WO2020247974A1 - Methods and compositions for treating cancer with collagen binding drug carriers - Google Patents

Methods and compositions for treating cancer with collagen binding drug carriers Download PDF

Info

Publication number
WO2020247974A1
WO2020247974A1 PCT/US2020/070113 US2020070113W WO2020247974A1 WO 2020247974 A1 WO2020247974 A1 WO 2020247974A1 US 2020070113 W US2020070113 W US 2020070113W WO 2020247974 A1 WO2020247974 A1 WO 2020247974A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
tumor
dox
cancer
cbd
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/070113
Other languages
English (en)
French (fr)
Inventor
Jeffrey A. Hubbell
Jun Ishihara
Koichi Sasaki
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Chicago
Original Assignee
University of Chicago
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2021571671A priority Critical patent/JP7680375B2/ja
Priority to CN202080055104.6A priority patent/CN114173822B/zh
Priority to EP20818032.3A priority patent/EP3976111A4/en
Priority to BR112021024438A priority patent/BR112021024438A2/pt
Priority to AU2020289485A priority patent/AU2020289485A1/en
Priority to MX2021014932A priority patent/MX2021014932A/es
Application filed by University of Chicago filed Critical University of Chicago
Priority to CA3144535A priority patent/CA3144535A1/en
Priority to US17/596,118 priority patent/US20220298225A1/en
Publication of WO2020247974A1 publication Critical patent/WO2020247974A1/en
Anticipated expiration legal-status Critical
Priority to JP2025077691A priority patent/JP2025121986A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/745Blood coagulation or fibrinolysis factors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/36Blood coagulation or fibrinolysis factors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/62Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
    • A61K47/64Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
    • A61K47/643Albumins, e.g. HSA, BSA, ovalbumin or a Keyhole Limpet Hemocyanin [KHL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/20Fusion polypeptide containing a tag with affinity for a non-protein ligand
    • C07K2319/21Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin

