Uncontrolled blood pressure defined as a systolic value > 180 mmHg or diastolic value > 100 mmHg at screening or baseline. (In case there is an elevated blood pressure measurement, it should be repeated after 20 minutes. If the repeat measurement is elevated, then the patient is not eligible to be enrolled into the study).
- Systemic anti-VEGF therapy at any time.
- Systemic medications known to be toxic to the lens, retina or optic nerve e.g., deferoxamine, chloroquine/hydroxychloroquine, tamoxifen, phenothiazines and ethambutol
- deferoxamine e.g., deferoxamine, chloroquine/hydroxychloroquine, tamoxifen, phenothiazines and ethambutol
- Pregnant or nursing (lactating) women where pregnancy is defined as the state of a female after conception and until the termination of gestation, confirmed by a positive human chorionic gonadotropin (hCG) pregnancy test.
- hCG human chorionic gonadotropin
- Women of child-bearing potential defined as all women physiologically capable of becoming pregnant, unless they are using highly effective methods of contraception during the study drug administration and for 22 days after stopping the investigational medication.
- VA Visual acuity
- BCVA measurements will be taken in a sitting position using ETDRS-like visual acuity testing charts at an initial testing distance of 4 meters. The details of the refraction technique and VA testing, as well as training material, are provided in the applicable manual. Certification of the assessment procedures and assessors will occur prior to any evaluation of study subjects. Color fundus photography and fluorescein angiography
- Seven-Field stereo Color Fundus Photography will be performed in both eyes at Baseline, Week 54, and Week 96 and in the treated eye at Week 18 and Week 72.
- WFCFP Wide-Field Color Fundus Photography
- Standard or Wide-Field Fluorescein Angiography will be performed in the treated eye at the Baseline, Week 54, Week 96 visits and in the fellow eye at the Baseline visit. FA may be performed at other visits, at the treatment provider’s discretion.
- the FA camera model used for an individual subject should not change for the duration of the treatment.
- FA images from a previous routine evaluation may be used as long as FA is performed within 3 days of the Baseline visit.
- the treatment provider will evaluate the images according to their standard of clinical practice and may use any of the CFP, WFCFP, and FA imaging findings to inform his/her decision for treatment.
- SD-OCT Optical coherence tomography Spectral Domain Optical Coherence Tomography
- Treatment providers will evaluate the SD-OCT images to assess the status of macular edema.
- SD-OCT machines can be used (i.e. no time-domain nor swept-source OCT).
- the SD-OCT model used for an individual subject should not change for the duration of the treatment.
- CSFT Central sub-field thickness
- OCT angiography may be performed at each visit in the treated eye. If OCT angiography was not assessed at Baseline, then it should not be introduced at later visits. OCT angiography may be used by the treatment provider to complement the evaluation of retinal neovascularization as part of the disease activity assessment.
- the treatment providers will evaluate the OCT images according to their clinical practice.
- Visual field examination in the treated eye will be performed at Baseline, Week 18, Week 54, Week 72, and Week 96 using automated perimetry. Visual field examination should be performed before treatment, if treatment is delivered at the visit. Accepted test methods are Humphrey 24-2,30-2, and 60-4 with full-threshold and Swedish Interactive Thresholding Algorithm (SITA) standard strategies.
