WO2020247843A2 - Fusions of mutant interleukin-2 polypeptides with antigen binding molecules for modulating immune cell function - Google Patents
Fusions of mutant interleukin-2 polypeptides with antigen binding molecules for modulating immune cell function Download PDFInfo
- Publication number
- WO2020247843A2 WO2020247843A2 PCT/US2020/036454 US2020036454W WO2020247843A2 WO 2020247843 A2 WO2020247843 A2 WO 2020247843A2 US 2020036454 W US2020036454 W US 2020036454W WO 2020247843 A2 WO2020247843 A2 WO 2020247843A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- polypeptide
- amino acid
- fusion protein
- mutant
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CCN(*)C(CC*)C(C)CCCC(C*)C(C)C Chemical compound CCN(*)C(CC*)C(C)CCCC(C*)C(C)C 0.000 description 2
- VLHQPYOMLKCLSG-UHFFFAOYSA-N CC(C)C(C)(C)C(F)(F)F Chemical compound CC(C)C(C)(C)C(F)(F)F VLHQPYOMLKCLSG-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
- A61K47/6813—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin the drug being a peptidic cytokine, e.g. an interleukin or interferon
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
- C07K14/54—Interleukins [IL]
- C07K14/55—IL-2
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2815—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD8
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/74—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor
- C07K2319/75—Fusion polypeptide containing domain for protein-protein interaction containing a fusion for binding to a cell surface receptor containing a fusion for activation of a cell surface receptor, e.g. thrombopoeitin, NPY and other peptide hormones
Definitions
- the present disclosure discloses mutant interleukin-2 polypeptides, and fusion polypeptides comprising the mutant interleukin-2 polypeptides and antigen binding molecules.
- the present disclosure provides methods of modulating immune cell function by contacting the immune cell with fusion polypeptides of the present disclosure.
- the present disclosure also provides polynucleotides encoding the disclosed fusion proteins, and vectors and host cells comprising such polynucleotides.
- the present disclosure further provides methods for producing the fusion proteins, pharmaceutical compositions comprising the same, and uses thereof.
- Interleukin-2 is a cytokine that regulates many lymphocyte subsets, including alpha beta CD4+ and CD8 T+ cells, and various innate and innate-like lymphocytes such as NK cells, NK T cells, gamma delta T cells (Tgd) cells, and innate lymphoid cells (ILC1, ILC2, and ILC3 cells). Binding of IL-2 to its receptor induces the phosphorylation of receptor-associated Janus kinases, JAK3 and JAK1, which promote the phosphorylation of STAT5 transcription factor (pSTAT5) that regulates transcription of many genes in lymphocytes.
- pSTAT5 transcription factor STAT5 transcription factor
- IL-2 signaling in lymphocytes promotes cell survival, proliferation, and increased effector function, including pro-inflammatory cytokine secretion and cytotoxic function, and in some cases, activation-induced cell death (reviewed in Ross & Cantrell, Annu Rev Immunol. 2018 Apr 26;36:411-433).
- IL-2 can signal by binding with an intermediate affinity to a receptor complex consisting of IL-2RP and IL-2Ry subunits (IL-2RPy, intermediate affinity receptor), both of which are required and sufficient to trigger downstream signaling in immune cells.
- IL-2 binds with high affinity to a receptor complex consisting of IL-2Ra, IL-2RP, and IL-2Ry subunits (IL- 2Ra.Py, high affinity receptor) (Stauber et al, Proc Natl Acad Sci U S A. 2006 Feb.
- IL-2Ra expression is restricted to CD4+ Treg cells, activated T
- IL-2RP and IL-2Ry subunits are shared with another related cytokine, IL-15, and IL- 2Ry subunit is shared among other common gamma chain cytokines (IL-4, IL-7, IL-9, and IL- 21).
- IL-4, IL-7, IL-9, and IL- 21 common gamma chain cytokines
- Most innate and innate-like lymphocytes including NK cells, NK T cells, Tgd cells, and ILC1, ILC2, and ILC3 cells express high levels of IL-2RP (ImmGen consortium; Heng TS et al, Immunological Genome Project Consortium. Nat Immunol. 2008 Oct;9(10): 1091-4), which also makes them sensitive to both IL-2 and IL-15 cytokines.
- IL-2 induced-toxicities set the limitation on the number of doses that patients could receive, and IL-2 treatment requires strict patient-eligibility criteria and administration by experienced physicians (Schwartz et al, Oncology (Williston Park). 2002 Nov;16(l l Suppl 13): 11 -20).
- IL-2-activated cells strongly bind to endothelial cells leading to their lysis, and IL-2 induces pulmonary edema via its interaction with functional IL-2 receptors on endothelial cells (reviewed in Milling et al, Adv Drug Deliv Rev. 2017 May 15; 114: 79- 101).
- Blocking of the IL-2 interaction with IL-2Ra abrogated pulmonary edema in animal models (Krieg et al, Proc Natl Acad Sci U S A. 2010 Jun 29; 107(26): 11906-11).
- NK cells have been shown to cause toxicity of IL-2 in mice through their hyper-activation and secretion of multiple inflammatory cytokines when IL-2 was administered together with IFN-a (Rothschilds et al, Oncoimmunology. 2019 Feb 19;8(5): el 558678).
- NK cells were also shown to cause toxicity of the cytokine IL-15 that also signals through IL-2RPy (GUO et al, J Immunol. 2015 Sep l;195(5):2353-64).
- This NK cell hyper activation in response to IL-2RPy signaling is likely due to their high expression of IL-2RP and ability to rapidly secrete inflammatory cytokines in response to activation.
- other innate lymphocytes that also express high levels of IL-2RP may play a role in systemic toxicities observed with systemic administration of IL-2.
- CD8+ T cells have been shown to mediate efficacy of
- CD8+ T cells express CD8, which is a type I transmembrane glycoprotein found on the cell surface as a CD8 alpha (CD8a, CD8a) homodimer and CD8 alpha-CD8 beta (CD8P, CD8b) heterodimer.
- CD8 dimers interact with the major histocompatibility (MHC) class I molecules on target cells and this interaction keeps the TCR closely engaged with MHC during CD8 + T cell activation.
- MHC major histocompatibility
- the cytoplasmic tail of CD8a contains binding sites for a T cell kinase (Lck) that initiates signal transduction downstream of the TCR during T cell activation, while the role of CD8P is thought to be in increasing the avidity of CD8 binding to MHC class I and influencing specificity of the CD8/MHC/TCR interaction (Bosselut et al, Immunity. 2000 Apr; 12(4): 409- 18).
- Lck T cell kinase
- Intratumoral T cells were recently shown to express PD1 in multiple human cancers (Gros et al, J Clin Invest. 2014 May;124(5):2246-59; Egelston etl al, Nat Commun. 2018 Oct 16;9(1):4297; T Subscriben et al, Nat Med. 2018 Jul;24(7):994-1004).
- PD1 is a type I
- transmembrane protein that contains an extracellular domain, a transmembrane region and a cytoplasmic tail.
- the cytoplasmic tail contains phosphorylation sites that are part of an immunoreceptor tyrosine-based inhibitory motif (ITIM) that can recruit intracellular
- ITIM immunoreceptor tyrosine-based inhibitory motif
- phosphatases such as SHP-1 and SHP-2.
- PD1 negatively regulates TCR signaling by binding to its ligands PD-L1 and PD-L2.
- the interaction between PD1 and its ligands is blocked by several approved anti -PD 1 and anti-PD-Ll antibodies as a treatment for cancer (Ribas & Wolchok, Science. 2018 Mar 23;359(6382): 1350-1355).
- PD1 High expression of PD1 on intratumoral T cells is associated with specificity for tumor antigens, and the frequency of these PD1+ T cells in tumors was associate with response to anti- PD1 antibodies (Tansn et al, Nat Med. 2018 Jul;24(7): 994- 1004).
- PD1 is also expressed on peripheral blood CD8+ and CD4+ memory and effector T cells, albeit at a lower level than on tumor antigen-specific intratumoral T cells, and it can also be expressed on T cells residing in healthy tissues.
- other cell types such as Tregs, Tgd, NK T and ILC2 cells can also express PD1.
- the goal was to reduce the toxicity of IL-2 and improve its efficacy by enhancing its activity on CD8+ T cells or PD1+ T cells that have been associated with efficacy in preclinical cancer models and cancer patients and reducing its activity on other cells that have been associated with toxicity and undesired effects of IL-2, including Tregs and innate lymphoid cells.
- mutant IL-2 polypeptides wherein the mutant IL-2 polypeptides have one, two or more, or three or more amino acid substitutions (i.e. mutations) relative to the wild-type mature IL-2 amino acid sequence, e.g., as depicted in Pig 1A (SEQ ID NO: 1) and Fig 2.
- the mutant IL-2 polypeptides exhibit reduced binding affinity to IL-2Ra polypeptide having an amino acid sequence depicted in Fig IB (SEQ ID NO:2), compared to the binding affinity of the wild-type IF-2 polypeptide.
- the mutant IF-2 polypeptides exhibit reduced binding affinity to IF-2Ra polypeptide having an amino acid sequence depicted in Fig IB (SEQ ID NO:2), compared to the binding affinity of the wild-type IF-2 polypeptide; and exhibit reduced binding affinity to IF- 2RP polypeptide having an amino acid sequence depicted in Fig 1C (SEQ ID NO: 3), compared to the binding affinity of the wild-type IF-2 polypeptide.
- the mutant IF-2 polypeptides exhibit reduced binding affinity to IF-2Ra polypeptide having an amino acid sequence depicted in Fig IB (SEQ ID NO:2), compared to the binding affinity of the wild-type IF-2 polypeptide; and exhibit reduced binding affinity to IL-2Ry polypeptide having an amino acid sequence depicted in Fig ID (SEQ ID NO:4) compared to the binding affinity of the wild- type IF-2 polypeptide.
- the mutant IF-2 polypeptides exhibit reduced binding affinity to IF-2Ra polypeptide having an amino acid sequence depicted in Fig IB (SEQ ID NO:2), compared to the binding affinity of the wild-type IF-2 polypeptide; exhibit reduced binding affinity to IF-2RP polypeptide having an amino acid sequence depicted in Fig 1C (SEQ ID NO: 3), compared to the binding affinity of the wild-type IF-2 polypeptide; and exhibit reduced binding affinity to IL-2Ry polypeptide having an amino acid sequence depicted in Fig ID (SEQ ID NO:4) compared to the binding affinity of the wild-type IF-2 polypeptide.
- mutant IF-2 polypeptides exhibit improved biophysical properties compared to the wild-type IF-2 polypeptide.
- Mutant IF-2 polypeptides disclosed herein due to their decreased binding affinity for IF- 2R complex, have decreased ability, compared to wild-type IF-2, to bind to and/or stimulate immune cells associated with undesired effects of IF-2 on efficacy, such as Tregs, or with toxicity of IF-2, such as innate lymphoid cells, including NK cells.
- disclosed mutant IF-2 polypeptides also have decreased ability, compared to wild-type IF-2, to bind to and/or activate desired IF-2R-expressing immune cells, such as CD8+ T cells, that have been associated with efficacy in preclinical cancer models and response to immune therapy in patients.
- mutant IF-2 polypeptides In order to turn disclosed mutant IF-2 polypeptides into therapeutics that could be both safer and more effective for the treatment of cancer and other immune-related diseases such as certain infectious diseases, we designed fusion proteins comprising of disclosed mutant IF-2 polypeptides and antigen binding molecules, such as antibodies, for antigens present on CD8+ T cells, such as CD8 and PD1.