Definitions

  • the invention generally relates to the field of medicine. More particularly, it concerns compositions and methods involving nucleotide constructs, proteins, and drug carriers for treating cancers.
  • SA Serum albumin
  • Doxorubicin is a small molecule anticancer drug that is approved for treating a broad spectrum of cancers by the US Food and Drug Administration (FDA). Dox internalizes within cells via passive transmembrane diffusion and interferes with DNA functions, leading to death of proliferating cells. Although Dox treatment prolongs survival of some populations of patients, anti-tumor efficacy is not dramatic partially due to acquired drug resistance. The poor therapeutic index of Dox also limits its therapeutic use. Indeed, considerable toxicity of Dox has been reported in the clinic, including bone marrow suppression, excessive inflammation, and cardiotoxicity. Dox is often used in combination with other chemotherapeutic agents.
  • aspects of the disclosure relate to a polypeptide comprising an albumin polypeptide or IgG Fc domain polypeptide operatively linked to a collagen binding domain. Further aspects relate to a composition comprising a polypeptide, nucleic acid, or cell of the disclosure. Further aspects relate to a nucleic acid encoding for a polypeptide of the disclosure. Yet further aspects relate to a cell comprising a nucleic acid or polypeptide of the disclosure.
  • Further aspects of the disclosure relate to a method for making a polypeptide comprising expressing a nucleic acid of the disclosure in a cell and isolated the expressed polypeptide.
  • Further aspects relate to a method for treating cancer comprising administering a polypeptide, nucleic acid, or composition of the disclosure. Further aspects relate to a method for reducing non-specific toxicity of a treatment comprising a cytotoxic agent in a subject, the method comprising administering the polypeptide or composition of the disclosure to the subject.
  • non-specific toxicity refers to toxicity or cell death of non-cancerous cells.
  • Further aspects relate to a method for increasing the accumulation of a cytotoxic agent in a tumor in a subject, the method comprising administering a polypeptide, nucleic acid, or composition of the disclosure to the subject.
  • Further aspects relate to a method for targeted delivery of a cytotoxic agent to the tumor vasculature, the method comprising administering a polypeptide or composition of the disclosure to the subject.
  • Yet further aspects relate to a method of treating a tumor or a method of treating a tumor in a subject, the method comprising administering a polypeptide or composition of the disclosure to the tumor or subject.
  • the method is for inhibiting tumor growth or tumor progression. The inhibition may be at least, at most, or about 10, 20, 30, 40, 50, 60, 70, 80, 90, 95, 99, or 100% (or any derivable range therein).
  • the polypeptide is operatively linked to a cytotoxic agent.
  • the term“operatively linked” refers to a covalent or non-covalent attachment.
  • the attachment is covalent.
  • the attachment is non- covalent.
  • the polypeptide is covalently linked to the cytotoxic agent.
  • the peptide is non-covalently linked to the cytotoxic agent.
  • the polypeptide is linked to the cytotoxic agent through a cleavable linker.
  • the cleavable linker comprises a pH-cleavable linker.
  • the linker comprises a hydrazone linker.
  • the linker is cleaved at a pH of less than 7.4. In some embodiments, the linker is cleaved at an acidic pH. In some embodiments, optimal cleavage of the linker is at a pH of 4.5, 5, 5.5, 6, or 6.5 (or any range therein). Optimal cleavage refers to the pH in which at least 75, 80, 85, 90, 95, or 99% of cleavage occurs in solution or in vitro at a time period of less than 6, 5, 4, 3, 2, 1, 0.5, or 0.25 hours (or any derivable range therein). In some embodiments, the polypeptide is linked to the cytotoxic agent and/or the collagen binding polypeptide through a bifunctional linker.
  • the cytotoxic agent comprises doxorubicin. In some embodiments, the cytotoxic agent comprises a derivative of doxorubicin. In some embodiments, the cytotoxic agent comprises aldoxorubicin. In some embodiments, the cytotoxic agent is a cytotoxic agent described herein. In some embodiments, the cytotoxic agent is conjugated to the polypeptide prior to administration of the polypeptide. In some embodiments, in situ conjugation of the cytotoxic agent is excluded.
  • the polypeptide is covalently linked to the collagen binding domain through a peptide bond.
  • the polypeptide comprises a collagen binding domain from decorin or von Willebrand factor (vWF).
  • the collagen binding domain comprises a polypeptide with at least 80% identity to SEQ ID NO: l or a fragment thereof.
  • the collagen binding domain comprises a polypeptide with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100% identity to SEQ ID NO: 1-4 or 11-14, or a fragment thereof.
  • the collagen binding domain comprises a polypeptide with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100% identity to SEQ ID NO: l, or a fragment thereof.
  • the collagen binding domain comprises a polypeptide with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97,
  • the collagen binding domain comprises a polypeptide with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100% identity to SEQ ID NO:3, or a fragment thereof.
  • the collagen binding domain comprises a polypeptide with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100% identity to SEQ ID NO:4, or a fragment thereof.
  • the collagen binding domain comprises a polypeptide with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100% identity to SEQ ID NO: 11, or a fragment thereof.
  • the collagen binding domain comprises a polypeptide with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100% identity to SEQ ID NO: 12, or a fragment thereof.
  • the collagen binding domain comprises a polypeptide with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity to SEQ ID NO: 13, or a fragment thereof.
  • the collagen binding domain comprises a polypeptide with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82,
  • the polypeptide is covalently linked to an albumin polypeptide.
  • the albumin polypeptide comprises a polypeptide with at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83,
  • the polypeptide is covalently linked to an IgG Fc domain polypeptide.
  • the IgG Fc domain polypeptide comprises a polypeptide with at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity (or any derivable range therein) to one of SEQ ID NOS: 15-18.
  • the collagen binding domain is at the amino end of the albumin polypeptide. In some embodiments, the collagen binding domain is at the carboxy end of the albumin polypeptide.
  • the phrase“at the amino end” or“at the carboxy end” refers to the relative position of one polypeptide to another. For example, when one polypeptide is “at the amino end” it is linked to the N-terminal amine group of the other polypeptide. However, there may be intervening sequences between the two polypeptides or domains. Similarly, a polypeptide“at the carboxy end” refers to a polypeptide linked to the carboxy terminus of another polypeptide or domain.
  • the cytotoxic agent is linked to the amino terminus of the collagen binding domain. In some embodiments, the cytotoxic agent is linked to the carboxy terminus of the collagen binding domain. In some embodiments, the cytotoxic agent is linked to the amino terminus of the albumin polypeptide. In some embodiments, the cytotoxic agent is linked to the carboxy terminus of the albumin polypeptide. In some embodiments, the collagen binding domain is at the amino end of the IgG Fc domain polypeptide. [0017] In some embodiments, the collagen binding domain is at the carboxy end of the IgG Fc domain polypeptide. In some embodiments, the cytotoxic agent is linked to the amino terminus of the collagen binding domain.
  • the cytotoxic agent is linked to the carboxy terminus of the collagen binding domain. In some embodiments, the cytotoxic agent is linked to the amino terminus of the IgG Fc domain polypeptide. In some embodiments, the cytotoxic agent is linked to the carboxy terminus of the IgG Fc domain polypeptide.
  • the polypeptide comprises a linker between the IgG Fc domain polypeptide and the collagen binding domain.
  • the linker comprises glycine and serine amino acid residues.
  • the linker comprises GGGS, (GGGS)n, or (GGGS) 2 .
  • the polypeptide comprises a linker between the albumin polypeptide and the collagen binding domain.
  • the linker comprises glycine and serine amino acid residues.
  • the linker comprises GGGS, (GGGS)n, or (GGGS)2.
  • n is 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more (or any range derivable therein).
  • the polypeptide is not operatively linked to a particle, nanovesicle, or liposome. In some embodiments, the polypeptide is not operatively linked to a nanoparticle or a solid support, such as a microplate or bead. In some embodiments, the composition does not comprise a liposome, particle, or nanovescicle. In some embodiments, the composition does not comprise a nanoparticle or a solid support, such as a microplate or a bead.
  • the polypeptide comprises at least two collagen binding domains. In some embodiments, the polypeptide comprises at least 2, 3, 4, 5, 6, 7, or 8 collagen binding domains. The collagen binding domains may be in tandem or at both the amino and carboxy terminus of the albumin polypeptide or IgG Fc domain polypeptide.
  • the ratio of cytotoxic agent to albumin is 3 : 1. In some embodiments, the ratio of cytotoxic agent to albumin is at least, at most, or exactly 0.5: 1, 1 : 1, 1.5: 1, 2: 1, 2.5: 1, 3 : 1, 3.5: 1, 4: 1, 4.5: 1, 5: 1, 5.5: 1, 6: 1, 7: 1, 8: 1, 9: 1, or 10: 1 (or any derivable range therein). In some embodiments, the ratio of albumin polypeptide to collagen binding domain is 1 : 1, 1 :2, 1 :3, 1 :4, 4: 1, 3 : 1, or 2: 1 (or any range derivable therein).
  • the ratio of cytotoxic agent to IgG Fc domain is 3 : 1. In some embodiments, the ratio of cytotoxic agent to IgG Fc domain is at least, at most, or exactly 0.5: 1, 1 : 1, 1.5: 1, 2: 1, 2.5: 1, 3 : 1, 3.5: 1, 4: 1, 4.5: 1, 5: 1, 5.5: 1, 6: 1, 7: 1, 8: 1, 9: 1, or 10: 1 (or any derivable range therein). In some embodiments, the ratio of IgG Fc domain polypeptide to collagen binding domain is 1 : 1, 1 :2, 1 :3, 1 :4, 4: 1, 3 : 1, or 2: 1 (or any range derivable therein).
  • the subject has cancer.
  • the subject has breast cancer or colon cancer or the tumor is a breast or colon tumor.
  • the subject has a cancer recited herein or a tumor from a cancer recited herein.
  • the cancer or tumor comprises a solid tumor. In some embodiments, hematological tumors or cancers are excluded.
  • the non-specific toxicity is reduced compared to the toxicity of the same cytotoxic agent linked to albumin and unlinked to collagen binding domain.
  • the non-specific toxicity may be reduced by at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 95% in the polypeptide comprising the collagen binding domain compared to the same polypeptide without the collagen binding domain.
  • the accumulation of the cytotoxic agent in the tumor is increased compared to the dose of the same cytotoxic agent linked to albumin and unlinked to collagen binding domain. In some embodiments, the increase is at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 95%.
  • the non-specific toxicity is reduced compared to the toxicity of the same cytotoxic agent linked to IgG Fc domain and unlinked to collagen binding domain.
  • the non-specific toxicity may be reduced by at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 95% in the polypeptide comprising the collagen binding domain compared to the same polypeptide without the collagen binding domain.
  • the accumulation of the cytotoxic agent in the tumor is increased compared to the dose of the same cytotoxic agent linked to IgG Fc domain and unlinked to collagen binding domain. In some embodiments, the increase is at least 10, 20, 30, 40, 50, 60, 70, 80, 90, or 95%.
  • the method further comprises administration of an additional cancer therapy.
  • the subject has or will receive an immunotherapy.
  • the subject has been determined to be non -responsive to the immunotherapy.
  • the subject has refractory cancer.
  • the subject is one that experienced toxicity associated with the previous therapy or previous immunotherapy.
  • the method further comprises administration of an immunotherapy.
  • the immunotherapy is administered before, after, or concurrent with the polypeptide.
  • the immunotherapy comprises checkpoint inhibitor therapy.
  • the checkpoint inhibitor therapy comprises mono checkpoint inhibitor therapy, which indicates that only one checkpoint inhibitor is administered.
  • the checkpoint inhibitor therapy comprises combination checkpoint inhibitor therapy, which indicates that at least two checkpoint inhibitors, such as an inhibitor to PD-1 and an inhibitor to CTLA-4 is administered.
  • the checkpoint inhibitor therapy comprises a PD-1 antibody.
  • the checkpoint inhibitor therapy comprises one or more checkpoint inhibitors described herein.
  • compositions of the disclosure further comprise one or more immune checkpoint inhibitors.
  • compositions of the disclosure comprise a PD-1 antibody.
  • compositions of the disclosure comprise a CTLA-4 antibody.
  • compositions of the disclosure comprise a PD-1 and CTLA-4 antibody.
  • the polypeptide or composition is administered systemically. In some embodiments, the polypeptide or composition is administered by intravenous injection. In some embodiments, the polypeptide or composition is administered intratumorally or peritumorally. In some embodiments, the polypeptide or composition is administered through a route of administration described herein.
  • the administered dose of the cytotoxic agent is less than the minimum effective dose of the cytotoxic agent unconjugated to collagen binding domain. In some embodiments, the administered dose of the cytotoxic agent is at least 10, 20, 30, 40, 50, 60, 70, 80, or 90% (or any derivable range therein) less than the minimum effective dose of the cytotoxic agent unconjugated to collagen binding domain. In some embodiments, the administered dose of the cytotoxic agent is less than the minimum effective dose of the cytotoxic agent conjugated to an albumin polypetide and unconjugated to collagen binding domain.
  • the administered dose of the cytotoxic agent is at least 10, 20, 30, 40, 50, 60, 70, 80, or 90% (or any derivable range therein) less than the minimum effective dose of the cytotoxic agent conjugated to an albumin polypetide and unconjugated to collagen binding domain. In some embodiments, the administered dose of the cytotoxic agent is less than the minimum effective dose of the cytotoxic agent conjugated to an IgG Fc domain polypetide and unconjutated to collagen binding domain.
  • the administered dose of the cytotoxic agent is at least 10, 20, 30, 40, 50, 60, 70, 80, or 90% (or any derivable range therein) less than the minimum effective dose of the cytotoxic agent conjugated to an IgG Fc domain polypetide and unconjutated to collagen binding domain.
  • the subject has been previously treated with a cytotoxic agent.
  • the subject has been determined to be non-responsive to the previous treatment or wherein the subject experienced non-specific toxicity to the previous treatment.
  • the subject experience greater than 2, 3, 4, or 5 immune related adverse events in response to the prior therapy.
  • compositions and polypeptides of the disclosure provide for a targeted delivery of a cytotoxic agent.
  • a cytotoxic agent may provide for a reduction in cardiac damage, extended survival, a reduction of the effective dose concentration, an increase in tumor-infiltrating lymphocytes, an increase in CD8 + cytotoxic T cells, an increase in natural killer cells, a reduction in inflammatory cytokines such as IFN-g, TNF-a, IL-5, and IL-6, or no adverse reduction of red blood cells, white blood cells, hematocrit and/or hemoglobin concentration compared to the composition comprising the same polypeptide without the collagen binding domain.
  • the terms“subject,”“mammal,” and“patient” are used interchangeably.
  • the subject is a mammal.
  • the subject is a human.
  • the subject is a mouse, rat, rabbit, dog, donkey, or a laboratory test animal such as fruit fly, zebrafish, etc.
  • the patient has been previously treated for the cancer.
  • the subject was resistant to the previous cancer treatment.
  • the subject was determined to be a poor responder to the previous cancer treatment.
  • the terms“or” and“and/or” are utilized to describe multiple components in combination or exclusive of one another.
  • “x, y, and/or z” can refer to“x” alone,“y” alone,“z” alone,“x, y, and z,”“(x and y) or z,”“x or (y and z),” or“x or y or z.” It is specifically contemplated that x, y, or z may be specifically excluded from an embodiment.
  • any limitation discussed with respect to one embodiment of the invention may apply to any other embodiment of the invention.
  • any composition of the invention may be used in any method of the invention, and any method of the invention may be used to produce or to utilize any composition of the invention.
  • Aspects of an embodiment set forth in the Examples are also embodiments that may be implemented in the context of embodiments discussed elsewhere in a different Example or elsewhere in the application, such as in the Summary of Invention, Detailed Description of the Embodiments, Claims, and description of Figure Legends.
  • FIG. 1A-H Synthesis and Characterization of Dox-CBD-SA.
  • A Schematic of CBD-SA mediated drug delivery.
  • B Synthesis scheme of Dox-CBD-SA.
  • D Dox conjugation ratio per protein are presented. Values were calculated based on the results of BCA protein quantification assay (proteins) and absorbance at 495 nm (Dox) (mean ⁇ SD of three experimental replicates).
  • Dox-CBD-SA shows comparable plasma pharmacokinetics with Dox- SA and higher tumor accumulation than aldoxorubicin and Dox-SA.
  • FIG. 3A-L Dox-CBD-SA shows enhanced anti-tumor efficacy and infiltration of lymphocytes into tumor in MMTV-PyMT breast cancer model.
  • A 5 x 10 5 MMTV-PyMT cells were inoculated to FVB mice on day 0. Aldoxorubicin, Dox-SA, or Dox-CBD-SA (5 mg/kg for Dox basis) were injected i.v. on day 7. Graphs depict tumor volume until the first mouse died (mean ⁇ SEM).
  • B Survival rate.
  • C-F Individual tumor growth curves. CR indicates complete response frequency. Three experimental replicates.
  • G-L 5 x 10 5 MMTV- PyMT cells were inoculated on day 0.
  • FIG. 4A-G Dox-CBD-SA treatment shows reduced toxicity. 20 mg/kg of aldoxorubicin or Dox-CBD-SA (Dox basis) were administered to tumor-free FVB mice via tail vein injection on day 0.
  • A-D Plasma cytokine concentrations on day 3.
  • E Red blood cell counts on day 6.
  • F White blood cell counts on day 3.
  • FIG. 5A-H Dox-CBD-SA treatment completely eradicates established MC38 tumor in combination with anti -PD- 1 checkpoint inhibitor.
  • 5 x 10 5 MC38 cells were inoculated on day 0.
  • Mice were injected i.v. with 5 mg/kg (Dox basis) of aldoxorubicin or Dox-CBD-SA on day 6, 9, and 12.
  • aPD-1 was also injected i.p. on day 10 and 13.
  • A The experimental schedule.
  • C Survival rate.
  • D-G Individual tumor growth curves. CR indicates complete response frequency.
  • FIG. 6 Confirmation of CBD fusion to SA by MALDI-TOF MS analysis.
  • CBD-SA was analyzed by MALDI-TOF MS. Abscissa is mass to charge ratio (m/z) and ordinate is intensity of charged ions. Two experimental replicates.
  • FIG. 8 SDS-PAGE analysis of mouse SA and CBD-SA conjugated with Dox.
  • Dox- SA and Dox-CBD-SA were analyzed by SDS-PAGE with coomassie blue staining. R reduced; NR non-reduced. Representative images are presented. Two experimental replicates.
  • FIG. 9A-B Hydrodynamic sizes.
  • A Sizes of un-conjugated CBD-SA, Dox-CBD- SA and Dox-CBD-SA reconstituted after lyophilization were measured by DLS.
  • B Sizes of un-conjugated SA and Dox-SA were also measured. Two experimental replicates.
  • FIG. 10 The binding interface between collagen type III and A3 domain of von Willebrand factor. Crystal structure of the A3 domain of von Willebrand factor (CBD) in complex with type III collagen (PDB 4DMU). The Image was processed using UCSF chimera. Lysines are indicated as blue color.
  • FIG. 12A-B Plasma pharmacokinetics of DyLight 800 labeled SA and CBD-SA.
  • 200 pg of DyLight 800 labeled SA or CBD-SA were administered to tumor-free FVB mice via tail vein injection (i.v.). Blood plasma was collected at indicated time points.
  • . t1 ⁇ 2, b, slow clearance half-life (mean ⁇ SEM. n 4).
  • MFI (t) A e_t + Be
  • . t1 ⁇ 2, b, slow clearance half-life (mean ⁇ SEM. n 4).
  • MFI (t) A e_t + Be
  • FIG. 13A-B Changes of hematological values in mice receiving 20 mg/kg of aldoxorubicin or Dox-CBD-SA.
  • FIG. 14 Histological analysis of major organs after Dox-CBD-SA treatment.
  • Tumor-free FVB mice received Dox-CBD-SA (20 mg/kg) on day 0.
  • Scale bar 200 pm.
  • H&E stained histology was evaluated blindly and no significant abnormality was observed after Dox-CBD-SA treatment. Representative images are shown. Two experimental replicates.
  • FIG. 15A-B MC38 tumor re-challenge and body weight changes of MC38 tumor bearing mice during the treatment.
  • A Graph depicts tumor sizes of Dox-CBD-SA + aPD-1 treated survivors re-challenged with MC38 cells (mean ⁇ SEM). Naive mice were also challenged with the same amounts of cells as a control group. # of mice developed a palpable tumor is shown.