- SITA Swedish Interactive Thresholding Algorithm
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Ophthalmology & Optometry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Vascular Medicine (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Endocrinology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Urology & Nephrology (AREA)
- Dermatology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2020347575A AU2020347575A1 (en) | 2019-09-13 | 2020-09-11 | Methods for treating ocular diseases |
| JP2022515650A JP7828274B2 (ja) | 2019-09-13 | 2020-09-11 | 眼疾患を治療するための方法 |
| MX2022003101A MX2022003101A (es) | 2019-09-13 | 2020-09-11 | Metodos de tratamiento de enfermedades oculares. |
| EP20772435.2A EP4028128A1 (en) | 2019-09-13 | 2020-09-11 | Methods for treating ocular diseases |
| US17/641,799 US20240052024A1 (en) | 2019-09-13 | 2020-09-11 | Methods for treating ocular diseases |
| CN202080063654.2A CN114375201A (zh) | 2019-09-13 | 2020-09-11 | 治疗眼部疾病的方法 |
| KR1020227007553A KR20220062279A (ko) | 2019-09-13 | 2020-09-11 | 안질환의 치료 방법 |
| CA3149706A CA3149706A1 (en) | 2019-09-13 | 2020-09-11 | Methods for treating ocular diseases |
| IL289436A IL289436A (en) | 2019-09-13 | 2021-12-27 | Methods for treating ocular diseases |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962899892P | 2019-09-13 | 2019-09-13 | |
| US62/899,892 | 2019-09-13 | ||
| US202062971405P | 2020-02-07 | 2020-02-07 | |
| US62/971,405 | 2020-02-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2021048806A1 true WO2021048806A1 (en) | 2021-03-18 |
Family
ID=72521675
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2020/058459 Ceased WO2021048806A1 (en) | 2019-09-13 | 2020-09-11 | Methods for treating ocular diseases |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20240052024A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP4028128A1 (cg-RX-API-DMAC7.html) |
| JP (1) | JP7828274B2 (cg-RX-API-DMAC7.html) |
| KR (1) | KR20220062279A (cg-RX-API-DMAC7.html) |
| CN (1) | CN114375201A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2020347575A1 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3149706A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL289436A (cg-RX-API-DMAC7.html) |
| MX (1) | MX2022003101A (cg-RX-API-DMAC7.html) |
| TW (1) | TW202116802A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2021048806A1 (cg-RX-API-DMAC7.html) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023175549A1 (en) * | 2022-03-17 | 2023-09-21 | Novartis Ag | Methods for treating neovascular age-related macular degeneration |
Families Citing this family (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3886946A1 (en) | 2019-06-05 | 2021-10-06 | Regeneron Pharmaceuticals, Inc. | Devices and methods for precision dose delivery |
| USD1120314S1 (en) | 2022-11-30 | 2026-03-24 | Regeneron Pharmaceuticals, Inc. | Dose delivery device |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006047325A1 (en) | 2004-10-21 | 2006-05-04 | Genentech, Inc. | Method for treating intraocular neovascular diseases |
| WO2009155724A2 (en) | 2008-06-25 | 2009-12-30 | Esbatech, An Alcon Biomedical Research Unit Llc | Stable and soluble antibodies inhibiting vegf |
-
2020
- 2020-09-11 TW TW109131282A patent/TW202116802A/zh unknown
- 2020-09-11 JP JP2022515650A patent/JP7828274B2/ja active Active
- 2020-09-11 MX MX2022003101A patent/MX2022003101A/es unknown
- 2020-09-11 CN CN202080063654.2A patent/CN114375201A/zh active Pending
- 2020-09-11 AU AU2020347575A patent/AU2020347575A1/en active Pending
- 2020-09-11 WO PCT/IB2020/058459 patent/WO2021048806A1/en not_active Ceased
- 2020-09-11 EP EP20772435.2A patent/EP4028128A1/en active Pending
- 2020-09-11 KR KR1020227007553A patent/KR20220062279A/ko active Pending
- 2020-09-11 CA CA3149706A patent/CA3149706A1/en active Pending
- 2020-09-11 US US17/641,799 patent/US20240052024A1/en active Pending
-
2021
- 2021-12-27 IL IL289436A patent/IL289436A/en unknown
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2006047325A1 (en) | 2004-10-21 | 2006-05-04 | Genentech, Inc. | Method for treating intraocular neovascular diseases |
| WO2009155724A2 (en) | 2008-06-25 | 2009-12-30 | Esbatech, An Alcon Biomedical Research Unit Llc | Stable and soluble antibodies inhibiting vegf |
Non-Patent Citations (20)
| Title |
|---|
| "Oxford Dictionary of Biochemistry and Molecular Biology", 2004, OXFORD UNIVERSITY PRESS |