- antigen binding molecules such as antibodies
- Such fusion proteins comprising mutant IL-2 polypeptides and antibodies binding specific antigens are also referred to as“targeted” fusion proteins as they bind to antigens recognized by the antigen binding molecules of the fusion. This distinguishes them from “untargeted” fusion proteins comprising mutant IL-2 polypeptides and control antibodies that do not bind to any particular antigens (i.e. Fc fusions or control antibody fusions with IL-2 polypeptides; Zhu et al, Cancer Cell. 2015 Apr 13;27(4):489-501).
- Figure 3 depicts the general mechanism for how antigen binding molecules binding to an antigen on CD8+ T cells could work to increase the binding and/or stimulation of CD8+ T cells by the mutant IL-2 polypeptides in the context of the disclosed targeted fusion proteins containing said mutant IL-2 polypeptides.
- Certain antigen binding molecules when fused to mutant IL-2 polypeptides, have the ability to substantially increase the binding and/or activity of the mutant IL-2 polypeptides only on cells expressing the antigen for the antigen binding molecule of the fusion, resulting in preferential activation of antigen-expressing over antigen-non expressing cells (Fig 3).
- Fig 3 unlike targeted fusion proteins, untargeted fusion proteins containing the same mutant IL-2 polypeptide, do not preferentially bind to and/or activate antigen-expressing cells (Fig 3).
- the difference in activation of antigen-expressing over antigen-non expressing cells by the targeted fusion protein, and the difference in activation of antigen-expressing cells by the targeted and the untargeted fusion protein are important for the effectiveness of the targeted fusion protein as a therapeutic and can be measured experimentally.
- the first moiety comprises an antibody heavy chain VH-CH1- hinge-CH2-CH3 monomer wherein VH is a variable heavy chain and CH2-CH3 is a Fc domain, an antibody light chain VL-CL wherein VL is a variable light chain and CL is a constant light chain, and a mutant IL-2 polypeptide, wherein the N-terminus of the mutant IL-2 polypeptide is fused to the C-terminus of the Fc domain via a linker; and the second moiety comprises an antibody heavy chain VH-CHl-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; wherein, both the first and second moiety bind to an epitope on one antigen selected from the following group: human CD8a, human CD8P, and human PD1.
- the first moiety is a polypeptide comprising an antibody hinge-CH2-CH3 monomer wherein CH2-CH3 is a Fc domain, and a mutant IL-2 polypeptide, wherein the N-terminus of the mutant IL-2 polypeptide is fused to the C-terminus end of the Fc domain via a linker; and 5he second moiety is a polypeptide comprising an antibody heavy chain VH-CHl-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; wherein the second moiety binds to an epitope on one antigen selected from the following group: human CD8a, human CD8P, and human PD1.
- the first moiety is a polypeptide comprising an antibody hinge-CH2-CH3 monomer wherein CH2-CH3 is a Fc domain, and a mutant IL-2 polypeptide, wherein the C- terminus of the mutant IL-2 polypeptide is fused to the N-terminus end of the Fc domain via a linker; and the second moiety is a polypeptide comprising an antibody heavy chain VH-CH1- hinge-CH2-CH3 monomer and an antibody light chain VL-CL; wherein the second moiety binds to an epitope on one antigen selected from the following group: human CD8a, human CD8P, and human PD1.
- the first moiety comprises an antigen-binding domain that binds to human CD8a or human CD8P; and the second moiety comprises a mutant IL-2 polypeptide; wherein the second moiety is linked to the first moiety via a linker ( e.g ., the second moiety is fused to the first moiety).
- said mutant IL-2 polypeptide exhibits reduced binding affinity by 50% or more to IL-2Ra polypeptide having an amino acid sequence of SEQ ID NO:2, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO: l .
- said mutant IL-2 polypeptide exhibits reduced binding affinity by 50% or more to IL-2Ra polypeptide having an amino acid sequence of SEQ ID NO:2, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO: l, and reduced binding affinity by 50% or more to IL-2RP polypeptide having an amino acid sequence of SEQ ID NO: 3, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO: 1.
- said mutant IL-2 polypeptide exhibits reduced binding affinity by 50% or more to IL-2Ra polypeptide having an amino acid sequence of SEQ ID NO:2, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO: 1, and reduced binding affinity by 50% or more to IL-2Ry polypeptide having an amino acid sequence of SEQ ID NO:4, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO: 1.
- said mutant IL-2 polypeptide exhibits reduced binding affinity by 50% or more to IL-2Ra polypeptide having an amino acid sequence of SEQ ID NO:2, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO: l, and reduced binding affinity by 50% or more to IL-2RP polypeptide having an amino acid sequence of SEQ ID NO: 3, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO: 1, and reduced binding affinity by 50% or more to IL-2Ry polypeptide having an amino acid sequence of SEQ ID NO: 4, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence of SEQ ID NO: 1.
- binding affinity of a mutant IL-2 polypeptide to IL-2Ra is measured by comparing activation of a Treg cell by a fusion protein of the present disclosure (e.g., comprising an anti-CD8 antigen-binding domain of the present disclosure and the mutant IL-2 polypeptide), as compared to activation of a Treg cell by wild-type IL-2, and by comparing activation of a NK cell (expressing IL-2Rbg) by a fusion protein of the present disclosure (e.g., comprising an anti-CD8 antigen-binding domain of the present disclosure and the mutant IL-2 polypeptide), as compared to activation of a NK cell by wild-type IL-2 or an IL-2 polypeptide with no binding to IL-2Ra and wild-type like binding to IL-2Rb and IL2Rg.
- binding affinity to IL-2RP or IL-2Ry of a mutant IL-2 polypeptide with reduced or no binding affinity to IL-2Ra is measured by comparing activation of a cell expressing IL-2RP and IL-2Ry by a fusion protein of the present disclosure (e.g., comprising an anti-CD 8 antigen-binding domain of the present disclosure and the mutant IL-2 polypeptide), as compared to activation of a cell expressing IL-2RP or IL-2Ry by wild-type IL-2 or an IL-2 polypeptide with no binding to IL-2Ra and wild-type like binding to IL-2Rb and IL2Rg.
- a fusion protein of the present disclosure e.g., comprising an anti-CD 8 antigen-binding domain of the present disclosure and the mutant IL-2 polypeptide
- a mutant IL-2 polypeptide with reduced or no binding to IL-2Ra can be optionally further mutated and tested for activation of cells that express IL-2Ra/p/y, e.g., Treg cells or IL-2bg, i.e. NK cells. Since the mutant IL-2 polypeptide has no binding to IL-2Ra, the ability to activate, or the potency of activation of, cells that express IL-2Ra/p/y can be used as an assay for binding of the mutant IL-2 polypeptide or fusion protein to IL-2Rp/y.
- the fusion protein activates CD8+ T cells with 10-fold or greater potency, or 50-fold or greater potency, as compared to activation of NK cells.
- said mutant IL-2 polypeptide comprises the sequence of SEQ ID NO: 1 with one or more or two or more amino acid substitutions relative to SEQ ID NO: 1, and wherein the substitutions are at positions of SEQ ID NO: l selected from the group consisting of: Qll, H16, L18, L19, D20, Q22, R38, F42, K43, Y45, E62, P65, E68, V69, L72, D84, S87, N88, V91, 192, T123, Q126, S127, 1129, and S130.
- said mutant IL-2 polypeptide comprises an F42A or F42K amino acid substitution relative to SEQ ID NO: 1. In some embodiments, said mutant IL-2 polypeptide further comprises an R38A, R38D, R38E, E62Q, E68A, E68Q, E68K, or E68R amino acid substitution relative to SEQ ID NO: 1.
- said mutant IL-2 polypeptide further comprises an H16E, H16D, D20N, M23A, M23R, M23K, S87K, S87A, D84L, D84N, D84V, D84H, D84Y, D84R, D84K, N88A, N88S, N88T, N88R, N88I, V91A, V91T, V91E, I92A, E95S, E95A, E95R, T123A, T123E, T123K, T123Q, Q126A, Q126S, Q126T, Q126E, SI 27 A, S127E, S127K, or S127Q ammo acid substitution relative to SEQ ID NO: 1.
- said mutant IL-2 polypeptide comprises an amino acid sequence selected from the group consisting of SEQ ID Nos: 18-88. In some embodiments, said mutant IL-2 polypeptide comprises the amino acid sequence of SEQ ID NO: l with one of the following sets of amino acid substitutions (relative to the sequence of SEQ ID NO: l): R38E and F42A; R38D and F42A; F42A and E62Q; R38A and F42K; R38E, F42A, and N88S; R38E, F42A, and N88A; R38E, F42A, and V91E; R38E, F42A, and D84H; H16D, R38E and F42A; H16E, R38E and F42A; R38E, F42A and Q126S; R38D, F42A and N88S; R38D, F42A and N88A; R38D, F42A and V91E; R38D, F42A, and D
- said mutant IL-2 polypeptide comprises the amino acid sequence of any of: IL-2ml, IL-2m2, IL-2m3, IL-2m4, IL-2m4.9, IL- 2m4.10, IL-2m4.11 , IL-2m4.12, IL-2m4.13, IL-2m4.14, IL-2m4.15, IL-2m4.16, IL-2m4.17, IL- 2m4.2, IL-2m4.1 , IL-2m4.6, IL-2m4.18, IL-2m4.4, IL-2m4.19, IL-2m4.5, IL-2m4.20, IL-2m4.3, IL-2m4.21, IL-2m4.22, IL-2m4.23, IL-2m4.24, IL-2m5, IL-2m6, IL-2m7, IL-2m8, IL-2m9, IL- 2m 10, IL-2ml0.1, IL-2ml0.2, IL-2ml0.3, IL-2ml0.4, IL-2ml0.5, IL-2m-4,
- the fusion protein binds human CD8, and binding of the fusion protein to CD8 does not block the interaction of CD8 with MHC class I.
- said mutant IL-2 polypeptide further comprises the amino acid mutation C125A compared to SEQ ID NO: 1.
- said first and second Fc domains comprise the following Fc mutations according to EU numbering: L234A, L235A, G237A, and K322A.
- said first Fc domain comprises the following amino acid substitutions: Y349C and T366W
- said second Fc domain comprises the following amino acid substitutions: S354C, T366S, L368A and Y407V, according to EU numbering
- said second Fc domain comprises the following amino acid substitutions: Y349C and T366W
- said first Fc domain comprises the following amino acid substitutions: S354C, T366S, L368A and Y407V, according to EU numbering.
- the fusion protein has or exhibits one or more of the following properties: the fusion protein binds human CD8, and the binding of the fusion protein to CD8 does not block the interaction of CD8 with MHC class I; and the fusion protein activates CD8+ T cells with 10-fold or greater potency, as compared to activation of NK cells.
- potency of activation of CD8+ T cells and NK cells is measured by EC50 of cell activation, as assessed by cell proliferation ( e.g ., a Ki67 assay).
- potency of activation of CD8+ T cells and NK cells is measured by EC50 of cell activation, as assessed by STAT5 activation (e.g., pSTAT5 assay).
- inventions of the present disclosure relate to isolated polynucleotide(s) (e.g., one or more) encoding the mutant IL-2 polypeptides or fusion protein according to any one of the above embodiments.
- vector(s) e.g., one or more encoding the mutant IL-2 polypeptides, fusion protein, or isolated polynucleotide(s) according to any one of the above embodiments.