  • B Body weight changes of mice during the treatments in FIG. 5 (mean ⁇ SEM). A line represents 85% of initial body weight. Two experimental replicates.
  • CBD-SA collagen binding domain-serum albumin
  • vWF von Willebrand factor
  • vWF A domain has the highest affinity against collagen among reported non-bacterial origin proteins/peptides.
  • the polypeptide comprises a collagen binding domain from decorin.
  • the collagen binding domain comprises a decorin peptide such as LRELHLNNN C (SEQ ID NO: 11), which is derived from bovine or LRELHLDNN C (SEQ ID NO: 12), which is derived from human.
  • the collagen binding domain comprises a peptide fragment from human decorin, which is represented by the following amino acid sequence: CGPFQQRGLFDFMLEDEASGIGPEVPDDRDFEPSLGPVCPFRCQCHLRVVQCSDLGL DK VPKDLPPD TTLLDLQNNKITEIKD GDFKNLKNLH ALIL VNNKI SKY SPGAF TPL VK LERL YL SKN QLKELPEKMPKTLQELRAHENEITK VRK VTFN GLN QMI VIELGTNPLK S SGIENGAFQGMKKLSYIRIADTNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNL AKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNI S V V GS SDF CPPGHNTKK A SYS GV SLF SNP V Q YWEIQP S TFRC V YVRS AIQLGNYK
  • the collagen binding peptide is a peptide from von Willebrand factor (vWF).
  • the sequence of human vWF comprises the following: MIP ARE AGVLL ALALILPGTLC AEGTRGRS STARC SLF GSDF VNTFDGSM Y SF AGY C S YLLAGGCQKRSF SIIGDF QNGKRV SLS VYLGEFFDIHLF VNGT VTQGDQRV SMPYAS KGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDD FMT QEGTLT SDP YDF AN S W AL S S GEQ W CERASPP S S S CNI S SGEMQKGL WEQC QLL K S T S VF ARCHPL VDPEPF V ALCEKTLCECAGGLECACP ALLEY ART C AQEGM VL Y G WTDHSACSPVCPAGMEYRQCVSPCARTCQSLH
  • the peptide is from the vWF A3 domain.
  • the VWF A3 domain is derived from the human sequence, residues 1670-1874 (907-1111 of mature VWF) and has the following sequence:
  • CSGEGLQIPTLSPAPDC SQPLD VILLLDGS S SFP AS YFDEMKSF AKAFISKANIGPRLTQ VSVLQYGSITTIDVPWNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMH GARPGASK AVVIL VTD V S VD SVDAAADAARSNRVT VFPIGIGDR YD AAQLRIL AGP A GD SNVVKLQRIEDLPTMVTLGN SFLHKLC SG (SEQ ID NO: 1).
  • the ECM-peptide comprises all or a fragment of vWF A3, which is represented by the following amino acid sequences: CSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVP WNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILV TD V S VD S VD AAAD AARSNRVT VFPIGIGDRYD AAQLRIL AGP AGD SNVVKLQRIEDL PTMVTLGNSFLHKLCSGFVRICTG (SEQ ID NO: 14).
  • the collagen binding domain comprises a polypeptide with the following sequence:
  • the polypeptide comprises a collagen binding domain albumin polypeptide having the following sequence:
  • Exemplary peptides include all or part of any one of SEQ ID NO: 1-4 or 1 1-14.
  • the collagen binding domain may be a polypeptide with 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity (or any derivable range therein) to a polypeptide of the disclosure, such as to SEQ ID NO: 1-4 or 1 1-14.
  • a linker sequence may be included in the polypeptides.
  • a linker having at least, at most, or exactly 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97
  • the albumin polypeptide, IgG Fc domain polypeptide, collagen binding domain and/or cytotoxic agent are covalently linked.
  • the cytotoxic agent may be covalently linked to the collagen binding domain.
  • the cytotoxic agent is covalently linked to the albumin polypeptide.
  • the cytotoxic agent is covalently linked to the IgG Fc domain polypeptide.
  • a linker is between the cytotoxic agent and the collagen binding domain or the albumin polypeptide.
  • a linker is between the cytotoxic agent and the collagen binding domain or the IgG Fc domain polypeptide.
  • the albumin polypeptide is covalently linked to the collagen domain.
  • the IgGFc domain polypeptide is covalently linked to the collagen domain.
  • a linker is between the albumin polypeptide and the collagen binding domain.
  • a linker is between the IgG Fc domain polypeptide and the collagen binding domain.
  • the linker comprises a bifunctional linker.
  • Linkers, such as amino acid or peptidomimetic sequences may be inserted between the peptide and/or antibody sequence. Linkers may have one or more properties that include a flexible conformation, an inability to form an ordered secondary structure or a hydrophobic or charged character which could promote or interact with either domain.
  • Other near neutral amino acids such as Thr and Ala, may also be used in the linker sequence.
  • the length of the linker sequence may vary without significantly affecting the function or activity of the fusion protein (see, e.g., U.S. Pat. No. 6,087,329).
  • the linker may be at least, at most, or exactly 4, 5, 6, 7,
  • linkers may also include chemical moieties and conjugating agents, such as sulfo-succinimidyl derivatives (sulfo-SMCC, sulfo-SMPB), disuccinimidyl suberate (DSS), disuccinimidyl glutarate (DSG) and disuccinimidyl tartrate (DST).
  • the linker can be a dipeptide linker, such as a valine-citrulline (val-cit), a phenylalanine-lysine (phe-lys) linker, or maleimidocapronic-valine-citruline-p-aminobenzyloxycarbonyl (vc) linker.
  • the linker is sulfosuccinimidyl-4-[N-maleimidomethyl]cyclohexane-l- carboxylate (smcc).
  • Sulfo-smcc conjugation occurs via a maleimide group which reacts with sulfhydryls (thiols,— SH), while its sulfo-NHS ester is reactive toward primary amines (as found in lysine and the protein or peptide N-terminus).
  • the linker may be maleimidocaproyl (me).
  • the covalent linkage may be achieved through the use of Traut’s reagent.
  • the albumin polypeptide is from mouse. In some embodiments, the albumin polypeptide is from humans.
  • the albumin polypeptide may comprise a polypeptide or fragment with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity (or any derivable range therein) to a polypeptide having the following sequence:
  • the albumin polypeptide may comprise a polypeptide or fragment with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity (or any derivable range therein) to a polypeptide having the following sequence:
  • the albumin polypeptide may comprise a polypeptide or fragment with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity (or any derivable range therein) to a polypeptide having the following sequence:
  • the albumin polypeptide may comprise a polypeptide or fragment with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity (or any derivable range therein) to a polypeptide having the following sequence:
  • Fc domain from human IgG is used to enhance drug half-life, because Fc domain also has cell recycling system as with albumin.
  • the albumin polypeptide is from humans.
  • the hlgGl Fc polypeptide may comprise a polypeptide or fragment with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity (or any derivable range therein) to a polypeptide having the following sequence (IGHG1, 99-330): EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVV S VLTVLHQDWLNGKEYKCK V SNK A LP APIEKTI SK AKGQPREPQ V YTLPP SREEMTKN Q VSLT CL VKGF YP SDI A
  • the hIgG2 Fc polypeptide may comprise a polypeptide or fragment with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity (or any derivable range therein) to a polypeptide having the following sequence (IGHG2, 99-326): ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNW YVDGMEVHNAKTKPREEQFN STFRVV S VLT VVHQDWLNGKEYKCKV SNKGLPAPI EKTISKTKGQPREPQ VYTLPP SREEMTKN Q V SLTCLVKGF YP SDI AVEWESN GQPEN NY
  • the hIgG3 Fc polypeptide may comprise a polypeptide or fragment with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity (or any derivable range therein) to a polypeptide having the following sequence (IGHG3, 99-376): ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPR CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFKWYVDGVEVH NAKTKPREEQYNSTFRVV S VLTVLHQDWLNGKEYKCKV SNK ALP APIEKTI SKTKG QPREPQVY
  • the hIgG4 Fc polypeptide may comprise a polypeptide or fragment with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identity (or any derivable range therein) to a polypeptide having the following sequence (IGHG4, 99-327): ESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFN WYVDGVEVHNAKTKPREEQFNST YRVV SVLTVLHQDWLNGKEYKCKV SNKGLPS S IEKTISKAKGQPREPQ VYTLPP SQEEMTKN Q V SLTCL VKGF YP SDI AVEW
  • Embodiments of the disclosure relate to albumin-collagen binding domain conjugates linked to cytotoxic agents.
  • Embodiments of the disclosure relate to IgG Fc domain- collagen binding domain conjugates linked to cytotoxic agents.
  • Cytotoxic agents include the enzyme inhibitors such as dihydrofolate reductase inhibitors, and thymidylate synthase inhibitors, DNA intercalators, DNA cleavers, topoisomerase inhibitors, the anthracycline family of drugs, the vinca drugs, the mitomycins, the bleomycins, the cytotoxic nucleosides, the pteridine family of drugs, diynenes, the podophyllotoxins, dolastatins, maytansinoids, differentiation inducers, and taxols.
  • Members of these classes include, for example, taxol, methotrexate, methopterin, dichloromethotrexate, 5-fluorouracil, 6-mercaptopurine, cytosine arabinoside, melphalan, leurosine, leurosideine, actinomycin, daunorubicin, doxorubicin, mitomycin C, mitomycin A, caminomycin, aminopterin, tallysomycin, podophyllotoxin and podophyllotoxin derivatives such as etoposide or etoposide phosphate, vinblastine, vincristine, vindesine, taxanes including taxol, taxotere retinoic acid, butyric acid, N8-acetyl spermidine, camptothecin, calicheamicin, esperamicin, ene-diynes, duocarmycin A, duocarmycin SA, calicheamicin, camptothecin,
  • Cytotoxic agents also include bacterial toxins such as diphtheria toxin, plant toxins such as ricin, small molecule toxins such as geldanamycin, maytansinoids, and calicheamicin, hemiasterlins. Toxins may exert their cytotoxic and cytostatic effects by mechanisms including tubulin binding, DNA binding, or topoisomerase inhibition.
  • Cytotoxic agents such as a maytansinoids, dolastatins, auristatins, a trichothecene, calicheamicin, and CC1065, and the derivatives of these toxins that have toxin activity, may also be used.
  • Other cytotoxic agents include BCNU, streptozoicin, vincristine and 5- fluorouracil, the family of agents known collectively LL-E33288 complex described in U.S. Pat. Nos. 5,053,394, 5,770,710, as well as esperamicins (U.S. Pat. No. 5,877,296).
  • Enzymatically active toxins and fragments thereof which can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin and the tricothecenes. See, for example, WO 93/21232 published Oct. 28, 1993.
  • the cytotoxic agent comprises a chemotherapeutic described herein.
  • the methods comprise administration of a cancer immunotherapy.
  • Cancer immunotherapy (sometimes called immuno-oncology, abbreviated IO) is the use of the immune system to treat cancer.
  • Immunotherapies can be categorized as active, passive or hybrid (active and passive). These approaches exploit the fact that cancer cells often have molecules on their surface that can be detected by the immune system, known as tumor-associated antigens (TAAs); they are often proteins or other macromolecules (e.g. carbohydrates).
  • TAAs tumor-associated antigens
  • Passive immunotherapies enhance existing anti-tumor responses and include the use of monoclonal antibodies, lymphocytes and cytokines. Immunotherapies useful in the methods of the disclosure are described below.
  • Embodiments of the disclosure may include administration of immune checkpoint inhibitors (also referred to as checkpoint inhibitor therapy), which are further described below.
  • immune checkpoint inhibitors also referred to as checkpoint inhibitor therapy
  • PD-1 can act in the tumor microenvironment where T cells encounter an infection or tumor. Activated T cells upregulate PD-1 and continue to express it in the peripheral tissues. Cytokines such as IFN-gamma induce the expression of PD-L1 on epithelial cells and tumor cells. PD-L2 is expressed on macrophages and dendritic cells. The main role of PD-1 is to limit the activity of effector T cells in the periphery and prevent excessive damage to the tissues during an immune response. Inhibitors of the disclosure may block one or more functions of PD-1 and/or PD-L1 activity.
  • Alternative names for“PD-1” include CD279 and SLEB2.
  • Alternative names for “PD-L1” include B7-H1, B7-4, CD274, and B7-H.
  • Alternative names for“PD-L2” include B7- DC, Btdc, and CD273.
  • PD-1, PD-L1, and PD-L2 are human PD-1, PD- L1 and PD-L2.
  • the PD-1 inhibitor is a molecule that inhibits the binding of PD-1 to its ligand binding partners.
  • the PD-1 ligand binding partners are PD-L1 and/or PD-L2.
  • a PD-L1 inhibitor is a molecule that inhibits the binding of PD-L1 to its binding partners.
  • PD-L1 binding partners are PD- 1 and/or B7-1.
  • the PD-L2 inhibitor is a molecule that inhibits the binding of PD-L2 to its binding partners.
  • a PD-L2 binding partner is PD- 1.
  • the inhibitor may be an antibody, an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide.
  • Exemplary antibodies are described in U.S. Patent Nos. 8,735,553, 8,354,509, and 8,008,449, all incorporated herein by reference.
  • Other PD-1 inhibitors for use in the methods and compositions provided herein are known in the art such as described in U.S. Patent Application Nos. US2014/0294898, US2014/022021, and US2011/0008369, all incorporated herein by reference.
  • the PD-1 inhibitor is an anti-PD-1 antibody (e.g., a human antibody, a humanized antibody, or a chimeric antibody).
  • the anti-PD- 1 antibody is selected from the group consisting of nivolumab, pembrolizumab, and pidilizumab.
  • the PD-1 inhibitor is an immunoadhesin (e.g., an immunoadhesin comprising an extracellular or PD-1 binding portion of PD-L1 or PD-L2 fused to a constant region (e.g., an Fc region of an immunoglobulin sequence).
  • the PD-L1 inhibitor comprises AMP-224.
  • Nivolumab also known as MDX-1106-04, MDX- 1106, ONO-4538, BMS-936558, and OPDIVO®, is an anti-PD-1 antibody described in W02006/121168.
  • Pembrolizumab also known as MK-3475, Merck 3475, lambrolizumab, KEYTRUDA®, and SCH-900475, is an anti-PD-1 antibody described in W02009/114335.
  • Pidilizumab also known as CT-011, hBAT, or hBAT-1, is an anti-PD-1 antibody described in W02009/101611.
  • AMP-224 also known as B7-DCIg, is a PD-L2-Fc fusion soluble receptor described in W02010/027827 and WO2011/066342. Additional PD-1 inhibitors include MEDI0680, also known as AMP-514, and REGN2810.
  • the immune checkpoint inhibitor is a PD-L1 inhibitor such as Durvalumab, also known as MEDI4736, atezolizumab, also known as MPDL3280A, avelumab, also known as MSB00010118C, MDX-1105, BMS-936559, or combinations thereof.
  • the immune checkpoint inhibitor is a PD-L2 inhibitor such as rHIgM12B7.
  • the inhibitor comprises the heavy and light chain CDRs or VRs of nivolumab, pembrolizumab, or pidilizumab. Accordingly, in one embodiment, the inhibitor comprises the CDR1, CDR2, and CDR3 domains of the VH region of nivolumab, pembrolizumab, or pidilizumab, and the CDR1, CDR2 and CDR3 domains of the VL region of nivolumab, pembrolizumab, or pidilizumab.
  • the antibody competes for binding with and/or binds to the same epitope on PD-1, PD-L1, or PD-L2 as the above- mentioned antibodies.
  • the antibody has at least about 70, 75, 80, 85, 90, 95, 97, or 99% (or any derivable range therein) variable region amino acid sequence identity with the above-mentioned antibodies.
  • CTLA-4 cytotoxic T-lymphocyte-associated protein 4
  • CD152 cytotoxic T-lymphocyte-associated protein 4
  • the complete cDNA sequence of human CTLA-4 has the Genbank accession number LI 5006.
  • CTLA-4 is found on the surface of T cells and acts as an“off’ switch when bound to B7-1 (CD80) or B7-2 (CD86) on the surface of antigen-presenting cells.
  • CTLA-4 is a member of the immunoglobulin superfamily that is expressed on the surface of Helper T cells and transmits an inhibitory signal to T cells.
  • CTLA-4 is similar to the T-cell co-stimulatory protein, CD28, and both molecules bind to B7-1 and B7-2 on antigen-presenting cells.
  • CTLA-4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal.
  • Intracellular CTLA- 4 is also found in regulatory T cells and may be important to their function. T cell activation through the T cell receptor and CD28 leads to increased expression of CTLA-4, an inhibitory receptor for B7 molecules.
  • Inhibitors of the disclosure may block one or more functions of CTLA-4, B7-1, and/or B7-2 activity. In some embodiments, the inhibitor blocks the CTLA-4 and B7-1 interaction. In some embodiments, the inhibitor blocks the CTLA-4 and B7-2 interaction.
  • the immune checkpoint inhibitor is an anti-CTLA-4 antibody (e.g., a human antibody, a humanized antibody, or a chimeric antibody), an antigen binding fragment thereof, an immunoadhesin, a fusion protein, or oligopeptide.
  • an anti-CTLA-4 antibody e.g., a human antibody, a humanized antibody, or a chimeric antibody
  • an antigen binding fragment thereof e.g., an immunoadhesin, a fusion protein, or oligopeptide.
  • Anti-human-CTLA-4 antibodies (or VH and/or VL domains derived therefrom) suitable for use in the present methods can be generated using methods well known in the art.
  • art recognized anti-CTLA-4 antibodies can be used.
  • the anti- CTLA-4 antibodies disclosed in: US 8, 119,129, WO 01/14424, WO 98/42752; WO 00/37504 (CP675,206, also known as tremelimumab; formerly ticilimumab), U.S. Patent No. 6,207,156; Hurwitz et ah, 1998; can be used in the methods disclosed herein.
  • the teachings of each of the aforementioned publications are hereby incorporated by reference.
  • Antibodies that compete with any of these art-recognized antibodies for binding to CTLA-4 also can be used.
  • a humanized CTLA-4 antibody is described in International Patent Application No. W02001/014424, W02000/037504, and U.S. Patent No. 8,017,114; all incorporated herein by reference.
  • a further anti-CTLA-4 antibody useful as a checkpoint inhibitor in the methods and compositions of the disclosure is ipilimumab (also known as 10D1, MDX- 010, MDX- 101, and Yervoy®) or antigen binding fragments and variants thereof (see, e.g., WOO 1/14424).
  • the inhibitor comprises the heavy and light chain CDRs or VRs of tremelimumab or ipilimumab. Accordingly, in one embodiment, the inhibitor comprises the CDR1, CDR2, and CDR3 domains of the VH region of tremelimumab or ipilimumab, and the CDR1, CDR2 and CDR3 domains of the VL region of tremelimumab or ipilimumab.
  • the antibody competes for binding with and/or binds to the same epitope on PD-1, B7-1, or B7-2 as the above- mentioned antibodies.
  • the antibody has at least about 70, 75, 80, 85, 90, 95, 97, or 99% (or any derivable range therein) variable region amino acid sequence identity with the above-mentioned antibodies.
  • the immunotherapy comprises an inhibitor of a co stimulatory molecule.
  • the inhibitor comprises an inhibitor of B7-1 (CD80), B7-2 (CD86), CD28, ICOS, 0X40 (TNFRSF4), 4-1BB (CD137; TNFRSF9), CD40L (CD40LG), GITR (TNFRSF18), and combinations thereof.
  • Inhibitors include inhibitory antibodies, polypeptides, compounds, and nucleic acids.
  • Dendritic cell therapy provokes anti-tumor responses by causing dendritic cells to present tumor antigens to lymphocytes, which activates them, priming them to kill other cells that present the antigen.
  • Dendritic cells are antigen presenting cells (APCs) in the mammalian immune system. In cancer treatment, they aid cancer antigen targeting.
  • APCs antigen presenting cells
  • cellular cancer therapy based on dendritic cells is sipuleucel-T.
  • One method of inducing dendritic cells to present tumor antigens is by vaccination with autologous tumor lysates or short peptides (small parts of protein that correspond to the protein antigens on cancer cells). These peptides are often given in combination with adjuvants (highly immunogenic substances) to increase the immune and anti-tumor responses.
  • adjuvants include proteins or other chemicals that attract and/or activate dendritic cells, such as granulocyte macrophage colony-stimulating factor (GM-CSF).
  • Dendritic cells can also be activated in vivo by making tumor cells express GM- CSF. This can be achieved by either genetically engineering tumor cells to produce GM-CSF or by infecting tumor cells with an oncolytic virus that expresses GM-CSF.
  • Another strategy is to remove dendritic cells from the blood of a patient and activate them outside the body.
  • the dendritic cells are activated in the presence of tumor antigens, which may be a single tumor-specific peptide/protein or a tumor cell lysate (a solution of broken down tumor cells). These cells (with optional adjuvants) are infused and provoke an immune response.
  • tumor antigens may be a single tumor-specific peptide/protein or a tumor cell lysate (a solution of broken down tumor cells). These cells (with optional adjuvants) are infused and provoke an immune response.
  • Dendritic cell therapies include the use of antibodies that bind to receptors on the surface of dendritic cells. Antigens can be added to the antibody and can induce the dendritic cells to mature and provide immunity to the tumor.
  • Chimeric antigen receptors are engineered receptors that combine a new specificity with an immune cell to target cancer cells. Typically, these receptors graft the specificity of a monoclonal antibody onto a T cell. The receptors are called chimeric because they are fused of parts from different sources.
  • CAR-T cell therapy refers to a treatment that uses such transformed cells for cancer therapy.
  • CAR-T cell design involves recombinant receptors that combine antigen-binding and T-cell activating functions.
  • the general premise of CAR-T cells is to artificially generate T-cells targeted to markers found on cancer cells.