| "Peptide and Protein Drug Delivery", 1991, MARCEL DEKKER, INC., pages: 247 - 301 |
| "Remington's Pharmaceutical Sciences", 2006 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| DEVRIES ET AL., SCIENCE, vol. 255, 1992, pages 989 |
| DUGEL PRAVIN U ET AL: "HAWK and HARRIER: Phase 3, Multicenter, Randomized, Double-Masked Trials of Brolucizumab for Neovascular Age-Related Macular Degeneration", OPHTHALMOLOGY, ELSEVIER, AMSTERDAM, NL, vol. 127, no. 1, 12 April 2019 (2019-04-12), pages 72 - 84, XP085965913, ISSN: 0161-6420, [retrieved on 20190412], DOI: 10.1016/J.OPHTHA.2019.04.017 * |
| HOUCK ET AL., MOL. ENDOCRIN., vol. 5, 1991, pages 1806 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| JONES, A., ADV. DRUG DELIVERY REV., vol. 10, 1993, pages 29 - 90 |
| LEUNG ET AL., SCIENCE, vol. 246, 1989, pages 1306 |
| MATTHEWS ET AL., PROC. NAT. ACAD. SCI., vol. 88, 1991, pages 9026 |
| NICOLAS A. YANNUZZI ET AL: "Brolucizumab: evidence to date in the treatment of neovascular age-related macular degeneration", CLINICAL OPHTHALMOLOGY, vol. Volume 13, 24 July 2019 (2019-07-24), NZ, pages 1323 - 1329, XP055759833, ISSN: 1177-5467, DOI: 10.2147/OPTH.S184706 * |
| RIORDAN-EVA, EYE (LOND, vol. 18, 2004, pages 1161 - 8 |
| SHIBUYA ET AL., ONCOGENE, vol. 5, 1990, pages 519 |
| SINGH RISHI P ET AL: "Advances in the treatment of diabetic retinopathy", JOURNAL OF DIABETES AND ITS COMPLICATIONS, ELSEVIER SCIENCE, NEW YORK, NY, US, vol. 33, no. 12, 15 August 2019 (2019-08-15), XP085919675, ISSN: 1056-8727, [retrieved on 20190815], DOI: 10.1016/J.JDIACOMP.2019.107417 * |
| TERMAN ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 187, 1992, pages 1579 |
| TERMAN ET AL., ONCOGENE, vol. 6, 1991, pages 1677 |
| VICTOR GONZALEZ: "The Impact on Vision and Regression of Retinal Neovascularization of Anti-VEGF Induction in Combination with Quarterly Anti-VEGF Maintenance or Selective PRP versus Standard PRP", INVESTIGATIVE OPHTHALMOLOGY & VISUAL SCIENCE ARVO MEETING ABSTRACT, 1 June 2013 (2013-06-01), XP055759805, Retrieved from the Internet <URL:https://iovs.arvojournals.org/article.aspx?articleid=2149474> [retrieved on 20201214] * |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| YUE ZHAO ET AL: "The role of anti-vascular endothelial growth factor (anti-VEGF) in the management of proliferative diabetic retinopathy", DRUGS IN CONTEXT, vol. 7, 13 August 2018 (2018-08-13), pages 1 - 10, XP055759835, DOI: 10.7573/dic.212532 * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023175549A1 (en) * | 2022-03-17 | 2023-09-21 | Novartis Ag | Methods for treating neovascular age-related macular degeneration |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2022547537A (ja) | 2022-11-14 |
| CA3149706A1 (en) | 2021-03-18 |
| TW202116802A (zh) | 2021-05-01 |
| JP7828274B2 (ja) | 2026-03-11 |
| AU2020347575A1 (en) | 2022-03-17 |
| US20240052024A1 (en) | 2024-02-15 |
| CN114375201A (zh) | 2022-04-19 |
| EP4028128A1 (en) | 2022-07-20 |
| MX2022003101A (es) | 2022-04-06 |
| IL289436A (en) | 2022-02-01 |
| KR20220062279A (ko) | 2022-05-16 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2021286278C1 (en) | Methods for treating ocular diseases | |
| US20260098085A1 (en) | Methods for treating age-related macular degeneration | |
| BR112020010659A2 (pt) | uso de um antagonista do vegf para tratar disfunções oftalmológicas angiogênicas | |
| JP7828274B2 (ja) | 眼疾患を治療するための方法 | |
| WO2022201084A1 (en) | Methods for treating ocular diseases | |
| CN116710137A (zh) | 用于在治疗眼部疾病的方法中使用的vegf拮抗剂 | |
| WO2023175549A1 (en) | Methods for treating neovascular age-related macular degeneration | |
| US20230416351A1 (en) | Vegf antagonist for use in methods for treating ocular diseases | |
| JP2026072102A (ja) | 眼疾患を治療するための方法 | |
| RU2776850C2 (ru) | Способы лечения глазных заболеваний | |
| RU2771900C2 (ru) | Способ лечения болезней глаз |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20772435 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3149706 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2022515650 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 17641799 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020347575 Country of ref document: AU Date of ref document: 20200911 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2022108313 Country of ref document: RU |
|
| ENP | Entry into the national phase |
Ref document number: 2020772435 Country of ref document: EP Effective date: 20220413 |