- the vector(s) e.g., one or more
- host cells e.g., isolated and/or recombinant host cells
- polynucleotide(s) and/or vector(s) according to any one of the above embodiments.
- host cells e.g., isolated and/or recombinant host cells
- polynucleotide(s) and/or vector(s) according to any one of the above embodiments.
- Other aspects of the present disclosure relate to
- compositions comprising the fusion protein according to any one of the above embodiments and a pharmaceutically acceptable carrier.
- Other aspects of the present disclosure relate to uses of the fusion proteins or pharmaceutical compositions according to any one of the above embodiments as a medicament.
- Other aspects of the present disclosure relate to uses of the fusion proteins or pharmaceutical compositions according to any one of the above embodiments in the manufacture of a medicament.
- Other aspects of the present disclosure relate to uses of the fusion proteins or pharmaceutical compositions according to any one of the above embodiments in a method of treating cancer or chronic infection, wherein said method comprises administering to a patient in need thereof an effective amount of the fusion protein or pharmaceutical composition.
- aspects of the present disclosure relate to uses of the fusion proteins or pharmaceutical compositions according to any one of the above embodiments in a method of treating cancer, wherein said method comprises administering to a patient in need thereof an effective amount of the fusion protein or pharmaceutical composition in combination with a T cell therapy, cancer vaccine, chemotherapeutic agent, or immune checkpoint inhibitor (ICI).
- a T cell therapy cancer vaccine, chemotherapeutic agent, or immune checkpoint inhibitor (ICI).
- ICI immune checkpoint inhibitor
- compositions according to any one of the above embodiments in the manufacture of a medicament for treating cancer or chronic infection relate to methods of treating cancer or chronic infection, comprising administering to a patient in need thereof an effective amount of the fusion protein or pharmaceutical composition according to any one of the above embodiments.
- methods of treating cancer comprising administering to a patient in need thereof an effective amount of the fusion protein or pharmaceutical composition according to any one of the above embodiments.
- the ICI is an inhibitor of PD-1, PD-L1, or CTLA-4.
- disclosed targeted IL-2 fusion proteins containing antigen binding molecules activate antigen-expressing IL-2RP+ cells, such as CD8+ T cells, over antigen-non expressing IL-2RP+ cells, such as NK cells, by at least 10 fold, 50 fold, 100 fold, or at least 200 fold.
- disclosed fusion proteins activate antigen-expressing IL-2RP+ cells more than 50 fold, 100 fold, or at least 200 fold, e.g., compared to a fusion protein comprising the said IL-2 mutant polypeptide and a control antibody not binding to any antigens expressed on said cells.
- Said cell activation by the IL-2 fusion protein is determined in an in vitro assay by measuring the expression of pSTAT5 or the cell proliferation marker Ki67 in said cells following treatment with said IL-2 fusion protein.
- the present disclosure accomplishes to reduce the pleiotropic effects of IL-2 on every immune cell expressing the IL-2R complex down to a subset of effects by reducing the effects of IL-2 to certain immune cell subsets of interest, such as CD8+ T cells.
- Such reduction aims to reduce the toxicity of IL-2 polypeptides when administered as therapeutics by directing their action on subsets of T cells that contain tumor antigen-specific CD8+ T cells or viral antigen-specific CD8+ T cells thus sparring: 1) T cells that may not contribute to efficacy; or 2) innate lymphocytes that express receptors for IL-2 and are systemically distributed and may contribute to toxicity; 3) other immune cells that can act as a sink for IL-2 or negatively contribute to efficacy.
- FIGS. 1A-1D show the amino acid sequences of mature IL-2 (FIG. 1A; SEQ ID NO: l), IL-2Roc (FIG. IB; SEQ ID NO:2), IL-2Rp ( FIG. 1C; SEQ ID NO:3) and IL-2Ry (FIG. ID;
- SEQ ID NO:4 polypeptides.
- FIG. 2 shows the amino acid sequence of wild-type mature IL-2 polypeptide (SEQ ID NO: l).“X” denotes the amino acid substituted in the sequence of wild-type IL-2 polypeptide for another amino acid to generate mutant IL-2 polypeptides of the present disclosure.
- FIG. 3 shows the general mechanism for how targeted fusions of mutant IL-2 polypeptides with CD8 or PD1 antigen binding molecules, and untargeted fusions with mutant IL-2 polypeptides work to stimulate cells expressing or not expressing CD8 or PD1 antigens.
- FIG. 4 depicts three different fusion protein formats (formats A, B, and C), in accordance with some embodiments.
- FIG. 5 shows the activation of STAT5 in different mouse splenic cell subsets stimulated with therapeutic human IL-2 (left) and an IL-2 variant with no binding to IL-2Ra and wild type binding to IL-2Rp and IL-2RY (right).
- STAT5 activation in splenic subsets was measured by flow cytometry.
- Activation of STAT5 in splenic cell subsets stimulated with IL-2 is shown at left.
- NK cells were found to be more sensitive to IL-2 and IL-2 variant with reduced binding to CD25/IL2Ra than CD 8 T cells.
- FIGS. 6A & 6B show the NK-cell induced toxicity of IL-2 variant with reduced binding to CD25 in mice.
- B6 mice of 8-10 weeks of age were injected subcutaneously with a single dose of indicated compounds and their body weights recorded daily.
- FIG. 6A shows the weight recordings for mice treated with xHA-IL-2v co-dosed with anti-PDl (xPDl) at 2.5 mg/kg.
- FIG. 6B shows the weight recordings for mice treated with the same IL-2v fused to an antibody targeting an antigen expressed in the tumor (tumor antigen/TAg) TAg-IL-2v.
- TAg-IL-2v was dosed alone at 5 mg/kg.
- NK cells were depleted with anti-NKl.
- NK cells induced toxicity, which manifested as body weight loss in mice treated with IL-2 variant with reduced binding CD25/IL2Ra.
- FIG. 7 shows the determination of binding of anti-mouse CD8 antibodies to CD8+ T cells.
- Fresh splenocytes were incubated with the indicated antibodies for 2 hours at 4 °C.
- the cells were then stained with antibodies against CD3, CD4, CD8 and anti-hFc.
- anti-hFc was used to measure the binding of CD8-IL2 fusion containing hFc.
- Cells were washed and analyzed by flow cytometry.
- Mean fluorescence intensity (MFI) of staining with anti-hFc is used to denote binding.
- xmCD8ab2 (published clone YTS156.7.7) had higher affinity than xmCD8abl
- xCD8ab2.1 is a lower affinity variant of xCD8ab2 that was generated by introducing two mutations in xCD8ab2.
- FIG. 8 shows the MHC blocking status for anti-mouse CD8 antibodies.
- CD8+ T cells were purified from splenocytes from OT-I mice and co-cultured with EL-4-OVA expressing line (E.G7-OVA, CRL-2113; ATCC), at 100,000 cells each for 24 hr. Cells were analyzed for upregulation of activation markers such as CD25 and CD69 by cell surface staining and flow cytometry. Both xCD8abl and xCD8ab2 blocked T cell activation, as measured by % of cells expressing CD25. xCD8ab2 blocked T cell activation more potently, correlating with its higher binding affinity to CD 8.
- FIG. 9 shows the selective targeting of CD8 T cells over other immune cells expressing IL-2R by human IL-2 muteins fused to CD8 antibodies.
- IL-2 muteins were fused to previously published anti-mouse CD8 antibody, xmCD8abl (2.43 clone), in format B (depicted in the diagram at left).
- STAT5 activation in mouse splenocytes was measured by flow cytometry.
- IL-2 mutein variants fused to CD8 antibodies selectively targeted CD8+ T cells (top left graph) over other immune cells expressing IL-2R, such as NK cells identified as CD3-CD49b+ (top right), CD4+ CD25- Tconv cells (bottom left), and CD4+ CD25+ Treg cells (bottom right).
- NK cells identified as CD3-CD49b+ (top right), CD4+ CD25- Tconv cells (bottom left), and CD4+ CD25+ Treg cells (bottom right).
- FIG. 10 shows the efficacy of a single dose of CD8-IL-2 over a single dose of TAg-IL- 2v in combination with anti-PDl in a B16 cold tumor model.
- mice were weighed and dosed subcutaneously under the scruff of the neck with the indicated compounds (10 mice/group): PBS (top left), xmCD8abl-IL2mlO at lmg/kg (top middle), xmCD8ab2-IL2mlO at lmg/kg (top right), xPDl at 5mg/kg (bottom left), TAg-IL-2v at lmg/kg (bottom middle), or TAg-IL-2v at 3mg/kg (bottom right).
- Tumor volume and body weight were measured every 3-4 days until either the end of study (30-40 days post initial dose) or until a max tumor volume (2000 mm 3 ) was reached.
- FIGS. 11A & 11B show the induction of CD8 T cell accumulation in the blood and tumor of mice with B16 tumors treated with a single dose CD8-IL-2.
- B6 mice were injected with B16 tumor cells and tumors allowed to grow to 200-250 mm 3 before they were dosed with indicated IL-2 fusions at lmg/kg together with 5mg/kg of xPDl .
- Cells from tumors and blood were collected and profiled by flow cytometry to detect CD8+ T cells and NK cells (NK1.1+CD3-), as indicated.
- FIG. 11A shows the immune cell counts in the blood
- FIG. 11B shows the immune cells count in the tumor. More CD 8+ T cells were observed in the tumor with xmCD8-IL2mlO than xHA-IL-2v.
- FIGS. 12A-12C show the performance of a single dose of CD8-IL-2 and single dose of TAg-IL-2v in a CT26 tumor model.
- xmCD8ab2-IL2m4 at 0.3mg/kg (FIG. 12C).
- Tumor volumes and body weights were measured every 3-4 days until either the end of the study (30 days post initial dose) or until a max tumor volume (2000 mm 3 ) was reached. Complete regression of tumor (CR) is denoted when applicable.
- xmCD8-IL2m4 performed better than TAg-IL-2v in CT26 tumor model.
- FIG. 13 shows the impact of CD8 antibody affinity on fusion potency in vitro.
- Cells were treated with IL-2 mutein IL-2m4 fused to xmCD8ab2 or its lower affinity variant xmCD8ab2.1 in format C.
- STAT5 activation in CD8+ T cells (left) and NK cell (right) was measured by flow cytometry.
- xmCD8ab2.1-IL2m4 had lower potency and lower selectivity for CD8 T cells over NK cells compared to xmCD8ab2-IL-2m4.
- FIG. 14 shows the in vivo expansion of CD8+ T cells treated with xmCD8ab2-IL2m4 and xmCD8ab2.1-IL2m4.
- Naive B6 mice were treated with the indicated compounds at 1 mg/kg and blood collected on day 5 post dose. Cells were stained with lineage markers to identify CD8+ T cells and NK cells and profiled by flow cytometry.
- Both xmCD8ab2-IL2m4 and xmCD8ab2.1-IL2m4 expanded CD8 T cells in vivo. Both fusions induced higher in vivo expansion of CD8 T cells than NK cells.
- FIGS. 15A & 15B show the characterization of xmCD8-IL-2 muteins with no binding to IL-2Ra and one additional mutation fused to a high affinity CD8 antibody in a STAT5 assay.
- Splenocytes from B6 mice bearing B16 tumors incubated with indicated protein then stained for cell surface markers (CD3, CD4, CD8, CD25, CD49b) and for intracellular phospho-STAT5 (pSTAT5). Cells were analyzed by flow cytometry. Data show mean fluorescence intensity (MFI) for STAT5 in the indicated cell subsets.