  • scientists can remove T-cells from a person, genetically alter them, and put them back into the patient for them to attack the cancer cells.
  • CAR-T cells create a link between an extracellular ligand recognition domain to an intracellular signalling molecule which in turn activates T cells.
  • the extracellular ligand recognition domain is usually a single-chain variable fragment (scFv).
  • scFv single-chain variable fragment
  • Exemplary CAR-T therapies include Tisagenlecleucel (Kymriah) and Axicabtagene ciloleucel (Yescarta).
  • the CAR-T therapy targets CD19.
  • Cytokines are proteins produced by many types of cells present within a tumor. They can modulate immune responses. The tumor often employs them to allow it to grow and reduce the immune response. These immune-modulating effects allow them to be used as drugs to provoke an immune response. Two commonly used cytokines are interferons and interleukins.
  • Interferons are produced by the immune system. They are usually involved in anti viral response, but also have use for cancer. They fall in three groups: type I (IFNa and IFNP), type II (IFNy) and type III (IFNk).
  • Interleukins have an array of immune system effects.
  • IL-2 is an exemplary interleukin cytokine therapy.
  • Adoptive T cell therapy is a form of passive immunization by the transfusion of T- cells (adoptive cell transfer). They are found in blood and tissue and usually activate when they find foreign pathogens. Specifically, they activate when the T-cell's surface receptors encounter cells that display parts of foreign proteins on their surface antigens. These can be either infected cells, or antigen presenting cells (APCs). They are found in normal tissue and in tumor tissue, where they are known as tumor infiltrating lymphocytes (TILs). They are activated by the presence of APCs such as dendritic cells that present tumor antigens. Although these cells can attack the tumor, the environment within the tumor is highly immunosuppressive, preventing immune-mediated tumor death.
  • APCs antigen presenting cells
  • T-cells specific to a tumor antigen can be removed from a tumor sample (TILs) or filtered from blood. Subsequent activation and culturing is performed ex vivo, with the results reinfused. Activation can take place through gene therapy, or by exposing the T cells to tumor antigens.
  • TILs tumor sample
  • Activation can take place through gene therapy, or by exposing the T cells to tumor antigens.
  • a cancer treatment may exclude any of the cancer treatments described herein.
  • embodiments of the disclosure include patients that have been previously treated for a therapy described herein, are currently being treated for a therapy described herein, or have not been treated for a therapy described herein.
  • the patient is one that has been determined to be resistant to a therapy described herein.
  • the patient is one that has been determined to be sensitive to a therapy described herein.
  • the additional therapy comprises an oncolytic virus.
  • An oncolytic virus is a virus that preferentially infects and kills cancer cells. As the infected cancer cells are destroyed by oncolysis, they release new infectious virus particles or virions to help destroy the remaining tumor. Oncolytic viruses are thought not only to cause direct destruction of the tumor cells, but also to stimulate host anti-tumor immune responses for long-term immunotherapy.
  • the additional therapy comprises polysaccharides.
  • Certain compounds found in mushrooms primarily polysaccharides, can up-regulate the immune system and may have anti-cancer properties.
  • beta-glucans such as lentinan have been shown in laboratory studies to stimulate macrophage, NK cells, T cells and immune system cytokines and have been investigated in clinical trials as immunologic adjuvants.
  • the additional therapy comprises neoantigen administration.
  • Many tumors express mutations. These mutations potentially create new targetable antigens (neoantigens) for use in T cell immunotherapy.
  • the presence of CD8 + T cells in cancer lesions, as identified using RNA sequencing data, is higher in tumors with a high mutational burden.
  • the level of transcripts associated with cytolytic activity of natural killer cells and T cells positively correlates with mutational load in many human tumors.
  • the additional therapy comprises a chemotherapy.
  • chemotherapeutic agents include (a) Alkylating Agents, such as nitrogen mustards (e.g., mechlorethamine, cylophosphamide, ifosfamide, melphalan, chlorambucil), ethylenimines and methylmelamines (e.g., hexamethylmelamine, thiotepa), alkyl sulfonates (e.g., busulfan), nitrosoureas (e.g., carmustine, lomustine, chlorozoticin, streptozocin) and triazines (e.g., dicarbazine), (b) Antimetabolites, such as folic acid analogs (e.g., methotrexate), pyrimidine analogs (e.g., 5-fluorouracil, floxuridine, cytarabine, azauridine) and purine analogs and
  • nitrogen mustards e.g.
  • Cisplatin has been widely used to treat cancers such as, for example, metastatic testicular or ovarian carcinoma, advanced bladder cancer, head or neck cancer, cervical cancer, lung cancer or other tumors. Cisplatin is not absorbed orally and must therefore be delivered via other routes such as, for example, intravenous, subcutaneous, intratumoral or intraperitoneal injection. Cisplatin can be used alone or in combination with other agents, with efficacious doses used in clinical applications including about 15 mg/m 2 to about 20 mg/m 2 for 5 days every three weeks for a total of three courses being contemplated in certain embodiments.
  • the amount of cisplatin delivered to the cell and/or subject in conjunction with the construct comprising an Egr-1 promoter operatively linked to a polynucleotide encoding the therapeutic polypeptide is less than the amount that would be delivered when using cisplatin alone.
  • chemotherapeutic agents include antimicrotubule agents, e.g., Paclitaxel (“Taxol”) and doxorubicin hydrochloride (“doxorubicin”).
  • Paclitaxel e.g., Paclitaxel
  • doxorubicin hydrochloride doxorubicin hydrochloride
  • Doxorubicin is absorbed poorly and is preferably administered intravenously.
  • appropriate intravenous doses for an adult include about 60 mg/m 2 to about 75 mg/m 2 at about 21-day intervals or about 25 mg/m 2 to about 30 mg/m 2 on each of 2 or 3 successive days repeated at about 3 week to about 4 week intervals or about 20 mg/m 2 once a week.
  • the lowest dose should be used in elderly patients, when there is prior bone- marrow depression caused by prior chemotherapy or neoplastic marrow invasion, or when the drug is combined with other myelopoietic suppressant drugs.
  • Nitrogen mustards are another suitable chemotherapeutic agent useful in the methods of the disclosure.
  • a nitrogen mustard may include, but is not limited to, mechlorethamine (HN2), cyclophosphamide and/or ifosfamide, melphalan (L-sarcolysin), and chlorambucil.
  • Cyclophosphamide (CYTOXAN®) is available from Mead Johnson and NEOSTAR® is available from Adria), is another suitable chemotherapeutic agent.
  • Suitable oral doses for adults include, for example, about 1 mg/kg/day to about 5 mg/kg/day
  • intravenous doses include, for example, initially about 40 mg/kg to about 50 mg/kg in divided doses over a period of about 2 days to about 5 days or about 10 mg/kg to about 15 mg/kg about every 7 days to about 10 days or about 3 mg/kg to about 5 mg/kg twice a week or about 1.5 mg/kg/day to about 3 mg/kg/day.
  • the intravenous route is preferred.
  • the drug also sometimes is administered intramuscularly, by infiltration or into body cavities.
  • Additional suitable chemotherapeutic agents include pyrimidine analogs, such as cytarabine (cytosine arabinoside), 5-fluorouracil (fluouracil; 5-FU) and floxuridine (fluorode- oxyuridine; FudR).
  • 5-FU may be administered to a subject in a dosage of anywhere between about 7.5 to about 1000 mg/m2. Further, 5-FU dosing schedules may be for a variety of time periods, for example up to six weeks, or as determined by one of ordinary skill in the art to which this disclosure pertains.
  • Gemcitabine diphosphate (GEMZAR®, Eli Lilly & Co.,“gemcitabine”), another suitable chemotherapeutic agent, is recommended for treatment of advanced and metastatic pancreatic cancer, and will therefore be useful in the present disclosure for these cancers as well.
  • the amount of the chemotherapeutic agent delivered to the patient may be variable.
  • the chemotherapeutic agent may be administered in an amount effective to cause arrest or regression of the cancer in a host, when the chemotherapy is administered with the construct.
  • the chemotherapeutic agent may be administered in an amount that is anywhere between 2 to 10,000 fold less than the chemotherapeutic effective dose of the chemotherapeutic agent.
  • the chemotherapeutic agent may be administered in an amount that is about 20 fold less, about 500 fold less or even about 5000 fold less than the chemotherapeutic effective dose of the chemotherapeutic agent.
  • chemotherapeutics of the disclosure can be tested in vivo for the desired therapeutic activity in combination with the construct, as well as for determination of effective dosages.
  • suitable animal model systems prior to testing in humans, including, but not limited to, rats, mice, chicken, cows, monkeys, rabbits, etc.
  • In vitro testing may also be used to determine suitable combinations and dosages, as described in the examples.
  • the additional therapy or prior therapy comprises radiation, such as ionizing radiation.
  • ionizing radiation means radiation comprising particles or photons that have sufficient energy or can produce sufficient energy via nuclear interactions to produce ionization (gain or loss of electrons).
  • An exemplary and preferred ionizing radiation is an x-radiation. Means for delivering x-radiation to a target tissue or cell are well known in the art.
  • the amount of ionizing radiation is greater than 20 Gy and is administered in one dose. In some embodiments, the amount of ionizing radiation is 18 Gy and is administered in three doses. In some embodiments, the amount of ionizing radiation is at least, at most, or exactly 2, 4, 6, 8, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 18, 19, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 40 Gy (or any derivable range therein). In some embodiments, the ionizing radiation is administered in at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 does (or any derivable range therein). When more than one dose is administered, the does may be about 1, 4, 8, 12, or 24 hours or 1, 2, 3, 4, 5, 6, 7, or 8 days or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, or 16 weeks apart, or any derivable range therein.
  • the amount of IR may be presented as a total dose of IR, which is then administered in fractionated doses.
  • the total dose is 50 Gy administered in 10 fractionated doses of 5 Gy each.
  • the total dose is 50-90 Gy, administered in 20-60 fractionated doses of 2-3 Gy each.
  • the total dose of IR is at least, at most, or about 20, 21, 22, 23, 24, 25, 26, 27,
  • the total dose is administered in fractionated doses of at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 15, 20, 25, 30, 35, 40, 45, or 50 Gy (or any derivable range therein. In some embodiments, at least, at most, or exactly 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18,
  • fractionated doses are administered (or any derivable range therein).
  • at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 (or any derivable range therein) fractionated doses are administered per day.
  • at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 (or any derivable range therein) fractionated doses are administered per week.
  • Curative surgery includes resection in which all or part of cancerous tissue is physically removed, excised, and/or destroyed and may be used in conjunction with other therapies, such as the treatment of the present embodiments, chemotherapy, radiotherapy, hormonal therapy, gene therapy, immunotherapy, and/or alternative therapies.
  • Tumor resection refers to physical removal of at least part of a tumor.
  • treatment by surgery includes laser surgery, cryosurgery, electrosurgery, and microscopically-controlled surgery (Mohs’ surgery).
  • a cavity may be formed in the body.
  • Treatment may be accomplished by perfusion, direct injection, or local application of the area with an additional anti-cancer therapy. Such treatment may be repeated, for example, every 1, 2, 3, 4, 5, 6, or 7 days, or every 1, 2, 3, 4, and 5 weeks or every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, or 12 months. These treatments may be of varying dosages as well.
  • agents may be used in combination with certain aspects of the present embodiments to improve the therapeutic efficacy of treatment.
  • additional agents include agents that affect the upregulation of cell surface receptors and GAP junctions, cytostatic and differentiation agents, inhibitors of cell adhesion, agents that increase the sensitivity of the hyperproliferative cells to apoptotic inducers, or other biological agents. Increases in intercellular signaling by elevating the number of GAP junctions would increase the anti-hyperproliferative effects on the neighboring hyperproliferative cell population.
  • cytostatic or differentiation agents can be used in combination with certain aspects of the present embodiments to improve the anti-hyperproliferative efficacy of the treatments.
  • Inhibitors of cell adhesion are contemplated to improve the efficacy of the present embodiments.
  • Examples of cell adhesion inhibitors are focal adhesion kinase (FAKs) inhibitors and Lovastatin. It is further contemplated that other agents that increase the sensitivity of a hyperproliferative cell to apoptosis, such as the antibody c225, could be used in combination with certain aspects of the present embodiments to improve the treatment efficacy.
  • polynucleotide refers to a nucleic acid molecule that either is recombinant or has been isolated free of total genomic nucleic acid. Included within the term“polynucleotide” are oligonucleotides (nucleic acids 100 residues or fewer in length), recombinant vectors, including, for example, plasmids, cosmids, phage, viruses, and the like. Polynucleotides include, in certain aspects, regulatory sequences, isolated substantially away from their naturally occurring genes or protein encoding sequences.
  • Polynucleotides may be single-stranded (coding or antisense) or double-stranded, and may be RNA, DNA (genomic, cDNA or synthetic), analogs thereof, or a combination thereof. Additional coding or non-coding sequences may, but need not, be present within a polynucleotide.
  • the term“gene,”“polynucleotide,” or“nucleic acid” is used to refer to a nucleic acid that encodes a protein, polypeptide, or peptide (including any sequences required for proper transcription, post-translational modification, or localization).
  • this term encompasses genomic sequences, expression cassettes, cDNA sequences, and smaller engineered nucleic acid segments that express, or may be adapted to express, proteins, polypeptides, domains, peptides, fusion proteins, and mutants.
  • a nucleic acid encoding all or part of a polypeptide may contain a contiguous nucleic acid sequence encoding all or a portion of such a polypeptide. It also is contemplated that a particular polypeptide may be encoded by nucleic acids containing variations having slightly different nucleic acid sequences but, nonetheless, encode the same or substantially similar protein (see above).
  • nucleic acid segments and recombinant vectors incorporating nucleic acid sequences that encode a polypeptides e.g., a polymerase, RNA polymerase, one or more truncated polymerase domains or interaction components that are polypeptides
  • a polypeptides e.g., a polymerase, RNA polymerase, one or more truncated polymerase domains or interaction components that are polypeptides
  • the term“recombinant” may be used in conjunction with a polypeptide or the name of a specific polypeptide, and this generally refers to a polypeptide produced from a nucleic acid molecule that has been manipulated in vitro or that is a replication product of such a molecule.
  • nucleic acid segments regardless of the length of the coding sequence itself, may be combined with other nucleic acid sequences, such as promoters, polyadenylation signals, additional restriction enzyme sites, multiple cloning sites, other coding segments, and the like, such that their overall length may vary considerably. It is therefore contemplated that a nucleic acid fragment of almost any length may be employed, with the total length preferably being limited by the ease of preparation and use in the intended recombinant nucleic acid protocol.
  • a nucleic acid sequence may encode a polypeptide sequence with additional heterologous coding sequences, for example to allow for purification of the polypeptide, transport, secretion, post-translational modification, or for therapeutic benefits such as targeting or efficacy.
  • a tag or other heterologous polypeptide may be added to the modified polypeptide-encoding sequence, wherein“heterologous” refers to a polypeptide that is not the same as the modified polypeptide.
  • polynucleotide variants having substantial identity to the sequences disclosed herein; those comprising at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% or higher sequence identity, including all values and ranges there between, compared to a polynucleotide sequence provided herein using the methods described herein (e.g., BLAST analysis using standard parameters).
  • the isolated polynucleotide will comprise a nucleotide sequence encoding a polypeptide that has at least 90%, preferably 95% and above, identity to an amino acid sequence described herein, over the entire length of the sequence; or a nucleotide sequence complementary to said isolated polynucleotide.
  • Polypeptides may be encoded by a nucleic acid molecule.
  • the nucleic acid molecule can be in the form of a nucleic acid vector.
  • vector is used to refer to a carrier nucleic acid molecule into which a heterologous nucleic acid sequence can be inserted for introduction into a cell where it can be replicated and expressed.
  • a nucleic acid sequence can be“heterologous,” which means that it is in a context foreign to the cell in which the vector is being introduced or to the nucleic acid in which is incorporated, which includes a sequence homologous to a sequence in the cell or nucleic acid but in a position within the host cell or nucleic acid where it is ordinarily not found.
  • Vectors include DNAs, RNAs, plasmids, cosmids, viruses (bacteriophage, animal viruses, and plant viruses), and artificial chromosomes (e.g., YACs).
  • viruses bacteriophage, animal viruses, and plant viruses
  • artificial chromosomes e.g., YACs.
  • Vectors may be used in a host cell to produce a polymerase, RNA polymerase, one or more truncated polymerase domains or interaction components that are fused, attached or linked to the one or more truncated RNA polymerase domains.
  • expression vector refers to a vector containing a nucleic acid sequence coding for at least part of a gene product capable of being transcribed. In some cases, RNA molecules are then translated into a protein, polypeptide, or peptide.
  • Expression vectors can contain a variety of“control sequences,” which refer to nucleic acid sequences necessary for the transcription and possibly translation of an operatively linked coding sequence in a particular host organism. In addition to control sequences that govern transcription and translation, vectors and expression vectors may contain nucleic acid sequences that serve other functions as well and are described herein.
  • the disclosure provides methods for modifying a target RNA of interest, in particular in prokaryotic cells, eukaryotic cells, tissues, organs, or organisms, more in particular in mammalian cells, tissues, organs, or organisms.
  • the target RNA may be comprised in a nucleic acid molecule within a cell.
  • the target RNA is in a eukaryotic cell, such as a mammalian cell or a plant cell.
  • the mammalian cell many be a human, non human primate, bovine, porcine, rodent or mouse cell.
  • the cell may be a non-mammalian eukaryotic cell such as poultry, fish or shrimp.
  • the plant cell may be of a crop plant such as cassava, com, sorghum, wheat, or rice.
  • the plant cell may also be of an algae, tree or vegetable.
  • the modulation of the RNA induced in the cell by the methods, systems, and compositions of the disclosure may be such that the cell and progeny of the cell are altered for improved production of biologic products such as an antibody, starch, alcohol or other desired cellular output.
  • the modulation of the RNA induced in the cell may be such that the cell and progeny of the cell include an alteration that changes the biologic product produced.
  • the mammalian cell may be a human or non-human mammal, e.g., primate, bovine, ovine, porcine, canine, rodent, Leporidae such as monkey, cow, sheep, pig, dog, rabbit, rat or mouse cell.
  • the cell may be a non-mammalian eukaryotic cell such as poultry bird (e.g., chicken), vertebrate fish (e.g., salmon) or shellfish (e.g., oyster, clam, lobster, shrimp) cell.
  • the cell may also be a plant cell.
  • the plant cell may be of a monocot or dicot or of a crop or grain plant such as cassava, com, sorghum, soybean, wheat, oat or rice.