- FIG. 15A shows the activation of STAT5 in CD8+ T cells, while FIG.
- 15B shows the activation of STAT5 in NK cells (defined as CD3- CD49b+).
- Certain IL-2 mutations lowered binding of IL-2 muteins fused to anti-CD8 antibodies to IL2Rp/y-expressing cells while maintaining their higher potency on CD8+ T cells over other IL2Rp/y-expressing cells not expressing CD8.
- FIGS. 16A & 16B shows the characterization of xmCD8-IL-2 muteins with no binding to IL-2Roc and one additional mutation fused to a low affinity CD8 antibody variant in a STAT5 assay.
- Splenocytes from B6 mice bearing B16 tumors incubated with indicated protein then stained for cell surface markers (CD3, CD4, CD8, CD25, CD49b) and for intracellular STAT5.
- Cells were analyzed by flow cytometry. Data show mean fluorescence intensity (MFI) for STAT5 in the indicated cell subsets.
- FIG. 16A shows the activation of STAT5 in CD8+ T cells
- FIG. 16B shows the activation of STAT5 in NK cells.
- Certain IL-2 mutations lowered binding of IL-2 muteins fused to low affinity anti-CD8 antibodies to IL2Rp/y-expressing cells while maintaining their higher potency on CD8+ T cells over other IL2Rp/y-expressing cells not expressing CD8.
- FIGS. 17A & 17B show the characterization of xmCD8-IL-2 muteins with no binding to IL-2Roc and one additional mutation fused to a high affinity CD8 antibody in an assay detecting expression of a cell proliferation marker (Ki67).
- a cell proliferation marker Ki67
- Splenocytes from B6 mice bearing B16 tumors incubated with indicated protein then stained for cell surface markers (CD3, CD4, CD8, CD25, CD49b) and for the intracellular marker of proliferation, Ki67, a downstream signaling event from IL2Rp/y and STAT5.
- Data show % of cells in the indicated cell subset positive for proliferation marker Ki67.
- FIG. 17A shows the percent of Ki67-positive CD8+ T cells
- FIG. 17B shows the percent of Ki67-positive NK cells.
- FIGS. 18A & 18B shows the characterization of xmCD8-IL-2 muteins with no binding to IL-2Roc and one additional mutation fused to a low affinity CD8 antibody in the Ki67 assay.
- Splenocytes from B6 mice bearing B16 tumors incubated with indicated protein then stained for cell surface markers (CD3, CD4, CD8, CD25, CD49b) and for Ki67.
- Data show % of cells in the indicated cell subset positive for proliferation marker Ki67.
- FIG. 18A shows the percent of Ki67-positive CD8+ T cells
- FIG. 18B shows the percent of Ki67-positive NK cells.
- FIG. 19 depicts the summary of potencies on CD8 T cells and NK cells for representative molecules and their selectivity for CD8 T cells over NK cells.
- CD8 and NK cell activation for each molecule are indicated on the same graph.
- Difference in potency on CD8 vs NK cells is indicated with a double arrow.
- the graph summarizes characterization data for generated CD8- IL2 fusions that have a range of selectivity for CD8+ T cells over NK cells.
- xmCD8ab2-IL2m4 top left
- xmCD8ab2-IL2m4.2 top right
- xmCD8ab2.1-IL2m4 ⁇ 50-100x; bottom left
- xmCD8ab2.1-IL2m4.1 lowest ( ⁇ 10x; bottom right).
- FIG. 20 depicts the CD8-IL-2 fusion properties with best efficacy.
- CD8-IL2 fusions as indicated
- Several representative CD8-IL2 fusions with varying degrees of selectivity for CD8 T cells over NK cells were tested in a B16 tumor model.
- Number of mice with complete regression out of total mice (CR) are indicated for each panel. All mice were dosed with 1 mg/kg of the indicated fusions together with 5 mg/kg of anti-PDl . Dosing above 1 mg/kg can induce NK cell activation due to the binding of IL-2 mutein to IL-2RPy on NK cells, thereby inducing body weight loss and toxicity.
- CD8-IL-2 performed better than TAg-IL-2v at a lower dose.
- CD8-IL2 fusion with the lowest selectivity for CD8 T cells had the least efficacy in the B16 model, approaching that observed for TAg-IL-2v in FIG. 10 with only 1 mouse out of 10 showing complete tumor regression. Selectivity of >10x was required for best efficacy, therapeutic index, and >40% tumor free mice.
- FIG. 21 shows the expansion of tumor antigen-specific CD8+ T cells and total CD8+ T cells and NK cells by treatment with CD8-IL-2.
- B6 mice were injected with B16 tumor cells and tumors allowed to grow to 200-250mm3 before they were dosed with indicated IL-2 fusions at 1 mg/kg together with 5mg/kg of xPDl. Tumors were removed day 5 post dose, digested to single cells and profiled by flow cytometry to detect CD8+ T cells and NK cells (NK1.1+CD3-). Cells were also stained with pl5E tetramer (TB-M507-2, MBL) according to manufacturer’s protocol to detect T cells that recognize pl5E tumor antigen.
- T-M507-2, MBL pl5E tetramer
- FIG. 22 shows the potency of a bivalent low affinity CD 8 antibody IL-2 fusion and a monovalent high affinity CD8 antibody IL-2 fusion.
- Splenocytes from B6 mice bearing B16 tumors were incubated with indicated protein for 30min in RPMI media after which cells were stained for cell surface markers (CD3, CD4, CD8, CD25, CD49b) and for intracellular phospho- STAT5.
- the bivalent low affinity fusion had a similar potency to that of the high affinity monovalent fusion as measured by percentage of cells positive for pSTAT5.
- FIG. 23 show the efficacy of a bivalent C-terminal format (format A) fusion in the B16 tumor model. Mice were dosed PBS as control or with 1 mg/kg of the indicated fusions together with 5 mg/kg of anti -PD 1 (9 per group). Bivalent C-terminal format (format A) was also very efficacious. IL-2m4.2 fusion fused to high affinity xmCD8ab2 antibody in format C (FIG. 20) or to bivalent xmCD8ab2.1 antibody in format A (FIG. 23) had similar in vivo efficacy.
- FIG. 24 shows blocking of CD8 T cell activation by CD8 antibodies.
- CD8+ T cells were purified from splenocytes from OT-I mice and co-cultured with EL-4-OVA line (ATCC), at 100,000 cells each for 24hr. Cells were analyzed for upregulation of activation markers such as CD25 and CD69 by cell surface staining and flow cytometry. Certain CD8 antibodies did not block CD8 T cell activation.
- xmCD8ab3 antibody (comprising a VH domain comprising the sequence of SEQ ID NO: 16 and a VL domain comprising the sequence of SEQ ID NO: 17) did not block CD8 T cell activation even at 200nM concentration.
- the xmCD8ab3 antibody was of the bivalent format.
- FIG. 25 shows the comparison of in vitro potency of xmCD8ab2 and xmCD8ab3 fusions, as indicated.
- Splenocytes from B6 mice bearing B16 tumors were incubated with indicated protein for 30min in RPMI media after which cells were stained for cell surface markers (CD3, CD4, CD8, CD25, CD49b) and for intracellular pSTAT5.
- Both xmCD8ab2-IL2m4.2 and xmCD8ab3-IL2m4.2 exhibited similar activity on CD8+ T cells in vitro with greater potency than TAg-IL-2v.
- FIGS. 26A & 26B show the in vivo effect of an MHC non-blocking anti-CD8 antibody fused to IL-2 mutein in the B16 tumor model. Mice were dosed with PBS or 0.3mg/kg (FIG.
- FIG. 26A or 1 mg/kg (FIG. 26B) of the indicated fusion together with 5 mg/kg of anti-PDl.
- IL-2m4.2 fusion fused to MHC non-blocking xmCD8ab3 antibody in format C was much more efficacious than IL-2m4.2 fusion fused to MHC blocking xmCD8ab2 antibody in format C (FIG. 26 A).
- FIG. 27 shows the fusion of IL-2 muteins which preferentially target PD1+ T cells over PD1- T cells.
- B16 tumors 300-600 mm 3 in size were removed from mice and digested to single cells.
- CD45+ cells were purified (Miltenyi’s LS columns according to manufacturer’s protocol) and stimulated with indicated fusion proteins for 30min.
- Cells were stained for cell surface markers (CD3, CD4, CD8, CD25, CD49b, and PD1) and for intracellular phospho-STAT5.
- Fusion of IL-2 mutein IL2mlO with anti-PDl antibody preferentially targeted PD1+ T cells over PD1- T cells; however both CD8+PD1+ T cells and CD4+CD25+PD1+ Treg cells were targeted.
- Immune cells are cells of the immune system that react to organisms or other entities that are deemed foreign to the immune system of the host. They protect the host against foreign pathogens, organisms and diseases. Immune cells, also called leukocytes, are involved in both innate and adaptive and immune responses to fight pathogens. Innate immune responses occur immediately upon exposure to pathogens without additional priming or learning processes. Adaptive immune processes require initial priming, and subsequently create memory, which in turn leads to enhanced responsiveness during subsequent encounters with the same pathogen. Innate immune cells include, but are not limited to monocytes, macrophages, dendritic cells, innate lymphoid cells (ILCs) including natural killer (NK) cells, neutrophils,
- Adaptive immune cells include B and T
- T cells subsets include, but are not limited to, alpha beta CD4+ T (naive CD4+, memory CD4+, effector memory CD4+, effector CD4+, regulatory CD4+), and alpha beta CD8+ T (naive CD8+, memory CD8+, effector memory CD8+, effector CD8+).
- B cell subsets include, but is not limited to, naive B, memory B, and plasma cells.
- NK T cells and T gamma delta (Tgd) cells exhibit properties of both innate and adaptive lymphocytes.
- T cells or“T lymphocytes” are immune cells that play a key role in the orchestration of immune responses in health and disease.
- T cells that express the CD8 antigen are cytotoxic or killer T cells that can lyse target cells using the cytotoxic proteins such as granzymes and perforin; and T cells that express the CD4 antigen (CD4 + T cells) are helper T cells that are capable of regulating the function of many other immune cell types including that of CD8 + T cells, B cells, macrophages etc.
- CD4 + T cells are further subdivided into several subsets such as: T regulatory (Treg) cells that are capable of suppressing the immune response, and T helper 1 (Thl), T helper 2 (Th2), and T helper 17 (Thl7) cells that regulate different types of immune responses by secreting immunomodulatory proteins such as cytokines.
- T cells recognize their targets via alpha beta T cell receptors that bind to unique antigen-specific motifs and this recognition mechanism is generally required in order to trigger their cytotoxic and cytokine-secreting functions.“Innate lymphocytes” can also exhibit properties of CD8 + and CD4 + T cells, such as the cytotoxic activity or the secretion of Thl, Th2, and Thl 7 cytokines.
- innate lymphocyte subsets include NK cells and ILC1, ILC2, and ILC3 cells; and innate-like T cells such as Tgd cells; and NK T cells.
- these cells can rapidly respond to inflammatory stimuli from infected or injured tissues, such as immunomodulatory cytokines, but unlike alpha beta T cells, they can respond without the need to recognize antigen-specific patterns.
- “Cytokine” is a form of immunomodulatory polypeptide that mediates cross-talk between initiating/primary cells and target/effector cells. It can function as a soluble form or cell-surface associated to bind the“cytokine receptor” on target immune cells to activate signaling.
- Cytoke receptor is the polypeptide on the cell surface that activates intracellular signaling upon binding the cytokine on the extracellular cell surface.
- Cytokines includes, but are not limited to, chemokines, interferons, interleukins, lymphokines, and tumor necrosis factors. Cytokines are produced by a wide range of cells, including immune cells, endothelial cells, fibroblasts, and stromal cells. A given cytokine may be produced by more than one cell type. Cytokine are pleiotropic; since the receptors are expressed on multiple immune cell subsets, one cytokine can activate the signaling pathway in multiple cells. However, depending on the cell type, the signaling events for a cytokine can result in different downstream cellular events such as activation, proliferation, survival, apoptosis, effector function and secretion of other immunomodulatory proteins.
- “Amino acid” as used here refers to naturally occurring carboxy a-amino acids comprising alanine (three letter code: ala, one letter code: A), arginine (arg, R), asparagine (asn, N), aspartic acid (asp, D), cysteine (cys, C), glutamine (gin, Q), glutamic acid (glu, E), glycine (gly, G), histidine (his, H), isoleucine (ile, I), leucine (leu, L), lysine (lys, K), methionine (met, M), phenylalanine (phe, F), proline (pro, P), serine (ser, S), threonine (thr, T), tryptophan (trp, W), tyrosine (tyr, Y), and valine (val, V).
- alanine three letter code: ala, one letter code: A
- arginine arg,
- Polypeptide or“protein” as used here refers to a molecule where monomers (amino acids) are linearly linked to one another by peptide bonds (also known as amide bonds).
- the term “polypeptide” refers to any chain of two or more amino acids and does not refer to a specific length of the product.
- peptides, dipeptides, tripeptides, oligopeptides, "protein”, “amino acid chain”, or any other term used to refer to a chain of two or more amino acids are included within the definition of "polypeptide", and the term “polypeptide” may be used instead of, or interchangeably with any of these terms.
- polypeptide is also intended to refer to the products of A polypeptide may be derived from a natural biological source or produced by recombinant technology but is not necessarily translated from a designated nucleic acid sequence. It may be generated in any manner, including by chemical synthesis. Polypeptides normally have a defined three-dimensional structure, but they do not necessarily have such structure.
- a polypeptide of the present disclosure may be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more,
- Polypeptides with a defined three- dimensional structure are referred to as folded, and polypeptides which do not possess a defined three- dimensional structure, but rather can adopt many different conformations and are referred to as unfolded.
- Polypeptides may further form multimers such as dimers, trimers and higher oligomers, i.e. consisting of more than one polypeptide molecule.
- Polypeptide molecules forming such dimers, trimers etc. may be identical or non-identical.
- the corresponding higher order structures of such multimers are, consequently, termed homo- or heterodimers, homo- or heterotrimers etc.
- the terms "polypeptide” and "protein” also refer to modified
- polypeptides/proteins wherein the post-expression modification is affected including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids.
- Leu 234 is a residue at position 234 in the human antibody IgGl .
- wild-type herein means an amino acid sequence or a nucleotide sequence that is found in nature, including allelic variations.
- a wild-type protein has an amino acid sequence or a nucleotide sequence that has not been intentionally modified.
- substitution or“mutation” refers to a change to the polypeptide backbone wherein an amino acid occurring naturally in the wild-type sequence of a polypeptide is substituted to another amino acid not naturally occurring at the same position in the said polypeptide.
- a mutation or mutations are introduced to modify polypeptide’s affinity to its receptor thereby altering its activity such that it becomes different from the affinity and activity of the wild-type cognate polypeptide. Mutations can also improve polypeptide’s biophysical properties.
- Amino acid mutations can be generated using genetic or chemical methods well known in the art. Genetic methods may include site-directed mutagenesis, PCR, gene synthesis and the like. It is contemplated that methods of altering the side chain group of an amino acid by methods other than genetic engineering, such as chemical modification, may also be useful.
- Interleukin-2 or "IL-2” as used here refers to any native human IL-2, unless otherwise indicated.
- IL-2 encompasses unprocessed IL-2 as well as“mature IL-2” which is a form of IL- 2 that results from processing in the cell. The sequence of“mature IL-2” is depicted in Fig 1 A.
- One exemplary form of unprocessed human IL-2 comprises of an additional N-terminal amino acid signal peptide attached to mature IL-2.
- IL-2 also includes but is not limited to naturally occurring variants of IL-2, e.g. allelic or splice variants or variants.
- the amino acid sequence of an exemplary human IL-2 is described under UniProt P60568 (IL2 HUMAN).
- binding affinity refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g. an antibody) and its binding partner (e.g. an antigen). Unless indicated otherwise, as used herein, “binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g.
- the affinity can generally be represented by the dissociation constant (KD), which is the ratio of dissociation and association rate constants (koff and kon,
- equivalent affinities may comprise different rate constants, as long as the ratio of the rate constants remains the same.
- Affinity can be measured by common methods known in the art, such as enzyme-linked immunosorbent assay (ELISA), surface plasmon resonance (SPR) technologies (e.g. BIAcore), BioLayer Interferometry (BLI) technologies (e.g. Octet) and other traditional binding assays (Heeley, Endocr Res 28, 217-229 (2002).
- ELISA enzyme-linked immunosorbent assay
- SPR surface plasmon resonance
- BLI BioLayer Interferometry
- Octet BioLayer Interferometry
- specific binding include but are not limited to IL-2 cytokine binding to its specific receptors (e.g. IL-2Ra, IL-2RP and IL-2Ry) and an antigen binding molecule binding to a specific antigen (e.g. CD8 or PD-1).
- “Mutant IL-2 polypeptide” refers to IL-2 polypeptide that has reduced affinity to its receptor wherein such decreased affinity will result in reduced biological activity of the mutant. Reduction in affinity and thereby activity can be obtained by introducing a small number of amino acid mutations or substitutions.
- the mutant IL-2 polypeptides can also have other modifications to the peptide backbone, including but not limited to amino acid deletion, permutation, cyclization, disulfide bonds, or the post-translational modifications (e.g.
- glycosylation or altered carbohydrate of a polypeptide
- chemical or enzymatic modifications to the polypeptide e.g. attaching PEG to the polypeptide backbone
- addition of peptide tags or labels e.g. attaching PEG to the polypeptide backbone
- fusion to proteins or protein domains e.g. IL-2RPy
- Desired activity may also include improved biophysical properties compared to the wild-type IL-2 polypeptide. Multiple modifications may be combined to achieve desired activity modification, such as reduction in affinity or improved biophysical properties.
- amino acid sequences for consensus N-link glycosylation may be incorporated into the polypeptide to allow for glycosylation.
- a lysine may be incorporated onto the polypeptide to enable pegylation.
- a mutation or mutations are introduced to the polypeptide to modify its activity.
- Targeting moiety and“antigen binding molecule” as used here refers in its broadest sense to a molecule that specifically binds an antigenic determinant.
- a targeting moiety or antigen binding molecule may be a protein, carbohydrate, lipid, or other chemical compound.
- antibody and“immunoglobulin” are used interchangeably and herein are used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies (e.g., full length or intact monoclonal antibodies), polyclonal antibodies, multispecific antibodies (e.g. bispecific antibodies), antibody fragments and single domain antibody (as described in greater detail herein), so long as they exhibit the desired antigen binding activity.
- monoclonal antibodies e.g., full length or intact monoclonal antibodies
- polyclonal antibodies e.g., multispecific antibodies (e.g. bispecific antibodies), antibody fragments and single domain antibody (as described in greater detail herein), so long as they exhibit the desired antigen binding activity.
- multispecific antibodies e.g. bispecific antibodies
- antibody fragments and single domain antibody as described in greater detail herein
- Antibodies refers to a protein having a structure substantially similar to a native antibody structure.“Native antibodies” refer to naturally occurring immunoglobulin molecules with varying structures.
- native immunoglobulins of the IgG class are heterotetrameric glycoproteins of about 150,000 daltons, composed of two light chains and two heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI, CH2, and CH3), also called a heavy chain constant region.
- each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain, also called a light chain constant region.
- VL variable region
- CL constant light domain
- Antibodies are assigned to different classes, depending on the amino acid sequences of the heavy chain constant domains. There are five major classes of antibodies: a (IgA), d (IgD), e (IgE), g (IgG), or m (IgM), some of which may be further divided into subtypes, e.g. g ⁇ (IgGl), g2 (IgG2), g3 (IgG3), g4 (IgG4), al (IgAl) and a2 (IgA2).
- IgA immunoglobulins
- the light chain of an immunoglobulin may be assigned to one of two types, called kappa (K) and lambda (l), based on the amino acid sequence of its constant domain.
- K kappa
- l lambda
- An immunoglobulin essentially consists of two Fab molecules and an Fc domain, linked via the immunoglobulin hinge region.
- “Fc” or“Fc region” or“Fc domain” as used herein refers to the C-terminal region of an antibody heavy chain that contains at least a portion of the constant region.
- the term includes native sequence Fc regions and variant Fc regions.
- An Fc can refer to the last two constant region immunoglobulin domains (e.g., CH2 and CH3) of IgA, IgD, and IgG, the last three constant region immunoglobulin domains of IgE and IgM, and optionally, all or a portion of the flexible hinge N-terminal to these domains.
- Fc may include the J chain.
- An IgG Fc region comprises an IgG CH2 and an IgG CH3 domain and in some cases, inclusive of the hinge.
- numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md., 1991.
- The“hinge” region usually extends from amino acid residue at about position 216 to amino acid residue at about position 230.
- the hinge region herein may be a native hinge domain or variant hinge domain.
- The“CH2 domain” of a human IgG Fc region usually extends from an amino acid residue at about position 231 to an amino acid residue at about position 340.
- the CH2 domain herein may be a native sequence CH2 domain or variant CH2 domain.
- The“CH3 domain” comprises the stretch of residues C-terminal to a CH2 domain in an Fc region, from an amino acid residue at about position 341 to an amino acid residue at about position 447 of an IgG.
- the CH3 region herein may be a native sequence CH3 domain or a variant CH3 domain (e.g. a CH3 domain with an introduced“protuberance”
- “Fc domain” includes both amino acids 231-447 (CH2-CH3) or 216-447 (hinge- CH2-CH3), or fragments thereof.
- An“Fc fragment” in this context may contain fewer amino acids from either or both of the N- and C-termini but still retains the ability to form a dimer with another Fc domain or Fc fragment as can be detected using standard methods, generally based on size (e.g. non-denaturing chromatography, size exclusion chromatography, etc.).
- Human IgG Fc domains are of particular use in the present disclosure, and can be the Fc domain from human IgGl, IgG2 or IgG4.
- A“variant Fc domain” or“Fc variant” or“variant Fc” contains amino acid modifications (e.g. substitution, addition, and deletion) as compared to a parental Fc domain.
- the term also includes naturally occurring allelic variants of the Fc region of an immunoglobulin.
- variant Fc domains have at least about 80, 85, 90, 95, 97, 98 or 99 percent identity to the corresponding parental human IgG Fc domain (using the identity algorithms discussed below, with one embodiment utilizing the BLAST algorithm as is known in the art, using default parameters).
- the variant Fc domains can have from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
- variant Fc domains herein still retain the ability to form a dimer with another Fc domain as measured using known techniques as described herein, such as non- denaturing gel electrophoresis.
- Fc gamma receptor “FcyR” or“Fc gamma R” as used herein is meant any member of the family of proteins that bind the IgG antibody Fc region and is encoded by an FcyR gene.