  • the plant cell may also be of an algae, tree or production plant, fruit or vegetable (e.g., trees such as citrus trees, e.g., orange, grapefruit or lemon trees; peach or nectarine trees; apple or pear trees; nut trees such as almond or walnut or pistachio trees; nightshade plants; plants of the genus Brassica; plants of the genus Lactuca; plants of the genus Spinacia; plants of the genus Capsicum; cotton, tobacco, asparagus, carrot, cabbage, broccoli, cauliflower, tomato, eggplant, pepper, lettuce, spinach, strawberry, blueberry, raspberry, blackberry, grape, coffee, cocoa, etc.).
  • “cell,” “cell line,” and“cell culture” may be used interchangeably. All of these terms also include their progeny, which is any and all subsequent generations. It is understood that all progeny may not be identical due to deliberate or inadvertent mutations.
  • “host cell” refers to a prokaryotic or eukaryotic cell, and it includes any transformable organism that is capable of replicating a vector or expressing a heterologous gene encoded by a vector.
  • a host cell can, and has been, used as a recipient for vectors or viruses.
  • a host cell may be “transfected” or“transformed,” which refers to a process by which exogenous nucleic acid, such as a recombinant protein-encoding sequence, is transferred or introduced into the host cell.
  • a transformed cell includes the primary subject cell and its progeny.
  • Some vectors may employ control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
  • control sequences that allow it to be replicated and/or expressed in both prokaryotic and eukaryotic cells.
  • One of skill in the art would further understand the conditions under which to incubate all of the above described host cells to maintain them and to permit replication of a vector. Also understood and known are techniques and conditions that would allow large-scale production of vectors, as well as production of the nucleic acids encoded by vectors and their cognate polypeptides, proteins, or peptides.
  • Prokaryote- and/or eukaryote-based systems can be employed for use with an embodiment to produce nucleic acid sequences, or their cognate polypeptides, proteins and peptides.
  • the vectors, fusion proteins, RNA hairpin binding proteins, RNA targeting molecules, RNA regulatory domain, and accessory proteins of the disclosure may utilize an expression system, such as an inducible or constitutive expression system. Many such systems are commercially and widely available.
  • the insect cell/baculovirus system can produce a high level of protein expression of a heterologous nucleic acid segment, such as described in U.S. Patents 5,871,986, 4,879,236, both herein incorporated by reference, and which can be bought, for example, under the name MAXBAC® 2.0 from INVITROGEN® and BACPACKTM BACULOVIRUS EXPRESSION SYSTEM FROM CLONTECH®.
  • a heterologous nucleic acid segment such as described in U.S. Patents 5,871,986, 4,879,236, both herein incorporated by reference, and which can be bought, for example, under the name MAXBAC® 2.0 from INVITROGEN® and BACPACKTM BACULOVIRUS EXPRESSION SYSTEM FROM CLONTECH®.
  • STRATAGENE® COMPLETE CONTROL Inducible Mammalian Expression System, which involves a synthetic ecdysone-inducible receptor, or its pET Expression System, an E. coli expression system.
  • INVITROGEN ® which carries the T-REXTM (tetracycline-regulated expression) System, an inducible mammalian expression system that uses the full-length CMV promoter.
  • INVITROGEN ® also provides a yeast expression system called the Pichia methanolica Expression System, which is designed for high-level production of recombinant proteins in the methyl otrophic yeast Pichia methanolica.
  • a vector such as an expression construct, to produce a nucleic acid sequence or its cognate polypeptide, protein, or peptide.
  • polypeptides or polynucleotides of the disclosure such as those comprising or encoding for an albumin polypeptide linked to a collagen binding domain, may include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 or more variant amino acids or nucleic acid substitutions or be at least 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% similar, identical, or
  • polypeptides or polynucleotides of the disclosure such as those comprising or encoding for an albumin polypeptide linked to a collagen binding domain, may include 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31,
  • the polypeptide comprises amino acids 1 to 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58,
  • the polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
  • the polypeptide comprises at least, at most, or exactly 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29,
  • the polypeptide comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12,
  • polypeptides of the disclosure may include at least, at most, or exactly 1, 2, 3,
  • substitution may be at amino acid position or nucleic acid position 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81
  • 504 505, 506, 507, 508, 509, 510, 511, 512, 513, 514, 515, 516, 517, 518, 519, 520, 521, 522,
  • polypeptides described herein may be of a fixed length of at least, at most, or exactly 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29,
  • Substitutional variants typically contain the exchange of one amino acid for another at one or more sites within the protein, and may be designed to modulate one or more properties of the polypeptide, with or without the loss of other functions or properties. Substitutions may be conservative, that is, one amino acid is replaced with one of similar shape and charge.
  • Conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine.
  • substitutions may be non-conservative such that a function or activity of the polypeptide is affected.
  • Non conservative changes typically involve substituting a residue with one that is chemically dissimilar, such as a polar or charged amino acid for a nonpolar or uncharged amino acid, and vice versa.
  • Proteins may be recombinant, or synthesized in vitro. Alternatively, a non recombinant or recombinant protein may be isolated from bacteria. It is also contemplated that bacteria containing such a variant may be implemented in compositions and methods. Consequently, a protein need not be isolated.
  • the term“functionally equivalent codon” is used herein to refer to codons that encode the same amino acid, such as the six codons for arginine or serine, and also refers to codons that encode biologically equivalent amino acids.
  • amino acid and nucleic acid sequences may include additional residues, such as additional N- or C-terminal amino acids, or 5' or 3' sequences, respectively, and yet still be essentially as set forth in one of the sequences disclosed herein, so long as the sequence meets the criteria set forth above, including the maintenance of biological protein activity where protein expression is concerned.
  • the addition of terminal sequences particularly applies to nucleic acid sequences that may, for example, include various non coding sequences flanking either of the 5' or 3' portions of the coding region.
  • amino acids of a protein may be substituted for other amino acids in a protein structure without appreciable loss of interactive binding capacity.
  • Structures such as, for example, an enzymatic catalytic domain or interaction components may have amino acid substituted to maintain such function. Since it is the interactive capacity and nature of a protein that defines that protein’s biological functional activity, certain amino acid substitutions can be made in a protein sequence, and in its underlying DNA coding sequence, and nevertheless produce a protein with like properties. It is thus contemplated by the inventors that various changes may be made in the DNA sequences of genes without appreciable loss of their biological utility or activity.
  • alteration of the function of a polypeptide is intended by introducing one or more substitutions.
  • certain amino acids may be substituted for other amino acids in a protein structure with the intent to modify the interactive binding capacity of interaction components. Structures such as, for example, protein interaction domains, nucleic acid interaction domains, and catalytic sites may have amino acids substituted to alter such function. Since it is the interactive capacity and nature of a protein that defines that protein’s biological functional activity, certain amino acid substitutions can be made in a protein sequence, and in its underlying DNA coding sequence, and nevertheless produce a protein with different properties. It is thus contemplated by the inventors that various changes may be made in the DNA sequences of genes with appreciable alteration of their biological utility or activity.
  • the hydropathic index of amino acids may be considered.
  • the importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
  • amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
  • Exemplary substitutions that take into consideration the various foregoing characteristics are well known and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
  • all or part of proteins described herein can also be synthesized in solution or on a solid support in accordance with conventional techniques.
  • Various automatic synthesizers are commercially available and can be used in accordance with known protocols. See, for example, Stewart and Young, (1984); Tam etal. , (1983); Merrifield, (1986); and Barany and Merrifield (1979), each incorporated herein by reference.
  • recombinant DNA technology may be employed wherein a nucleotide sequence that encodes a peptide or polypeptide is inserted into an expression vector, transformed or transfected into an appropriate host cell and cultivated under conditions suitable for expression.
  • One embodiment includes the use of gene transfer to cells, including microorganisms, for the production and/or presentation of proteins.
  • the gene for the protein of interest may be transferred into appropriate host cells followed by culture of cells under the appropriate conditions.
  • a nucleic acid encoding virtually any polypeptide may be employed.
  • the generation of recombinant expression vectors, and the elements included therein, are discussed herein.
  • the protein to be produced may be an endogenous protein normally synthesized by the cell used for protein production.
  • compositions and related methods of the present disclosure particularly administration of a polypeptide comprising an albumin polypeptide or IgG Fc domain polypeptide linked to a collagen binding domain may also be used in combination with the administration of additional therapies such as the additional therapeutics described herein or in combination with other traditional therapeutics known in the art.
  • compositions and treatments disclosed herein may precede, be co current with and/or follow another treatment or agent by intervals ranging from minutes to weeks.
  • agents are applied separately to a cell, tissue or organism, one would generally ensure that a significant period of time did not expire between the time of each delivery, such that the therapeutic agents would still be able to exert an advantageously combined effect on the cell, tissue or organism.
  • one may contact the cell, tissue or organism with two, three, four or more agents or treatments substantially simultaneously (i.e., within less than about a minute).
  • one or more therapeutic agents or treatments may be administered or provided within 1 minute, 5 minutes, 10 minutes, 20 minutes, 30 minutes, 45 minutes, 60 minutes, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 22 hours, 23 hours, 24 hours, 25 hours, 26 hours, 27 hours, 28 hours, 29 hours, 30 hours, 31 hours, 32 hours, 33 hours, 34 hours, 35 hours, 36 hours, 37 hours, 38 hours, 39 hours, 40 hours, 41 hours, 42 hours, 43 hours, 44 hours, 45 hours, 46 hours, 47 hours, 48 hours, 1 day,
  • a therapeutic agent such as a composition disclosed herein is“A” and a second agent, such as an additional agent, chemotherapeutic, or checkpoint inhibitor described herein or known in the art is“B”.
  • more than one course of therapy may be employed. It is contemplated that multiple courses may be implemented.
  • the current methods and compositions relate to methods for treating cancer.
  • the cancer comprises a solid tumor.
  • the cancer is non lymphatic.
  • the cancer is breast cancer or colon cancer.
  • compositions of the disclosure may be used for in vivo, in vitro, or ex vivo administration.
  • the route of administration of the composition may be, for example, intratumoral, intracutaneous, subcutaneous, intravenous, intralymphatic, and intraperitoneal administrations.
  • the administration is intratumoral or intralymphatic or peri-tumoral.
  • the compositions are administered directly into a cancer tissue or a lymph node.
  • Tumor refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
  • cancer refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
  • cancer refers to all neoplastic cell growth and proliferation, whether malignant or benign, and all pre-cancerous and cancerous cells and tissues.
  • cancer “cancerous,”“cell proliferative disorder,”“proliferative disorder,” and“tumor” are not mutually exclusive as referred to herein.
  • the cancers amenable for treatment include, but are not limited to, tumors of all types, locations, sizes, and characteristics.
  • the methods and compositions of the disclosure are suitable for treating, for example, pancreatic cancer, colon cancer, acute myeloid leukemia, adrenocortical carcinoma, AIDS-related cancers, AIDS-related lymphoma, anal cancer, appendix cancer, astrocytoma, childhood cerebellar or cerebral basal cell carcinoma, bile duct cancer, extrahepatic bladder cancer, bone cancer, osteosarcoma/malignant fibrous histiocytoma, brainstem glioma, brain tumor, cerebellar astrocytoma brain tumor, cerebral astrocytoma/malignant glioma brain tumor, ependymoma brain tumor, medulloblastoma brain tumor, supratentorial primitive neuroectodermal tumors brain tumor, visual pathway and hypothalamic glioma, breast cancer, specific breast cancers such as
  • compositions are administered to a subject. Different aspects involve administering an effective amount of a composition to a subject.
  • a composition comprising an inhibitor may be administered to the subject or patient to treat cancer or reduce the size of a tumor. Additionally, such compounds can be administered in combination with an additional cancer therapy.
  • compositions can be formulated for parenteral administration, e.g., formulated for injection via the intravenous, transcatheter injection, intraarterial injection, intramuscular, sub cutaneous, or even intraperitoneal routes.
  • parenteral administration e.g., formulated for injection via the intravenous, transcatheter injection, intraarterial injection, intramuscular, sub cutaneous, or even intraperitoneal routes.
  • such compositions can be prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for use to prepare solutions or suspensions upon the addition of a liquid prior to injection can also be prepared; and, the preparations can also be emulsified.
  • the preparation of such formulations will be known to those of skill in the art in light of the present disclosure.
  • Other routes of administration include intratumoral, peri-tumoral, intralymphatic, injection into cancer tissue, and injection into lymph nodes. In some embodiments, the administration is systemic.
  • the constructs and agents may be administered in association with a carrier.
  • the carrier is a nanoparticle or microparticle.
  • the nanoparticle or microparticle is a tumor directed nanoparticle or microparticle.
  • the carrier may further comprise a targeting moiety that directs the carrier to the tumor.
  • the targeting moiety may be a binding agent (e.g. antibody, including scFv, etc. or other antigen binding agent) that specifically recognizes tumor cells.
  • the construct is enclosed within the carrier.
  • the construct is covalently or non-covalently attached to the surface of the carrier.
  • the carrier is a liposome.
  • a carrier molecule described herein is excluded.
  • Particles can have a structure of variable dimension and known variously as a microsphere, microparticle, nanoparticle, nanosphere, or liposome. Such particulate formulations can be formed by covalent or non-covalent coupling of the construct to the particle. In some embodiments, particles described herein are excluded.
  • the pharmaceutical forms suitable for injectable use include sterile aqueous solutions or dispersions; formulations including sesame oil, peanut oil, or aqueous propylene glycol; and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions.
  • the form must be sterile and must be fluid to the extent that it may be easily injected. It also should be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms, such as bacteria and fungi.
  • the carrier also can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils.
  • the proper fluidity can be maintained, for example, by the use of a coating, such as lecithin, by the maintenance of the required particle size in the case of dispersion, and by the use of surfactants.
  • the prevention of the action of microorganisms can be brought about by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, thimerosal, and the like.
  • isotonic agents for example, sugars or sodium chloride.
  • Prolonged absorption of the injectable compositions can be brought about by the use in the compositions of agents delaying absorption, for example, aluminum monostearate and gelatin.
  • Sterile injectable solutions are prepared by incorporating the active compounds in the required amount in the appropriate solvent with various of the other ingredients enumerated above, as required, followed by filtered sterilization.
  • dispersions are prepared by incorporating the various sterilized active ingredients into a sterile vehicle which contains the basic dispersion medium and the required other ingredients from those enumerated above.
  • the preferred methods of preparation are vacuum-drying and freeze-drying techniques, which yield a powder of the active ingredient, plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the term“pharmaceutically acceptable” refers to those compounds, materials, compositions, and/or dosage forms which are, within the scope of sound medical judgment, suitable for contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem complications commensurate with a reasonable benefit/risk ratio.
  • pharmaceutically acceptable carrier means a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting a chemical agent.
  • “pharmaceutically acceptable salts” refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form.
  • pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like.
  • Pharmaceutically acceptable salts include the conventional non-toxic salts or the quaternary ammonium salts of the parent compound formed, for example, from non-toxic inorganic or organic acids.
  • the pharmaceutically acceptable salts can be synthesized from the parent compound which contains a basic or acidic moiety by conventional chemical methods.
  • unit dose or“dosage” refers to physically discrete units suitable for use in a subject, each unit containing a predetermined quantity of the composition calculated to produce the desired responses discussed above in association with its administration, i.e., the appropriate route and regimen.
  • the quantity to be administered both according to number of treatments and unit dose, depends on the effects desired. Precise amounts of the composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting dose include physical and clinical state of the subject, route of administration, intended goal of treatment (alleviation of symptoms versus cure), and potency, stability, and toxicity of the particular composition.
  • solutions Upon formulation, solutions will be administered in a manner compatible with the dosage formulation and in such amount as is therapeutically or prophylactically effective.
  • the formulations are easily administered in a variety of dosage forms, such as the type of injectable solutions described above.
  • a subject is administered about, at least about, or at most about 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9,
  • a dose may be administered on an as needed basis or every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 18, or 24 hours (or any range derivable therein) or 1, 2, 3, 4, 5, 6, 7, 8, 9, or times per day (or any range derivable therein).
  • a dose may be first administered before or after signs of a condition.
  • the patient is administered a first dose of a regimen 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 hours (or any range derivable therein) or 1, 2, 3, 4, or 5 days after the patient experiences or exhibits signs or symptoms of the condition (or any range derivable therein).
  • the patient may be treated for 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more days (or any range derivable therein) or until symptoms of the condition have disappeared or been reduced or after 6, 12, 18, or 24 hours or 1, 2, 3, 4, or 5 days after symptoms of an infection have disappeared or been reduced.
  • SA Serum albumin
  • CBD collagen binding domain
  • Dox tumor vascular permeability doxorubicin
  • Dox-CBD-SA efficiently stimulated host anti-tumor immunity, resulting in the complete eradication of MC38 colon carcinoma when used in combination with anti -PD- 1 checkpoint inhibitor.
  • Dox-CBD- SA decreased adverse events compared to aldoxorubicin.
  • engineered CBD-SA could be a versatile and clinically-relevant drug conjugate carrier protein for treatment of solid tumors.