- this family includes but is not limited to FcyR I (CD64), including isoforms FcyRIa, FcyRIb, and FcyRIc; FcyR 11 (CD32), including isoforms FcyRIIa (including allotypes HI 31 and R131), FcyRIIb (including FcyRIIb- 1 and FcyRIIb-2), and FcyR lie; and FcyRIII (CD 16), including isoforms FcyRIIIa (including allotypes VI 58 and FI 58) and FcyRIIIb (including allotypes FcyRIIb-NAl and FcyRIIb-NA2) (Jefferis et al., 2002, Immunol Lett 82:57-65, entirely incorporated by reference), as well as any undiscovered human FcyRs or FcyR isoforms or allotypes.
- An FcyR may be from any organism, including but not limited to humans, mice, rats, rabbits, and monkeys.
- Mouse FcyRs include but are not limited to FcyRI (CD64), FcyRII (CD32), FcyRIII (CD16), and FcyRIIIb (CD16-2), as well as any undiscovered mouse FcyRs or FcyR isoforms or allotypes.
- effector function as used herein is meant a biochemical event that results from the interaction of an antibody Fc region with an Fc receptor or ligand, which vary with the antibody isotype. Effector functions include but are not limited to antibody-dependent cell-mediated cytotoxicity (ADCC), antibody-dependent cell-mediated phagocytosis (ADCP), complement- dependent cytotoxicity (CDC), cytokine secretion, immune complex-mediated antigen uptake by antigen presenting cells, down regulation of cell surface receptors (e.g.
- ADCC antibody-dependent cell-mediated cytotoxicity
- nonspecific cytotoxic cells that express FcRs (such as Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell.
- FcRs such as Natural Killer (NK) cells, neutrophils, and macrophages
- ADCC activity a molecule of interest
- an in vitro ADCC assay such as that described in U.S. Pat. No. 5,500,362 or 5,821,337 may be performed.
- “ADCP” or antibody dependent cell-mediated phagocytosis as used herein is meant the cell-mediated reaction wherein nonspecific cytotoxic cells that express FcyRs recognize bound antibody on a target cell and subsequently cause phagocytosis of the target cell.
- Fc null and“Fc null variant” are used interchangeably and used herein to describe a modified Fc which have reduced or abolished effector functions.
- Such Fc null or Fc null variant have reduced or abolished to FcyRs and/or complement receptors.
- Fc null or Fc null variant has abolished effector functions.
- Exemplary methods for the modification include but not limited to chemical alteration, amino acid residue substitution, insertion and deletions.
- IgG4 L235, G237, D265 and E318.
- Fc molecules having decreased effector function include those having one or more of the following substitutions: l) IgGl : N297A, N297Q, D265A/N297A, D265A/N297Q,
- L234F/L235E/P331 S L234A/L235A, L234A/L235A/G237A, L234A/L235A/G237A/K322A, L234A/L235 A/G237A/A330S/A331 S,
- E233P/L234V/L235A/G236del/S267K E233P/L234V/L235A/G236del/S239K/A327G
- E233P/L234V/L235A/G236del/S267K/A327G E233P/L234V/L235A/G236del/S267K/A327G and E233P/L234V/L235A/G236del
- IgG2 A330S/A331S, V234A/G237A, V234A/G237A/D265A, D265A/A330S/A331 S, V234A/G237A/D265A/A330S/A331 S, and H268 Q/V 309L/ A330S/A331S;
- IgG4 L235A/G237A/E318A, D265A,
- Epitope refers to a determinant capable of specific binding to the variable region of an antibody molecule known as a paratope.
- Epitopes are groupings of molecules such as amino acids or sugar side chains and usually have specific structural characteristics, as well as specific charge characteristics.
- a single antigen may have more than one epitope.
- the epitope may comprise amino acid residues directly involved in the binding and other amino acid residues, which are not directly involved in the binding, such as amino acid residues which are effectively blocked by the antigen binding peptide (in other words, the amino acid residue is within the footprint of the antigen binding peptide).
- Epitopes may be either conformational or linear.
- An epitope typically includes at least 3, and more usually, at least 5 or 8-10 amino acids. Antibodies that recognize the same epitope can be verified in a simple immunoassay showing the ability of one antibody to block the binding of another antibody to a target antigen, for example "binning".
- Linker refers to a molecule that connect two polypeptide chains.
- Linker can be a polypeptide linker or a synthetic chemical linker (for example, see disclosed in Protein Engineering, 9(3), 299-305, 1996).
- the length and sequence of the polypeptide linkers is not particularly limited and can be selected according to the purpose by those skilled in the art.
- Polypeptide linker comprises one or more amino acids.
- polypeptide linker is a peptide with a length of at least 5 amino acids, preferably with a length of 5 to 100, more preferably of 10 to 50 amino acids.
- said peptide linker is G, S, GS, SG,
- Synthetic chemical linkers include crosslinking agents that are routinely used to crosslink peptides, for example, N-hydroxy succinimide (NHS), disuccinimidyl suberate (DSS), bis(succinimidyl) suberate (BS3), dithiobis(succinimidyl propionate) (DSP), dithiobis(succinimidyl propionate) (DTSSP), ethylene glycol bis(succinimidyl succinate) (EGS), ethylene glycol bis(sulfosuccinimidyl succinate) (sulfo-EGS), disuccinimidyl tartrate (DST), disulfosuccinimidyl tartrate (sulfo-DST), bis[2- (succinimidoxycarbonyloxy)ethyl] sulfone (BSOCOES), and bis[2- (succinimidoxycarbonyloxy)ethyl] sulfone (sulf
- polynucleotide refers to an isolated nucleic acid molecule or construct, e.g. messenger RNA (mRNA), virally-derived RNA, or plasmid DNA (pDNA) encoding the polypeptides of the present disclosure.
- a polynucleotide may comprise a conventional phosphodiester bond or a non-conventional bond (e.g. an amide bond, such as found in peptide nucleic acids (PNA).
- PNA peptide nucleic acids
- nucleic acid molecule refers to any one or more nucleic acid segments, e.g. DNA or RNA fragments, present in a polynucleotide.
- one or more vectors comprising such nucleic acids are provided.
- a method for making a polypeptide of the present disclosure comprises culturing a host cell comprising a nucleic acid encoding the polypeptide under conditions suitable for expression of the polypeptide and recovering the polypeptide from the host cell.
- "Recombinant” means the proteins are generated using recombinant nucleic acid techniques in exogeneous host cells. Recombinantly produced proteins expressed in host cells are considered isolated for the purpose of the present disclosure, as are native or recombinant proteins which have been separated, fractionated, or partially or substantially purified by any suitable technique.
- isolated when used to describe the various polypeptides disclosed herein, means a polypeptide that has been identified and separated and/or recovered from a cell or cell culture from which it was expressed. Typically, an isolated polypeptide will be purified by at least one purification step. There is no required level of purity;“purification” or“purified” refers to increase of the target protein concentration relative to the concentration of contaminants in a composition as compared to the starting material.
- An "isolated protein,” as used herein refers to a target protein which is substantially free of other proteins having different binding specificities.
- cancer refers the physiological condition in mammals that is typically characterized by unregulated and abnormal cell growth with the potential to invade or spread to other parts of the body.
- cancer include but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia.
- cancers include lung cancer, small-cell lung cancer, non-small cell lung (NSCL) cancer, bronchioloalviolar cell lung cancer, squamous cell cancer, adenocarcinoma of the lung, squamous carcinoma of the lung, cancer of the peritoneum, head and neck cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the head or neck, cutaneous or intraocular melanoma, thyroid cancer, uterine cancer, , gastrointestinal cancer, ovarian cancer, rectal cancer, cancer of the anal region, stomach cancer, gastric cancer, colon cancer, breast cancer, endometrial carcinoma, uterine cancer, carcinoma of the fallopian tubes, carcinoma of the cervix, carcinoma of the vagina, vulval cancer, Hodgkin's Disease, cancer of the esophagus, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, sarcoma of soft tissue
- mutant IL-2 polypeptides that exhibit less than 50% of binding affinity to IL-2Ra (e.g., comprising the amino acid sequence of SEQ ID NO:2 or as shown in FIG. IB). In some embodiments, mutant IL-2 polypeptides also exhibit less than 50% of binding affinity to IL-2R]3 (e.g., comprising the amino acid sequence of SEQ ID NO:3 or as shown in FIG. 1C). In some embodiments, mutant IL-2 polypeptides exhibit less than 50% of binding affinity to IL-2Ra and less than 50% of binding affinity to IL-2RP ( e.g, comprising the amino acid sequence of SEQ ID NO: 3 or as shown in FIG.
- mutant IL-2 polypeptides exhibit less than 50% of binding affinity to IL-2Ra and less than 50% of binding affinity to IL-2Ry (e.g., comprising the amino acid sequence of SEQ ID NO:4 or as shown in FIG. ID), compared to wild-type IL-2 polypeptide (e.g., comprising the amino acid sequence of SEQ ID NO: l or as shown in FIG.
- mutant IL-2 polypeptides exhibit less than 50% of binding affinity to IL-2Ra, less than 50% of binding affinity to IL-2RP, and less than 50% of binding affinity to IL- 2Ry, compared to wild-type IL-2 polypeptide. Differences in binding affinity of wild-type and disclosed mutant polypeptide for IL-2Ra and IL-2RJ3 can be measured, e.g., in standard surface plasmon resonance (SPR) assays that measure affinity of protein-protein interactions familiar to those skilled in the art.
- SPR surface plasmon resonance
- the mutant IL-2 polypeptides of the present disclosure have one or more, two or more, or three or more affinity-reducing amino acid substitutions relative to the wild-type mature IL-2 polypeptide having an amino acid sequence as depicted in Fig 1 A (SEQ ID NO: 1), wherein one or more, two or more, or three or more substituted residues, are selected from the following group: Ql l, H16, LI 8, L19, D20, D84, S87, Q22, R38, F42, K43, Y45, E62, P65, E68, V69,
- the location of possible amino acid substitutions in the sequence of the wild-type mature IL-2 polypeptide is depicted, e.g., in Fig 2.
- Decreased affinity to IL-2Ra may be obtained by substituting one or more of the following residues in the sequence of the wild-type mature IL-2 polypeptide: R38, F42, K43, Y45, E62, P65, E68, V69, and L72.
- Decreased affinity to IL-2RP may be obtained by substituting one or more of the following residues: E15, H16, L19, D20, D84, S87, N88, V91, and 192.
- Decreased affinity to IL-2Ry may be obtained by substituting one or more of the following residues in the sequence of the wild-type mature IL-2 polypeptide: Ql l, L18, Q22, T123, Q126, SI 27, 1129, and S130.
- the mutant IL-2 polypeptide comprises an F42A or F42K amino acid substitution relative to the wild-type mature IL-2 amino acid sequence, e.g., as depicted in FIG. 1A (SEQ ID NO: l).
- the mutant IL-2 polypeptide comprises an F42A or F42K amino acid substitution and an R38A, R38D, R38E, E62Q, E68A, E68Q, E68K, or E68R amino acid substitution relative to the wild-type mature IL-2 amino acid sequence, e.g., as depicted in FIG. 1A (SEQ ID NO: 1).
- the mutant IL-2 polypeptide comprises F42A; R38A and F42A; R38D and F42A; R38E and F42A; F42A and E62Q; F42A and E68A; F42A and E68Q; F42A and E68K; F42A and E68R; or R38A and F42K amino acid substitution(s) relative to the wild-type mature IL-2 amino acid sequence, e.g., as depicted in FIG. 1A (SEQ ID NO: 1).