  • Doxorubicin is a small molecule anticancer drug that is approved for treating a broad spectrum of cancers by the US Food and Drug Administration (FDA). Dox internalizes within cells via passive transmembrane diffusion and interferes with DNA functions, leading to death of proliferating cells. Although Dox treatment prolongs survival of some populations of patients, anti-tumor efficacy is not dramatic partially due to acquired drug resistance. The poor therapeutic index of Dox also limits its therapeutic use. Indeed, considerable toxicity of Dox has been reported in the clinic, including bone marrow suppression, excessive inflammation, and cardiotoxicity (13, 14). To improve efficacy, Dox is often used in combination with other chemotherapeutic agents.
  • FDA US Food and Drug Administration
  • CBD-SA recombinant mouse SA
  • the inventors designed recombinant mouse SA (CBD-SA) in which the N-terminus is fused with the C-terminus of the VWF A3 domain, and aldoxorubicin was conjugated to CBD-SA via a pH-dependent cleavable hydrazone linkage prior to injection (namely, Dox-CBD-SA) (21).
  • the inventors evaluated engineered CBD-SA as a tumor-targeted drug carrier, leading to improved anti-tumor efficacy by efficient Dox delivery to the tumor microenvironment.
  • CBD-SA binds to collagen and can be conjugated to Dox
  • the inventors synthesized Dox-CBD-SA conjugates to target the tumor microenvironment (FIG. 1 A, B).
  • the inventors first investigated the binding abilities of CBD- SA to recombinant collagen protein in vitro.
  • SA was expressed recombinantly, with the CBD on the N-terminus of mouse SA using a (GGGS)2 linker (SEQ ID NO:3).
  • the molecular weight of CBD-SA was analyzed by MALDI-TOF MS (FIG. 6). Strong binding affinities (nM range dissociation constant (Kd) values) of CBD-SA to collagen type I and type III were observed (FIG. 1C, FIG. 7).
  • the inventors For Dox conjugation, the inventors first thiolated the lysine residues of CBD-SA using 2-iminothiolane (also known as Traut’s reagent). Then, aldoxorubicin was covalently conjugated to CBD-SA. Unmodified SA was also conjugated with aldoxorubicin in the same way (Dox-SA). SDS-polyacrylamide gel electrophoresis (PAGE) under non-reducing condition showed that purified Dox-SA and Dox-CBD-SA are monomeric (FIG. 8). Before and after Dox conjugation, the hydrodynamic size of CBD-SA was measured (FIG. 9).
  • the inventors compared the intracellular localization of Dox conjugates with free drug using confocal laser scanning microscopy by detecting the fluorescence of Dox. Because Dox is a major drug for breast cancer (23), here the inventors chose mouse mammary tumor virus-polyomavirus middle T antigen (MMTV-PyMT) murine breast cancer as an experimental model.
  • MMTV-PyMT mouse mammary tumor virus-polyomavirus middle T antigen
  • the MMTV-PyMT cells were cultured in the presence of Dox or Dox conjugates and then their intracellular uptake was assessed (FIG. IF). After 1 h of incubation, free Dox was detected in cytoplasm, intracellular acidic organelles, and preferentially in the nucleus, indicating that its delivery is mediated by passive transmembrane diffusion.
  • Dox-CBD-SA demonstrates comparable blood plasma pharmacokinetics as aldoxorubicin and accumulates in tumors
  • Aldoxorubicin reacts with endogenous SA rapidly after intravenous (i.v.) administration, therefore it possesses substantially longer blood plasma half-life compared with Dox (18).
  • the inventors tested the plasma pharmacokinetics of aldoxorubicin with or without prior conjugation of SA and CBD-SA using tumor-free FVB mice. After i.v. injection, similar blood plasma half-life of aldoxorubicin, Dox-SA, and Dox-CBD-SA were observed (FIG. 2A, B).
  • the inventors also examined the plasma pharmacokinetics of fluorescently labeled SA and CBD-SA with a pH-insensitive linker (FIG. 12). The result showed that the half-lives of each protein conjugated with either Dox or dye were similar, suggesting that Dox liberation from the conjugates does not occur in the blood circulation.
  • CBD-fusion to SA would increase the amount of Dox within the tumor via active targeting against collagens within the tumor microenvironment.
  • the inventors measured the amounts of Dox within tumor tissues after a single i.v. administration.
  • Dox-CBD-SA showed significantly higher tumor accumulation of Dox compared to aldoxorubicin and Dox-SA at 2 h post administration (FIG. 2C).
  • Conjugation with CBD-SA achieved the highest tumor accumulation of Dox after 24 h of injection as well, showing a significant increase compared to aldoxorubicin.
  • Dox-CBD-SA showed a greater therapeutic effect compared to Dox- SA.
  • Dox-CBD-SA treatment significantly extended the survival rate compared to all the other groups (FIG. 3B) and induced complete tumor remission in 2 mice out of 12.
  • Dox reportedly induces ICD, which stimulates immune responses against antigens from necrotic cells (15). Indeed, ICD increases the number of tumor-infiltrating lymphocytes (TILs), which is a marker of favorable prognosis in multiple types of cancers such as colorectal cancer and breast cancer (24, 25).
  • TILs tumor-infiltrating lymphocytes
  • the inventors analyzed the TILs after Dox-CBD-SA treatment, particularly T cells and natural killer (NK) cells. Lymphocytes were extracted from the tumor and analyzed by flow cytometry 7 days after treatment with the various Dox forms.
  • Dox-CBD-SA but not aldoxorubicin or Dox-SA, significantly increased the numbers of CD8 + T cells, CD4 + T cells, and NK cells within the tumor per unit tumor mass (FIG. 3G-I).
  • Dox-CBD-SA treatment increased the number of CD8 + T cells more than two-fold higher than the other treatment groups (FIG. 3G).
  • Plots of individual tumor size and TIL cell number revealed Dox-CBD-SA indeed induced a correlation between small tumor size and the number of tumor-infiltrated CD8 + T cells, CD4 + T cells and NK cells (FIG. 3 J-L).
  • aPD-1 is used in combination with Dox in clinical trials (e.g. NCT02648477).
  • the inventors examined the anti-tumor effect of aldoxorubicin and Dox- CBD-SA in combination with aPD-1 using the MC38 colon carcinoma model, which is immunogenic (27), but not curable by Dox monotherapy (28).
  • C57BL/6 mice were inoculated subcutaneously with 5 x lO 5 MC38 cells.
  • the treatment schedule is shown in FIG. 5A.
  • Aldoxorubicin or Dox-CBD-SA was administered to mice 6, 9, and 12 days after tumor inoculation. Since Dox-CBD-SA increases the number of TILs, the inventors injected 100 pg of aPD-1 one day after Dox treatment for two times (on day 10 and day 13).
  • Dox-CBD-SA + aPD-1 therapy completely eradicated established MC38 tumors (average tumor volume was about 100 mm 3 on day 6, FIG. 5B, G), and significantly prolonged the survival of mice compared to all the other groups (FIG. 5C).
  • Nanoparticle-formulated (17) or SA-reactive (18, 19) doxorubicin exhibits improved pharmacokinetics and accumulation within tumors based in part on their pathologically abnormal vasculature (5).
  • this effect may not always be effective in human cancers because of their heterogeneity (29).
  • drugs that are dependent on passive targeting alone may have room for improvement.
  • Active targeting of tumor-specific or tumor-associated antigens for drug delivery is another therapeutic strategy.
  • CBD-SA engineered CBD-SA to overcome these issues. Unlike other active targeting strategies, CBD-SA does not require the prior investigation of tumor-associated antigen expression, because collagen is nearly ubiquitously expressed in tumors, and the CBD gains access to the tumor stroma via the abnormal blood vessel structure within the tumor microenvironment (6). Subsequently, the CBD-SA binds to exposed collagen (FIG. 1C, FIG. 7) and converts the tumor stroma into a reservoir for chemotherapeutics.
  • Dox conjugation to CBD-SA showed significantly higher accumulation of Dox within tumor tissue compared to aldoxorubicin and Dox-SA (FIG. 2C).
  • the hydrazone linkage which can be cleaved under the slightly acidic conditions in the tumor microenvironment (FIG. IE) (21), enables the sustained release of Dox from CBD-SA.
  • tumor cells uptake SA (1).
  • CBD fusion did not alter the cellular uptake of SA (FIG. IF), indicating that Dox-CBD-SA can also be delivered intracellularly as efficient as Dox-SA.
  • part of the Dox release may occur in the tumor stroma while the Dox-CBD-SA is still matrix-bound, and part may occur in the endolysosomal compartment following endocytosis.
  • the relatively low molecular weight of CBD-SA (88 kDa, FIG. 6) may be a benefit in terms of diffusion into tumor tissues (32).
  • Dox-CBD-SA significantly suppressed the growth of MMTV-PyMT breast cancer and extended the survival of mice compared to aldoxorubicin and Dox-SA (FIG. 3 A-F). Because Dox-CBD-SA showed the highest accumulation into tumor tissue in vivo , Dox-CBD-SA should induce tumor cell death more efficiently via inhibition of tumor cell proliferation. In addition to this effect, a single injection of Dox-CBD-SA brought a long-lasting therapeutic effect in spite of its faster plasma clearance half-life (FIG. 2A, B).
  • Dox-CBD-SA treatment induces a higher number and density of TILs compared to Dox-SA and aldoxorubicin treatments (FIG. 3G-L). Therefore, the anti-tumor mechanism of action of Dox-CBD-SA may be not only direct cell killing, but also the stimulation of host anti-tumor immunity. Since Dox-CBD-SA efficiently accumulates within tumors, it may induce ICD and tumor antigen exposure to the immune system more efficiently than aldoxorubicin and Dox-SA. As a consequence, Dox- CBD-SA synergistically eradicated MC38 colon carcinoma when administered in combination with aPD-1 (FIG. 5B, G).
  • CBD-SA is produced with high yield ( ⁇ 70- 100 mg/L of HEK293 cell culture)
  • the inventors propose that pre-conjugation of Dox to CBD- SA produces high anti-tumor efficacy with a simple and translatable production method.
  • Dox-CBD-SA accumulated into tumors and activated host anti-tumor immunity.
  • monotherapy of Dox-CBD-SA suppressed orthotopic MMTV- PyMT breast tumor growth and prolonged survival.
  • combination therapy of Dox-CBD-SA with immune checkpoint inhibition via aPD-1 completely eradicated tumors in the immunogenic MC38 model.
  • CBD fusion provided an active targeting ability to SA, which is classically used as a passively targeted drug carrier, enabling effective drug delivery to tumors from the systemic circulation.
  • CBD-SA is expected to be non-immunogenic and biologically acceptable, because it is comprised of two proteins (VWF A3 domain and SA) that naturally exist in the blood.
  • CBD-SA acts independency of tumor type-specific antigens and thus provides broad applicability to various types of solid tumors as a drug carrier. Therefore, CBD-SA may hold potential for clinical translation to cancer therapy as an anti tumor drug carrier.
  • This study was designed to verify the strategy for anti-cancer drug delivery to tumors by engineered collagen-binding SA as a drug conjugation carrier. Specifically, the inventors tested if anti-tumor efficacy of Dox-CBD-SA against mouse models of breast cancer and colon carcinoma are improved compared to their unmodified forms. The adverse effects of Dox- CBD-SA were also tested using tumor-free mice. The inventors measured tumor growth, anti cancer immune responses, and multiple aspects of toxicity after treatment. Statistical methods were not used to predetermine required sample size, but sample sizes were determined based on estimates from pilot experiments and previously published results such that appropriate statistical tests could yield significant results. CBD-SA was produced by multiple individuals to ensure reproducibility. All experiments were replicated at least twice except for FIG. 12 (once).
  • mice were randomized into treatment groups within a cage immediately before the first Dox-CBD-SA injection and treated in the same way. Samples were excluded from analysis only when an animal developed a health problem for a non-treatment related reason, according to the animal care guidelines. The survival endpoint was reached when the tumor size became over 500 mm 3 for MMTV-PyMT model, and 600 mm 3 for MC38 model. The n values used to calculate statistics are indicated in the figures or in the figure legends. Drug administration and pathological analyses were performed in a blinded fashion. Statistical methods are described in the“Statistical analysis” section.
  • MMTV-PyMT Mouse mammary tumor virus-polyomavirus middle T antigen (MMTV-PyMT) cells were obtained from spontaneously developed breast cancer in FVB-Tg (MMTV-PyMT) transgenic mice as described previously (9).
  • DMEM Gibco
  • penicillin/streptomycin was used for both cell lines.
  • the cell lines were checked for mycoplasma contamination by an IMPACT I pathogen test (IDEXX BioResearch).
  • mice Female FVB mice, ages 8 to 12 weeks, were obtained from Charles River and Jackson Laboratory. Female C57BL/6 mice, ages 8 to 12 weeks, were obtained from Jackson Laboratory. All the animal experiments performed in this work were approved from the Institutional Animal Care and Use Committee of the University of Chicago.
  • CBD-SA protein was designed, produced and purified similarly to previously reported CBD proteins (9).
  • the sequences encoding for the fusion of human VWF A3 domain residues Cysl670-Glyl874 (907-1111 of mature VWF) and mouse SA without pro-peptide (25-608 amino acids of whole SA) were synthesized and subcloned into the mammalian expression vector pcDNA3.1(+) by Genscript.
  • a sequence encoding for a His-tag (6 His) was inserted at the C-terminus for further purification of the recombinant protein.
  • Suspension- adapted HEK-293F cells were routinely maintained in serum-free FreeStyle 293 Expression Medium (Gibco).
  • CBD-SA was analyzed by MALDI-TOF MS (Bruker Ultraflextreme MALDI TOF/TOF) as described previously (9).
  • Bruker flexControlTM was used for data acquisition, and Bruker flexAnalysisTM was used for data processing.
  • a saturated solution of a-cyano-4-hydroxycinnamic acid (Sigma-Aldrich) was prepared in 50:50 acetonitrile: 1% TFA in water as a solvent.
  • CBD-SA in PBS (5 pL, 0.1 mg/mL) and the matrix solution (25 pL) were mixed, and 1 pL of that mixture was dropped on the MTP 384 ground steel target plate. The drop was dried in a nitrogen gas flow. All samples were analyzed using high mass linear positive mode method with 2500 laser shots at the laser intensity of 75%. The measurements were externally calibrated at three points with a mix of carbonic anhydrase, phosphorylase B, and bovine SA.
  • CBD-SA were detected with tetramethylbenzidine substrate by measurement of the absorbance at 450 nm with subtraction of the absorbance at 570 nm.
  • the apparent Kd values were obtained by nonlinear regression analysis in Prism software (version 7, GraphPad) assuming one-site-specific binding.
  • Dialysate was loaded onto a 96 well black plate in duplicate (90 pL/well). Fluorescence was determined using excitation at 495 nm and emission at 590 nm. Serial dilution of doxorubicin hydrochloride was prepared in the same buffer to create standard curve. 11. Cellular uptake of Dox-conjugates
  • MMTV-PyMT cells were seeded in 96 well high content imaging plate (Corning) at 5000 cells/well and incubated overnight. Cells were washed with PBS, and treated with free Dox, Dox-SA, or Dox-CBD-SA dissolved in DMEM (110 mg/L of sodium pyruvate, 10% heat inactivated FBS, 1% penicillin/streptomycin, Phenol red (-)) at the concentration of 50 mM equivalent of Dox. After the incubation, cells were washed twice, treated with 75 nM of Lysotracker Deep Red and further incubated 30 min at 37°C. Cells were washed twice and observed by 1X83 microscope (Olympus) with x60 magnification. Images were processed using ImageJ software (NIH). Scale bar; 20 pm.
  • MMTV-PyMT cells or MC38 cells were seeded in a 96 well tissue culture plate (BD Falcon) at 3000 cells/well and incubated overnight. Cells were washed with DMEM (110 mg/L of sodium pyruvate, 10% heat inactivated FBS, 1% penicillin/streptomycin, Phenol red (-)), and 80 pL/well of DMEM was added. Then, serial dilutions of aldoxorubicin, Dox-SA, or Dox- CBD-SA in PBS was added (20 pL/well).
  • DMEM 110 mg/L of sodium pyruvate, 10% heat inactivated FBS, 1% penicillin/streptomycin, Phenol red (-)
  • a previous report about polypeptide-Dox nanoparticles was referred (40).
  • Dox equivalent of aldoxorubicin, Dox-SA, or Dox- CBD-SA was injected intravenously into female FVB mice.
  • Blood samples were collected in EDTA coated tubes at 5 min, 30 min, 1 h, 4 h, 12 h, 25 h, 50 h, and 75 h after injection. Blood samples were stored at 4°C until the end of sample collection. The samples were centrifuged (2000 x g, 5min) and plasma was collected.
  • SA and CBD-SA was labeled with DyLight 800 NHS ester (Thermo fisher scientific) according to the manufacturer’s instructions. Unreacted dye was removed by Zeba spin desalting column as described above. After labeling, 200 pg of each protein was injected intravenously into female FVB mice. Blood samples were collected in EDTA coated tubes at 1 min, 1 h, 4 h, 24 h, 74 h, and 120 h after injection. Blood samples were stored at 4°C until the end of sample collection. The samples were centrifuged (2000 x g, 5min) and plasma was collected. Plasma samples were diluted in PBS and loaded into a 96 well black plate (100 pL/well). The concentration of each protein in plasma was measured with a LI-COR Infrared Odyssey Imager (Li-COR Biosciences). The method of curve fitting and calculation of plasma half-life was described above.
  • TILs tumor infiltrating lymphocytes
  • the MC38 murine colon carcinoma model was prepared similarly to B16F10 melanoma model as described previously (9). A total of 5 c 10 5 MC38 cells suspended in 50 pL of PBS were injected intradermally on the left side of the back of each C57BL/6 mouse. Mice were injected i.v. on day 6, 9, 12 with aldoxorubicin, Dox-SA or Dox-CBD-SA (5 mg/kg). Mice were also treated i.p. with 100 pg of anti-PD-1 (Clone 29F.1 A12, Bio X Cell) on day 10 and 13. Tumor growth was monitored as described above. Mice were sacrificed when tumor volume had reached over 600 mm 3 or when active ulceration was observed. On day 60, naive C57BL/6 mice or tumor-free survivors were re-challenged by intradermal injection of 5 x 10 5 MC38 cells.
  • MMTV-PyMT model was prepared as described above. Mice were treated on day 7 with aldoxorubicin, Dox-SA or Dox-CBD-SA (5 mg/kg). Mice were sacrificed on day 14. Cell suspensions were obtained from each tumor as described previously (9). Tumors were harvested and digested in Dulbecco's Modified Eagle Medium (DMEM) supplemented with 2% FBS, 2 mg/mL collagenase D and 40 pg/mL DNase I (Roche) for 30 min at 37°C. Single cell suspensions were obtained by gently disrupting the organs through a 70 pm cell strainer. Red blood cells were lysed with ACK lysing buffer (Quality Biological).
  • DMEM Dulbecco's Modified Eagle Medium
  • Fixable live/dead cell discrimination was performed using Fixable Viability Dye eFluor 455 (eBioscience) according to the manufacturer’s instructions. Following a washing step, cells were stained with specific antibodies for 20 min on ice prior to fixation. Following antibodies were used to stain the cells: CD3 (145-2C11, BD Biosciences), CD4 (RM4-5, BD Biosciences), CD8a (53-6.7, BD Biosciences), CD45 (30-F11, BD Biosciences), and Kl . l (PK136, BD Biosciences). All flow cytometric analyses were done using a Fortessa flow cytometer (BD Biosciences) and analyzed using FlowJo software (Tree Star).
  • Tumor-free FVB mice received 20 mg/kg of aldoxorubicin or Dox-CBD-SA by intravenous injection. Blood samples were collected from each mouse in EDTA-coated tube by submandibular bleeding on day 3 and day 6 after injection for plasma cytokine analysis and hematological analysis. Body weight of each mouse was measured at indicated time points. On day 16, mice were sacrificed and organs were harvested. Spleens were weighed, and the other organs were used for histological analysis. Mice were sacrificed when more than 15% decrease of initial body weight was observed.
  • BMS-936561 (MDX-1203), an antibody-drug conjugate targeting CD70. Cancer Chemother. Pharmacol. 77, 155-162 (2016).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Hematology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Oncology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Biomedical Technology (AREA)
  • Toxicology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
PCT/US2020/070113 2019-06-03 2020-06-03 Methods and compositions for treating cancer with collagen binding drug carriers Ceased WO2020247974A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
CN202080055104.6A CN114173822B (zh) 2019-06-03 2020-06-03 用胶原结合药物载体治疗癌症的方法和组合物
EP20818032.3A EP3976111A4 (en) 2019-06-03 2020-06-03 Methods and compositions for treating cancer with collagen binding drug carriers
BR112021024438A BR112021024438A2 (pt) 2019-06-03 2020-06-03 Métodos e composições para tratar câncer com carreadores de fármaco de ligação de colágeno
AU2020289485A AU2020289485A1 (en) 2019-06-03 2020-06-03 Methods and compositions for treating cancer with collagen binding drug carriers
MX2021014932A MX2021014932A (es) 2019-06-03 2020-06-03 Métodos y composiciones para tratar cáncer con portadores de fármacos que se enlazan al colágeno.
JP2021571671A JP7680375B2 (ja) 2019-06-03 2020-06-03 コラーゲン結合薬物担体を用いてがんを処置するための方法および組成物
CA3144535A CA3144535A1 (en) 2019-06-03 2020-06-03 Methods and compositions for treating cancer with collagen binding drug carriers
US17/596,118 US20220298225A1 (en) 2019-06-03 2020-06-03 Methods and compositions for treating cancer with collagen binding drug carriers
JP2025077691A JP2025121986A (ja) 2019-06-03 2025-05-08 コラーゲン結合薬物担体を用いてがんを処置するための方法および組成物

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962856468P 2019-06-03 2019-06-03
US62/856,468 2019-06-03

Publications (1)

Publication Number Publication Date
WO2020247974A1 true WO2020247974A1 (en) 2020-12-10

Family

ID=73652058

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/070113 Ceased WO2020247974A1 (en) 2019-06-03 2020-06-03 Methods and compositions for treating cancer with collagen binding drug carriers

Country Status (9)

Country Link
US (1) US20220298225A1 (https=)
EP (1) EP3976111A4 (https=)
JP (2) JP7680375B2 (https=)
CN (1) CN114173822B (https=)
AU (1) AU2020289485A1 (https=)
BR (1) BR112021024438A2 (https=)
CA (1) CA3144535A1 (https=)
MX (1) MX2021014932A (https=)
WO (1) WO2020247974A1 (https=)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPWO2024177006A1 (https=) * 2023-02-20 2024-08-29
US12605394B2 (en) 2024-07-25 2026-04-21 Visionary Assets, Llc Compositions containing cannabinoid nanoparticles

Citations (24)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US4879236A (en) 1984-05-16 1989-11-07 The Texas A&M University System Method for producing a recombinant baculovirus expression vector
US5053394A (en) 1988-09-21 1991-10-01 American Cyanamid Company Targeted forms of methyltrithio antitumor agents
WO1993021232A1 (en) 1992-04-10 1993-10-28 Research Development Foundation IMMUNOTOXINS DIRECTED AGAINST c-erbB-2 (HER-2/neu) RELATED SURFACE ANTIGENS
US5770710A (en) 1987-10-30 1998-06-23 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group
WO1998042752A1 (en) 1997-03-21 1998-10-01 Brigham And Women's Hospital Inc. Immunotherapeutic ctla-4 binding peptides
US5871986A (en) 1994-09-23 1999-02-16 The General Hospital Corporation Use of a baculovirus to express and exogenous gene in a mammalian cell
US5877296A (en) 1994-06-03 1999-03-02 American Cyanamid Company Process for preparing conjugates of methyltrithio antitumor agents
WO2000037504A2 (en) 1998-12-23 2000-06-29 Pfizer Inc. Human monoclonal antibodies to ctla-4
US6087329A (en) 1991-10-25 2000-07-11 Immunex Corporation CD40 ligand polypeptide
WO2001014424A2 (en) 1999-08-24 2001-03-01 Medarex, Inc. Human ctla-4 antibodies and their uses
WO2006121168A1 (en) 2005-05-09 2006-11-16 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics
WO2009101611A1 (en) 2008-02-11 2009-08-20 Curetech Ltd. Monoclonal antibodies for tumor treatment
WO2009114335A2 (en) 2008-03-12 2009-09-17 Merck & Co., Inc. Pd-1 binding proteins
WO2010027827A2 (en) 2008-08-25 2010-03-11 Amplimmune, Inc. Targeted costimulatory polypeptides and methods of use to treat cancer
WO2011066342A2 (en) 2009-11-24 2011-06-03 Amplimmune, Inc. Simultaneous inhibition of pd-l1/pd-l2
US8017114B2 (en) 1999-08-24 2011-09-13 Medarex, Inc. Human CTLA-4 antibodies and their uses
US8119129B2 (en) 2008-08-01 2012-02-21 Bristol-Myers Squibb Company Combination of anti-CTLA4 antibody with dasatinib for the treatment of proliferative diseases
WO2012112690A2 (en) * 2011-02-16 2012-08-23 Fabius Biotechnology Targeting of therapeutic drugs and diagnostic agents employing collagen binding domains
US8354509B2 (en) 2007-06-18 2013-01-15 Msd Oss B.V. Antibodies to human programmed death receptor PD-1
US20140022021A1 (en) 2012-07-17 2014-01-23 Murata Manufacturing Co Power amplifier
US8735553B1 (en) 2013-09-13 2014-05-27 Beigene, Ltd. Anti-PD1 antibodies and their use as therapeutics and diagnostics
US20140294898A1 (en) 2013-03-15 2014-10-02 Bristol-Myers Squibb Company Macrocyclic inhibitors of the pd-1/pd-l1 and cd80(b7-1)/pd-l1 protein/protein interactions
US20160106858A1 (en) * 2014-09-29 2016-04-21 Counterpoint Biomedica Llc Targeting of pharmaceutical agents to pathologic areas using bifunctional fusion polymers

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101808751B1 (ko) * 2009-11-13 2017-12-13 그리폴스 테라퓨틱스 인코포레이티드 폰 빌레브란트 인자(vWF)-함유 제제, 및 그와 관련된 방법, 키트 및 용도
JP6508785B2 (ja) * 2013-10-25 2019-05-08 ファーマサイクリックス エルエルシー ブルトンチロシンキナーゼ阻害剤および免疫療法を使用する処置
EP3094650A2 (en) * 2014-01-13 2016-11-23 Pieris Pharmaceuticals GmbH Multi-specific polypeptide useful for localized tumor immunomodulation
WO2016033331A1 (en) * 2014-08-28 2016-03-03 Bioatla, Llc Conditionally active chimeric antigen receptors for modified t-cells
WO2017106656A1 (en) * 2015-12-17 2017-06-22 Novartis Ag Antibody molecules to pd-1 and uses thereof
AU2019366956B2 (en) * 2018-10-23 2025-10-30 Dragonfly Therapeutics, Inc. Heterodimeric Fc-fused proteins

Patent Citations (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4554101A (en) 1981-01-09 1985-11-19 New York Blood Center, Inc. Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity
US4879236A (en) 1984-05-16 1989-11-07 The Texas A&M University System Method for producing a recombinant baculovirus expression vector
US5770710A (en) 1987-10-30 1998-06-23 American Cyanamid Company Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methlytrithio group
US5053394A (en) 1988-09-21 1991-10-01 American Cyanamid Company Targeted forms of methyltrithio antitumor agents
US6087329A (en) 1991-10-25 2000-07-11 Immunex Corporation CD40 ligand polypeptide
WO1993021232A1 (en) 1992-04-10 1993-10-28 Research Development Foundation IMMUNOTOXINS DIRECTED AGAINST c-erbB-2 (HER-2/neu) RELATED SURFACE ANTIGENS
US5877296A (en) 1994-06-03 1999-03-02 American Cyanamid Company Process for preparing conjugates of methyltrithio antitumor agents
US5871986A (en) 1994-09-23 1999-02-16 The General Hospital Corporation Use of a baculovirus to express and exogenous gene in a mammalian cell
WO1998042752A1 (en) 1997-03-21 1998-10-01 Brigham And Women's Hospital Inc. Immunotherapeutic ctla-4 binding peptides
US6207156B1 (en) 1997-03-21 2001-03-27 Brigham And Women's Hospital, Inc. Specific antibodies and antibody fragments
WO2000037504A2 (en) 1998-12-23 2000-06-29 Pfizer Inc. Human monoclonal antibodies to ctla-4
WO2001014424A2 (en) 1999-08-24 2001-03-01 Medarex, Inc. Human ctla-4 antibodies and their uses
US8017114B2 (en) 1999-08-24 2011-09-13 Medarex, Inc. Human CTLA-4 antibodies and their uses
WO2006121168A1 (en) 2005-05-09 2006-11-16 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics
US8008449B2 (en) 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
US8354509B2 (en) 2007-06-18 2013-01-15 Msd Oss B.V. Antibodies to human programmed death receptor PD-1
WO2009101611A1 (en) 2008-02-11 2009-08-20 Curetech Ltd. Monoclonal antibodies for tumor treatment
US20110008369A1 (en) 2008-03-12 2011-01-13 Finnefrock Adam C Pd-1 binding proteins
WO2009114335A2 (en) 2008-03-12 2009-09-17 Merck & Co., Inc. Pd-1 binding proteins
US8119129B2 (en) 2008-08-01 2012-02-21 Bristol-Myers Squibb Company Combination of anti-CTLA4 antibody with dasatinib for the treatment of proliferative diseases
WO2010027827A2 (en) 2008-08-25 2010-03-11 Amplimmune, Inc. Targeted costimulatory polypeptides and methods of use to treat cancer
WO2011066342A2 (en) 2009-11-24 2011-06-03 Amplimmune, Inc. Simultaneous inhibition of pd-l1/pd-l2
WO2012112690A2 (en) * 2011-02-16 2012-08-23 Fabius Biotechnology Targeting of therapeutic drugs and diagnostic agents employing collagen binding domains
US20140022021A1 (en) 2012-07-17 2014-01-23 Murata Manufacturing Co Power amplifier
US20140294898A1 (en) 2013-03-15 2014-10-02 Bristol-Myers Squibb Company Macrocyclic inhibitors of the pd-1/pd-l1 and cd80(b7-1)/pd-l1 protein/protein interactions
US8735553B1 (en) 2013-09-13 2014-05-27 Beigene, Ltd. Anti-PD1 antibodies and their use as therapeutics and diagnostics
US20160106858A1 (en) * 2014-09-29 2016-04-21 Counterpoint Biomedica Llc Targeting of pharmaceutical agents to pathologic areas using bifunctional fusion polymers