- the mutant IL-2 polypeptide comprises R38E and F42A amino acid substitutions relative to the wild- type IL-2 amino acid sequence.
- the mutant IL-2 polypeptide comprises R38D and F42A amino acid substitutions relative to the wild-type IL-2 amino acid sequence. In some embodiments, the mutant IL-2 polypeptide comprises F42A and E62Q amino acid substitutions relative to the wild- type IL-2 amino acid sequence. In some embodiments, the mutant IL-2 polypeptide comprises R38A and F42K amino acid substitutions relative to the wild-type IL-2 amino acid sequence. In some embodiments, the mutant IL-2 polypeptide comprises R38D and F42A amino acid substitutions relative to the wild-type IL-2 amino acid sequence. In some embodiments, the mutant IL-2 polypeptide comprises R38A and F42K amino acid substitutions relative to the wild- type IL-2 amino acid sequence.
- the mutant IL-2 polypeptide comprises F42A and E62Q amino acid substitutions relative to the wild-type IL-2 amino acid sequence.
- the mutant IL-2 polypeptide comprises an H16E, H16D, D20N, M23A, M23R, M23K, D84L, D84N, D84V, D84H, D84Y, D84R, D84K, S87K, S87A, N88A, N88S, N88T, N88R, N88I, V91A, V91T, V91E, I92A, E95S, E95A, E95R, T123A, T123E, T123K, T123Q, Q126A, Q126S, Q126T, Q126E, S127A, S127E, S127K, or S127Q ammo acid substitution relative to the wild-type IL-2 amino acid sequence.
- the mutant IL-2 polypeptide comprises F42A; R38A and F42A; R38D and F42A; R38E and F42A; F42A and E62Q; F42A and E68A; F42A and E68Q; F42A and E68K; F42A and E68R; or R38A and F42K amino acid substitution(s) relative to the wild-type mature IL-2 amino acid sequence depicted in FIG.
- the mutant IL-2 polypeptide comprises R38E, F42A, and H16E amino acid substitutions relative to the wild-type IL-2 amino acid sequence.
- the mutant IL-2 polypeptide comprises R38E, F42A, and H16D amino acid substitutions relative to the wild-type IL-2 amino acid sequence.
- the mutant IL-2 polypeptide comprises R38E, F42A, and N88S amino acid substitutions relative to the wild-type IL-2 amino acid sequence.
- the mutant IL-2 polypeptide comprises R38E, F42A, and N88A amino acid substitutions relative to the wild-type IL-2 amino acid sequence.
- the mutant IL-2 polypeptide comprises R38E, F42A, and V91E amino acid substitutions relative to the wild-type IL-2 amino acid sequence. In some embodiments, the mutant IL-2 polypeptide comprises R38E, F42A, and Q126S amino acid substitutions relative to the wild-type IL-2 amino acid sequence.
- the mutant IL-2 polypeptide comprises the amino acid sequence of SEQ ID NO: 1 with one of the following sets of amino acid substitutions (relative to the sequence of SEQ ID NO: l): R38E and F42A; R38D and F42A; F42A and E62Q; R38A and F42K; R38E, F42A, and N88S; R38E, F42A, and N88A; R38E, F42A, and V91E; R38E, F42A, and D84H; H16D, R38E and F42A; H16E, R38E and F42A; R38E, F42A and Q126S; R38D, F42A and N88S; R38D, F42A and N88A; R38D, F42A and V91E; R38D, F42A, and D84H; H16D, R38D and F42A; H16E, R38D and F42A; R38D, F42A and Q
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- the mutant IL-2 polypeptide comprises the amino acid sequence of APTSSSTKKTQLQLEDLLLDLQMILNGINNYKNPKLTEMLTAKFYMPKKATELKHLQCL EEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNR WITFCQSIISTLT (SEQ ID NO:26).
- the mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- the mutant IL-2 polypeptide comprises the amino acid sequence of APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTEMLTAKFYMPKKATELKHLQCL EEELKPLEEVLNLAQSKNFHLRPRHLISNINVIVLELKGSETTFMCEYADETATIVEFLNR WITFAQSIISTLT (SEQ ID NO: 57).
- the mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- the mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- mutant IL-2 polypeptide comprises the amino acid sequence of
- the mutant IL-2 polypeptide comprises the amino acid sequence of APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTAKFYMPKKATELKHLQCL EEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNR WITFASSIISTLT (SEQ ID NO:88).
- mutant IL-2 polypeptides of the present disclosure also contain other modifications, including but not limited to mutations and deletions, that provide additional advantages such as improved biophysical properties.
- Improved biophysical properties include but are not limited to improved thermostability, aggregation propensity, acid
- residue Cl 25 may be replaced with a neutral amino acid such as serine, alanine, threonine or valine; and N terminal A1 residue could be deleted, both of which were described in U.S. Pat.
- Mutant IL-2 polypeptides may also include a mutation of the residue Ml 04, such as M104A, as described in U.S. Pat. No. 5,206,344.
- the mutant IL- 2 polypeptide of the present disclosure comprises the amino acid substitution Cl 25 A.
- one, two, or three N-terminal residues are deleted.
- the present disclosure provides fusion proteins comprising the mutant IL-2 polypeptides of the present disclosure and antigen binding molecules binding to one of the following antigens: CD8a, CD8P, and PD1 wherein said fusion proteins preferentially activate immune cells expressing the antigen for the antigen binding molecule of the fusion over immune cells not expressing said antigen.
- Preferential activity of the targeted IL-2 fusion proteins comprising the mutant IL-2 polypeptides on antigen-expressing cells is demonstrated in assays that contain antigen expressing and antigen-non expressing cells that also express IL-2RPy or IL-2Ra.Py.
- One such assay is an in vitro assay that measures STAT5 (pSTAT5) phosphorylation and/or expression of the proliferation marker Ki-67 in human immune cells, such as human peripheral blood and/or tumor-infiltrating immune cells upon exposure to IL-2 polypeptides.
- STAT5 pSTAT5
- the activity of the targeted IL-2 fusion protein is measured on antigen-expressing and non expressing cells to demonstrate the selectivity on antigen-expressing cells.
- the activity of the targeted IL-2 fusion protein comprising the mutant IL-2 polypeptide on antigen-expressing cells is compared to that of the untargeted IL-2 fusion protein comprising the same mutant IL-2 polypeptide and a control antibody not recognizing any antigens on antigen-expressing cells to demonstrate the magnitude of rescue in signaling of the mutant IL-2 polypeptide when fused to an antigen binding molecule.
- the fusion protein of the present disclosure containing CD8a antigen binding molecules activates CD8a+ IL-2RP+ cells over CD8a- IL-2R]3+ cells, by at least 10-fold, at least 50-fold, or at least 100-fold.
- said fusion protein activate CD8a+ IL-2R]3+ cells more than 50-fold, 100 fold, or 200 fold compared to a fusion molecule comprising the said IL-2 mutant polypeptide and a control antibody not binding to any antigens expressed on said cells.
- Said cell activation by the IL-2 fusion protein is determined by measuring the expression of pSTAT5 or the cell proliferation marker Ki67 in said cells following the treatment with said IL-2 fusion protein.
- the fusion protein of the present disclosure containing CD8P antigen binding molecules activates CD8P+ IL-2R]3+ cells over CD8P- IL-2R]3+ cells by at least 10-fold, at least 50-fold, or at least 100-fold.
- said fusion protein activates CD8P+ IL-2RP+ cells more than 50-fold, 100 fold, or 200 fold compared to a fusion molecule comprising the said IL-2 mutant polypeptide and a control antibody not binding to any antigens expressed on said cells.
- Said cell activation by the IL-2 fusion protein is determined by measuring the expression of pSTAT5 or the cell proliferation marker Ki67 in said cells following the treatment with said IL-2 fusion protein
- fusion protein of the present disclosure containing PD1 antigen binding molecules activates PD1+ IL-2RP+ cells over PD1- IL-2RP+ cells by at least 10-fold, at least 50-fold, or at least 100-fold.
- said fusion protein activates PD1+ IL- 2RP+ cells more than 50-fold, 100 fold, or 200 fold compared to a fusion protein comprising the said IL-2 mutant polypeptide and a control antibody not binding to any antigens expressed on said cells.
- Said cell activation by the IL-2 fusion protein is determined by measuring the expression of pSTAT5 or the cell proliferation marker Ki67 in said cells following the treatment with said IL-2 fusion protein.
- a fusion protein of the present disclosure displays one or more of the following: binds human CD8 and does not block an interaction of CD8 with MHC class I; and activates CD8+ T cells with at least 10-fold, 25-fold, 50-fold, 100-fold, 250-fold, 500-fold, or 1000-fold greater potency, e.g., as compared to activation of NK cells.
- whether an anti-CD8 antibody or fusion protein of the present disclosure blocks the interaction of CD8 with MHC class I can be assayed, e.g., by assaying activation status of CD8+ T cells (e.g., upon antigen stimulation) in the presence or absence of the anti-CD 8 antibody or fusion protein.
- activation of CD8+ T cells and/or NK cells can be measured, e.g., by assaying one or more markers (e.g., proportion of treated cells expressing one or more markers) of proliferation (e.g., Ki67), IL- 2Rp/y downstream signaling, and/or STAT5 downstream signaling.
- markers e.g., proportion of treated cells expressing one or more markers
- of proliferation e.g., Ki67
- STAT5 downstream signaling e.g., STAT5 downstream signaling.
- the fusion proteins of the disclosure may contain polypeptides that bind to IL-2Ra.Py for which reduction in binding affinity to IL2Ra was achieved by methods other than introducing a small number of mutations in the sequence of the wild-type IL-2 polypeptide. Therefore, the fusion proteins of the invention may include IL-2 polypeptides that were fused to IL-2Ra as described in Lopes et al, J Immunother Cancer. 2020; 8(1): e000673; or synthetic polypeptide mimics computationally designed to bind to IL-2RPy, but not to IL-2Ra, such as the one described in Silva et al, Nature. 2019 Jan;565(7738): 186-191; or by using an antigen binding domain polypeptide that is agonistic to IL-2RPy.
- IL-2 polypeptides that were fused to IL-2Ra as described in Lopes et al, J Immunother Cancer. 2020; 8(1): e000673
- polypeptides can be fused to CD8 antibodies to construct fusions resulting in their selective potency for CD8+ T cells compared to NK cells of 10 fold or more.
- the fusion protein comprises two moieties as depicted in Fig 4A wherein: i) the first moiety is a polypeptide comprising an antibody heavy chain VH-CHl-hinge-CH2-CH3 monomer wherein VH is a variable heavy chain and CH2-CH3 is a Fc domain, an antibody light chain VL-CL wherein VL is a variable light chain and CL is a constant light chain, and the mutant IL-2 polypeptide, wherein the N-terminus of the mutant IL-2 polypeptide is fused to the C-terminus of the Fc domain via a linker; ii) the second moiety is a polypeptide comprising an antibody heavy chain VH-CHl-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; and wherein, both the first and second moiety bind to an epitope on one antigen selected from the following group: human CD8a,
- the fusion protein comprises two moieties as depicted in Fig 4B wherein: i) the first moiety is a polypeptide comprising an antibody hinge-CH2-CH3 monomer wherein CH2-CH3 is a Fc domain, and the mutant IL-2 polypeptide, wherein the N-terminus of the mutant IL-2 polypeptide is fused to the C-terminus end of the Fc domain via a linker; ii) the second moiety is a polypeptide comprising an antibody heavy chain VH-CHl-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; and wherein the second moiety binds to an epitope on one antigen selected from the following group: human CD8a, human CD8P, and human PD1.