Non-Patent Citations (41)

* Cited by examiner, † Cited by third party
Title
"Genbank", Database accession no. L15006
A. PLUENY. BOUCHERS. RAMANUJANT. D. MCKEET. GOHONGIE. DI TOMASOE. B. BROWNY. IZUMIR. B. CAMPBELLD. A. BERK: "Role of tumor-host interactions in interstitial diffusion of macromolecules: cranial vs. subcutaneous tumors.", PROC. NATL. ACAD. SCI. U.S.A., vol. 98, 2001, pages 4628 - 4633
C. ADDIF. MURSCHELG. DE CRESCENZO: "Design and use of chimeric proteins containing a collagen-binding domain for wound healing and bone regeneration", TISSUE ENG. PART B. REV, vol. 23, 2017, pages 163 - 182, XP055800565, DOI: 10.1089/ten.teb.2016.0280
C. CHAUDHURYS. MEHNAZJ. M. ROBINSONW. L. HAYTOND. K. PEARLD. C. ROOPENIANC. L. ANDERSON: "The major histocompatibility complex-related Fc receptor for IgG (FcRn) binds albumin and prolongs its lifespan", J. EXP. MED., vol. 197, 2003, pages 315 - 322, XP002417289, DOI: 10.1084/jem.20021829
C. HOLOHANS. VAN SCHAEYBROECKD. B. LONGLEYP. G. JOHNSTON: "Cancer drug resistance: an evolving paradigm", NAT. REV. CANCER, vol. 13, 2013, pages 714 - 726, XP055252550, DOI: 10.1038/nrc3599
F. DANHIERO. FERONV. PREAT: "To exploit the tumor microenvironment: passive and active tumor targeting of nanocarriers for anti-cancer drug delivery.", J. CONTROL. RELEASE, vol. 148, 2010, pages 135 - 146, XP027509904, DOI: 10.1016/j.jconrel.2010.08.027
F. KRATZ, A. WARNECKE, K. SCHEUERMANN, C. STOCKMAR, J. SCHWAB, P. LAZAR, P. DRUCKES, N. ESSER, J. DREVS, D. ROGNAN: "Probing the cysteine-34 position of endogenous serum albumin with thiol-binding doxorubicin derivatives. Improved efficacy of an acid-sensitive doxorubicin derivative with specific albumin-binding properties compared to that of the parent compound. ", J. MED. CHEM., vol. 45, 2002, pages 5523 - 5533
F. KRATZ: "Albumin as a drug carrier: design of prodrugs, drug conjugates and nanoparticles", J. CONTROL. RELEASE, vol. 132, 2008, pages 171 - 183
G. KROEMERL. GALLUZZIO. KEPPL. ZITVOGEL: "Immunogenic cell death in cancer therapy", ANNU. REV. IMMUNOL., vol. 31, 2013, pages 51 - 72
G. STEHLEH. SINNA. WUNDERH. H. SCHRENKS. SCHIITTW. MAIER-BORSTD. L. HEENE: "The loading rate determines tumor targeting properties of methotrexate-albumin conjugates in rats", ANTICANCER. DRUGS, vol. 8, 1997, pages 677 - 685, XP009029047, DOI: 10.1097/00001813-199708000-00006
G. TAKEMURAH. FUJIWARA: "Doxorubicin-induced cardiomyopathy: from the cardiotoxic mechanisms to management.", PROG. CARDIOVASC. DIS., vol. 49, 2007, pages 330 - 352
G. WHITEP. J. KEELY: "Collagen density promotes mammary tumor initiation and progression", BMC MED., vol. 6, 2008, pages 11, XP021037892
H. M. KUERERL. A. NEWMANT. L. SMITHF. C. AMESK. K. HUNTK. DHINGRAR. L. THERIAULTG. SINGHS. M. BINKLEYN. SNEIGE: "Clinical course of breast cancer patients with complete pathologic primary tumor and axillary lymph node response to doxorubicin-based neoadjuvant chemotherapy.", J. CLIN. ONCOL., vol. 17, 1999, pages 460 - 469
J. A. MACKAYM. CHENJ. R. MCDANIELW. LIUA. J. SIMNICKA. CHILKOTI: "Self-assembling chimeric polypeptide-doxorubicin conjugate nanoparticles that abolish tumours after a single injection", NAT. MATER., vol. 8, 2009, pages 993 - 999
J. MORALES: "Defining the role of insulin detemir in basal insulin therapy", DRUGS, vol. 67, 2007, pages 2557 - 2584
J. PRAKASHL. BELJAARSA. K. HARAPANAHALLIM. ZEINSTRA-SMITHA. DE JAGER-KRIKKENM. HESSINGH. STEENK. POELSTRA: "Tumor-targeted intracellular delivery of anticancer drugs through the mannose-6-phosphate/insulin-like growth factor II receptor", INT. J. CANCER, vol. 126, 2010, pages 1966 - 1981
J. RIOS-DORIAN. DURHAML. WETZELR. ROTHSTEINJ. CHESEBROUGHN. HOLOWECKYJW. ZHAOC. C. LEOWR. HOLLINGSWORTH: "Doxil synergizes with cancer immunotherapies to enhance antitumor responses in syngeneic mouse models", NEOPLASIA, vol. 17, 2015, pages 661 - 670, XP002753467, DOI: 10.1016/j.neo.2015.08.004
K. M. HARGADONC. E. JOHNSONC. J. WILLIAMS: "Immune checkpoint blockade therapy for cancer: an overview of FDA-approved immune checkpoint inhibitors", INT. IMMUNOPHARMACOL., vol. 62, 2018, pages 29 - 39, XP055637409, DOI: 10.1016/j.intimp.2018.06.001
K. M. ROPPONENM. J. ESKELINENP. K. LIPPONENE. ALHAVAV. M. KOSMA: "Prognostic value of tumour-infiltrating lymphocytes (TILs) in colorectal cancer", J. PATHOL., vol. 182, 1997, pages 318 - 324
K. TEMMINGD. L. MEYERR. ZABINSKIE. C. DIJKERSK. POELSTRAG. MOLEMA, RJ. KOK: "Evaluation of RGD-targeted albumin carriers for specific delivery of auristatin E to tumor blood vessels", BIOCONJUG. CHEM., vol. 17, 2006, pages 1385 - 1394
L. WANGQ. CHENH. QIC. WANGC. WANGJ. ZHANGL. DONG: "Doxorubicin-induced systemic inflammation is driven by upregulation of toll-like receptor TLR4 and endotoxin leakage", CANCER RES., vol. 76, 2016, pages 6631 - 6642
M. A. SWARTZJ. A. HUBBELL: "Targeted antibody and cytokine cancer immunotherapies through collagen affinity.", SCI. TRANSL. MED. IN PRESS
M. E. O'BRIENN. WIGLERM. INBARR. ROSSOE. GRISCHKEA. SANTOROR. CATANED. KIEBACKP. TOMCZAKS. ACKLAND: "Reduced cardiotoxicity and comparable efficacy in a phase III trial of pegylated liposomal doxorubicin HCl (CAELYXTm/Doxi1g) versus conventional doxorubicin for first-line treatment of metastatic breast cancer", ANN. ONCOL., vol. 15, 2004, pages 440 - 449
M. GREENG. MANIKHASS. ORLOVB. AFANASYEVA. MAKHSONP. BHARM. HAWKINS: "Abraxane®, a novel Cremophor®-free, albumin-bound particle form of paclitaxel for the treatment of advanced non-small-cell lung cancer", ANN. ONCOL., vol. 17, 2006, pages 1263 - 1268
M. J. MCCALLH. DIRILC. F. MEARES: "Simplified method for conjugating macrocyclic bifunctional chelating agents to antibodies via 2-iminothiolane", BIOCONJUG. CHEM., vol. 1, 1990, pages 222 - 226, XP002397026, DOI: 10.1021/bc00003a007
M. PRABAHARANJ. J. GRADERS. PILLAD. A. STEEBERS. GONG: "Amphiphilic multi-arm-block copolymer conjugated with doxorubicin via pH-sensitive hydrazone bond for tumor-targeted drug delivery", BIOMATERIALS, vol. 30, 2009, pages 5757 - 5766, XP026470002, DOI: 10.1016/j.biomaterials.2009.07.020
M. YADAVS. JHUNJHUNWALAQ. T. PHUNGP. LUPARDUSJ. TANGUAYS. BUMBACAC. FRANCIT. K. CHEUNGJ. FRITSCHET. WEINSCHENK: "Predicting immunogenic tumour mutations by combining mass spectrometry and exome sequencing.", NATURE, vol. 515, 2014, pages 572 - 576
M. YASUNAGAS. MANABED. TARINY. MATSUMURA: "Cancer-stroma targeting therapy by cytotoxic immunoconjugate bound to the collagen 4 network in the tumor tissue.", BIOCONJUG. CHEM, vol. 22, 2011, pages 1776 - 1783
N. DIAMANTISU. BANERJI: "Antibody-drug conjugates-an emerging class of cancer treatment", BR. J. CANCER, vol. 114, 2016, pages 362 - 367, XP055371017, DOI: 10.1038/bjc.2015.435
P. W. FISHERF. SALLOUMA. DASH. HYDERR. C. KUKREJA: "Phosphodiesterase-5 inhibition with sildenafil attenuates cardiomyocyte apoptosis and left ventricular dysfunction in a chronic model of doxorubicin cardiotoxicity", CIRCULATION, vol. 111, 2005, pages 1601 - 1610
R. C. YOUNG, R. F. OZOLS, C. E. MYERS: "The anthracycline antineoplastic drugs.", J. MED., vol. 305, 1981, pages 139 - 153, XP009040331
R. FLISIAKI. FLISIAK: "Albinterferon-alfa 2b: a new treatment option for hepatitis C", EXPERT. OPIN. BIOL. THER., vol. 10, 2010, pages 1509 - 1515
R. GRAESERN. ESSERH. UNGERI. FICHTNERA. ZHUC. UNGERF. KRATZ: "INNO-206, the (6-maleimidocaproyl hydrazone derivative of doxorubicin), shows superior antitumor efficacy compared to doxorubicin in different tumor xenograft models and in an orthotopic pancreas carcinoma model", INVEST. NEW DRUGS, vol. 28, 2010, pages 14 - 19, XP019768224
R. KUAIW. YUANS. SONJ. NAMY. XUY. FANA. SCHWENDEMANJ. J. MOON: "Elimination of established tumors with nanodisc-based combination chemoimmunotherapy", SCI. ADV., vol. 4, 2018, pages 1736
S. LOIN. SIRTAINEF. PIETTER. SALGADOG. VIALEF. VAN EENOOG. ROUASP. FRANCISJ. P. CROWNE. HITRE: "Prognostic and predictive value of tumor-infiltrating lymphocytes in a phase III randomized adjuvant breast cancer trial in node-positive breast cancer comparing the addition of docetaxel to doxorubicin with doxorubicin-based chemotherapy: BIG 02-98", J. CLIN. ONCOL., vol. 31, 2013, pages 860 - 867, XP055248124, DOI: 10.1200/JCO.2011.41.0902
S. P. CHAWLAZ. PAPAIG. MUKHAMETSHINAK. SANKHALAL. VASYLYEVA. FEDENKOK. KHAMLYK. GANJOOR. NAGARKARS. WIELAND: "First-line aldoxorubicin vs doxorubicin in metastatic or locally advanced unresectable soft-tissue sarcoma: a phase 2b randomized clinical trial.", JAMA ONCOL., vol. 1, 2015, pages 1272 - 1280
T. H. C. BRONDIJKD. BIHANR. W. FARNDALEE. G. HUIZINGA: "Implications for collagen I chain registry from the structure of the collagen von Willebrand factor A3 domain complex", PROC. NATL. ACAD. SCI. U.S.A., vol. 109, 2012, pages 5253 - 5258, XP002693782, DOI: 10.1073/pnas.1112388109
T. K. OWONIKOKOA. HUSSAINW. M. STADLERD. C. SMITHH. KLUGERA. M. MOLINAP. GULATIA. SHAHC. M. AHLERSP. M. CARDARELLI: "First-in-human multicenter phase I study of BMS-936561 (MDX-1203), an antibody-drug conjugate targeting CD70", CANCER CHEMOTHER. PHARMACOL., vol. 77, 2016, pages 155 - 162
U. PRABHAKARH. MAEDAR. K. JAINE. M. SEVICK-MURACAW. ZAMBONIO. C. FAROKHZADS. T. BARRYA. GABIZONP. GRODZINSKID. C. BLAKEY: "Challenges and key considerations of the enhanced permeability and retention effect for nanomedicine drug delivery in oncology.", CANCER RES., vol. 73, 2013, pages 2412 - 2417
Y. MATSUMURAH. MAEDA: "A new concept for macromolecular therapeutics in cancer chemotherapy: mechanism of tumoritropic accumulation of proteins and the antitumor agent smancs", CANCER RES., vol. 46, 1986, pages 6387 - 6392, XP002084436
Z.-H. ZHOUC.-D. JIH.-L. XIAOH.-B. ZHAOY.-H. CUIX.-W. BIAN: "Reorganized Collagen in the Tumor Microenvironment of Gastric Cancer and Its Association with Prognosis", J. CANCER, vol. 8, 2017, pages 1466 - 1476

Also Published As

Publication number Publication date
JP2025121986A (ja) 2025-08-20
AU2020289485A1 (en) 2022-02-03
CN114173822A (zh) 2022-03-11
JP7680375B2 (ja) 2025-05-20
US20220298225A1 (en) 2022-09-22
BR112021024438A2 (pt) 2022-02-15
CA3144535A1 (en) 2020-12-10
CN114173822B (zh) 2025-01-10
EP3976111A1 (en) 2022-04-06
EP3976111A4 (en) 2023-07-05
JP2022535816A (ja) 2022-08-10
MX2021014932A (es) 2022-04-06

Similar Documents

Publication Publication Date Title
US20230377764A1 (en) Methods and compositions for treating cancer with ecm-affinity peptides linked to immunotherapeutic antibodies
CA2989269C (en) Hydrophilic linkers for conjugation of a cytotoxic agent or chromophore molecule to a cell-binding molecule
AU2017408164A1 (en) Conjugation of a cytotoxic drug with bis-linkage
IL322637A (en) Amanita toxin bracelet with branched connectors
CN113286616A (zh) 分子佐剂
JP2025121986A (ja) コラーゲン結合薬物担体を用いてがんを処置するための方法および組成物
WO2019173289A1 (en) Methods and compositions for treating cancer with ecm-affinity peptides linked to cytokines
WO2025247082A1 (en) An antibody-drug conjugate having two or more different functional small molecules for enhanced treatment of refractory diseases.
US20220305135A1 (en) Methods and compositions for treating cancer with cancer-targeted adjuvants
CA3151322A1 (en) Combination therapy with immune stimulatory conjugates
CA3225815A1 (en) Il-2/il-15rbetagamma agonist combination with antibody-drug conjugates for treating cancer
KR20250004774A (ko) 개선된 약동학적 특성 및 약물 방출 특성을 갖는 리간드-약물-접합체
WO2025128735A2 (en) B7-h4 antibody-drug conjugates and methods of use thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20818032

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2021571671

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021024438

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 3144535

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020818032

Country of ref document: EP

Effective date: 20220103

ENP Entry into the national phase

Ref document number: 2020289485

Country of ref document: AU

Date of ref document: 20200603

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112021024438

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20211202

WWG Wipo information: grant in national office

Ref document number: 202080055104.6

Country of ref document: CN