- the fusion protein comprises two moieties as depicted in Fig 4C wherein: i) the first moiety is a polypeptide comprising an antibody hinge-CH2-CH3 monomer wherein CH2-CH3 is a Fc domain, and the mutant IL-2 polypeptide, wherein the C-terminus of the mutant IL-2 polypeptide is fused to the N-terminus end of the Fc domain via a linker; ii) the second moiety is a polypeptide comprising an antibody heavy chain VH-CHl-hinge-CH2-CH3 monomer and an antibody light chain VL-CL; and wherein the second moiety binds to an epitope on one antigen selected from the following group: human CD8a, human CD8P, and human PD1.
- said first and second Fc domains of the fusion protein contain the following Fc mutations to decrease effector function according to EU numbering: L234A,
- said first and second Fc domains of the fusion protein contain the following Fc mutations to decrease effector function according to EU numbering: L234A, L235A, G237A, and K322A.
- said first and second Fc domains of the fusion protein contain the following amino acid substitutions to facilitate heterodimeric formation: Y349C/T366W (knob) and S354C, T366S, L368A and Y407V (hole).
- the recombinant bispecific antibodies and/or fusion proteins disclosed herein can be very roughly classified in two categories, namely i) formats resulting from the combination of variable regions only and ii) formats combining variable regions with Fc domains.
- Representatives of the first category are tandem scFv (taFv), diabodies (Db),
- variable region Fab DART, single-chain diabodies (scDbs), Fab-Fc, tandem Fab, Dual variable region Fab and tandem dAb/VHH.
- the two variable regions can be linked together via covalent bonds or non- covalent interaction.
- bispecific antibodies/fusion proteins are generated on the natural immunoglobulin architecture containing two pairs of heavy chain and light chain combination with each pair having distinct binding specificity. Homodimerization of the two heavy chains in an IgG is mediated by the CH3 interaction. To promote heterodimeric formation, genetic modifications are introduced to the two respective CH3 regions. There heterodimerization mutations often involve steric repulsion, charge steering interaction, or interchain disulfide bond formation. Exemplary Fc modifications to promote heterodimerization include, without limitation, the following:
- bispecific antibody can be generated by post-production assembly from half-antibodies, thereby solving the issues of heavy and light chain mispairing. These antibodies often contain modification to favor heterodimerization of half-antibodies. Exemplary systems include but not limited to the knob-into-hole, IgGl (EEE - RRR), IgG2 (EEE - RRRR) (Strop et al. J Mol Biol (2012)) and DuoBody (F405L-K409R), listed in Table A. In such case, half-antibody is individually produced in separate cell line and purified. The purified antibodies were then subjected to mild reduction to obtain half-antibodies, which were then assembled into bispecific antibodies. Heterodimeric bispecific antibody was then purified from the mixture using conventional purifications methods.
- strategies on bispecific antibody generation that do not rely on the preferential chain pairing can also be employed. These strategies typically involve introducing genetic modification on the antibody in such a manner that the heterodimer will have distinct biochemical or biophysical properties from the homodimers; thus the post-assembled or expressed heterodimer can be selectively purified from the homodimers.
- One example was to introduce H435R/Y436F in IgGl CH3 domain to abolish the Fc binding to protein A resin and then co-express the H435R/Y436F variant with a wildtype Fc.
- heterodimeric antibody comprising one copy of H435R/Y436F mutation will have a decreased affinity for protein A as compared to the strong interaction from homodimeric wildtype antibody (Tustian et al Mabs 2016).
- Other examples include kappa/lambda antibody (Fischer et al, Nature Communication 2015) and introduction of differential charges (E357Q, S267K or
- bispecific antibody can be generated via fusion of an additional binding site to either the heavy or light chain of an immunoglobulin.
- additional binding site include but not limited to variable regions, scFv, Fab, VHH, and peptide.
- the heterodimeric mutations and/or mutations to modify Fc gamma receptor binding resulted in reduction of Fc stability. Therefore, additional mutation(s) was added to the Fc region to increase its stability. For example, one or more pairs of disulfide bonds such as A287C and L306C, V259C and L306C, R292C and V302C, and V323C and I332C are introduced into the Fc region. Another example is to introduce S228P to IgG4 based bispecific antibodies to stabilize the hinge disulfide. Additional example includes introducing K338I, A339K, and K340S mutations to enhance Fc stability and aggregation resistance (Gao et al, 2019 Mol Pharm. 2019;16:3647).
- the fusion protein binds human CD8, and the binding of the fusion protein to CD8 does not block the interaction of CD8 with MHC class I.
- the antigen binding molecule of the present disclosure binds to an epitope on CD8a wherein the binding of the antigen binding molecule to CD8a does not block the interaction of CD8aa or CD8a.p with MHC class I molecules on target cells or antigen presenting cells.
- the antigen binding molecule of the present disclosure binds to an epitope on CD8P wherein the binding of the antigen binding molecule to CD8P does not block the interaction of CD8aP with MHC class I molecules on target cells or antigen presenting cells.
- whether an anti-CD8 antibody or fusion protein of the present disclosure blocks the interaction of CD8 with MHC class I can be assayed, e.g., by assaying activation status of CD8+ T cells ( e.g ., upon antigen stimulation) in the presence or absence of the anti- CD8 antibody or fusion protein.
- activation status of CD8+ T cells e.g ., upon antigen stimulation
- an anti-CD8 antibody or fusion protein of the present disclosure comprises a VH domain comprising the sequence of
- an anti-CD8 antibody or fusion protein of the present disclosure comprises a VH domain comprising the sequence of
- an anti-CD8 antibody or fusion protein of the present disclosure comprises a VH domain comprising the sequence of
- an anti-CD8 antibody or fusion protein of the present disclosure comprises a VH domain comprising the sequence of
- the antigen binding molecule of the present disclosure binds to an epitope on PD1 wherein the binding of the antigen binding molecule to PD1 does not block the interaction of PD1 with PD-L1 expressed on target cells or other immune cells.
- fusion proteins are particularly useful as they can be administered as therapeutics in combination with anti -PD 1 therapeutic antibodies, including but not limited to nivolumab, pembrolizumab, and cemiplimab.
- the antigen binding molecule of the present disclosure binds to an epitope on PD1 wherein the binding of the antigen binding molecule to PD1 blocks the interaction of PD1 with PD-L1 on target cells or other immune cells.
- fusion proteins are particularly useful as they can be administered as therapeutics in combination with anti-PDLl therapeutic antibodies, including but not limited to atezolizumab, avelumab, and durvalumab.
- Certain aspects of the present disclosure relate to methods of treating cancer or chronic infection.
- the methods comprise administering an effective amount of a fusion protein, or a pharmaceutical composition comprising the fusion protein and a
- the patient in need of said treatment has been diagnosed with cancer.
- the fusion protein or composition is administered in combination with a T cell therapy, cancer vaccine, chemotherapeutic agent, or immune checkpoint inhibitor (ICI).
- the chemotherapeutic agent is a kinase inhibitor, antimetabolite, cytotoxin or cytostatic agent, anti-hormonal agent, platinum-based chemotherapeutic agent, methyltransferase inhibitor, antibody, or anti-cancer peptide.
- the immune checkpoint inhibitor targets PD-L1, PD-1, CTLA-4, CEACAM, LAIR1, CD 160, 2B4, CD80, CD86, CD276, VTCN1, HVEM, KIR, A2AR, MHC class I, MHC class II, GALS, adenosine, TGFR, 0X40, CD137, CD40, IDO, CSF1R, ⁇ M-3, BTLA, VISTA, LAG-3, TIGIT, IDO, MICA/B, LILRB4, SIGLEC-15, or arginase, including without limitation an inhibitor of PD-1 (e.g ., an anti-PD-1 antibody), PD-L1 (e.g., an anti-PD-Ll antibody), or CTLA-4 (e.g., an anti- CTLA-4 antibody).
- PD-1 e.g ., an anti-PD-1 antibody
- PD-L1 e.g., an anti-PD-Ll antibody
- CTLA-4 e.g.,
- T cell therapies include, without limitation, CD4+ or CD8+ T cell-based therapies, adoptive T cell therapies, chimeric antigen receptor (CAR)-based T cell therapies, tumor-infiltrating lymphocyte (TIL)-based therapies, autologous T cell therapies, and allogeneic T cell therapies.
- Exemplary cancer vaccines include, without limitation, dendritic cell vaccines, vaccines comprising one or more polynucleotides encoding one or more cancer antigens, and vaccines comprising one or more cancer antigenic peptides.
- a fusion protein of the present disclosure is part of a
- compositions and formulations as described herein can be prepared by mixing the active ingredients (such as a fusion protein) having the desired degree of purity with one or more optional pharmaceutically acceptable carriers ⁇ Remington’s
- Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol
- a fusion protein comprising two moieties, wherein: i) The first moiety is a polypeptide comprising an antibody heavy chain VH-CHl-hinge-CH2-
- CH3 monomer wherein VH is a variable heavy chain and CH2-CH3 is a Fc domain, an antibody light chain VL-CL wherein VL is a variable light chain and CL is a constant light chain, and a mutant IL-2 polypeptide, wherein the N-terminus of the mutant IL-2 polypeptide is fused to the C-terminus of the Fc domain via a linker;
- the second moiety is a polypeptide comprising an antibody heavy chain VH-CHl-hinge-
- both the first and second moiety bind to an epitope on one antigen selected from the following group: human CD8a, human CD8P, and human PD1.
- a fusion protein comprising two moieties, wherein:
- the first moiety is a polypeptide comprising an antibody hinge-CH2-CH3 monomer wherein
- CH2-CH3 is a Fc domain, and a mutant IL-2 polypeptide, wherein the N-terminus of the mutant IL-2 polypeptide is fused to the C-terminus end of the Fc domain via a linker; ii)
- the second moiety is a polypeptide comprising an antibody heavy chain VH-CHl-hinge-
- the second moiety binds to an epitope on one antigen selected from the following group: human CD8a, human CD8P, and human PD1.
- a fusion protein comprising two moieties, wherein: i) The first moiety is a polypeptide comprising an antibody hinge-CH2-CH3 monomer wherein
- CH2-CH3 is a Fc domain, and a mutant IL-2 polypeptide, wherein the C-terminus of the mutant IL-2 polypeptide is fused to the N-terminus end of the Fc domain via a linker; ii)
- the second moiety is a polypeptide comprising an antibody heavy chain VH-CHl-hinge-
- the second moiety binds to an epitope on one antigen selected from the following group: human CD8a, human CD8P, and human PD1.
- mutant IL-2 polypeptide exhibits reduced binding affinity by 50% or more to IL-2Ra polypeptide having an amino acid sequence depicted in Fig IB, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence depicted in Fig 1 A, and reduced binding affinity by 50% or more to IL-2Ra polypeptide having an amino acid sequence depicted in Fig 1C, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence depicted in Fig 1 A.
- mutant IL-2 polypeptide further exhibits reduced binding affinity by 50% or more to IL-2Ry polypeptide having an amino acid sequence depicted in Fig ID, compared to the binding affinity of the wild-type IL-2 polypeptide with an amino acid sequence depicted in Fig 1 A.
- the fusion protein of embodiment 4 or 5 wherein said mutant IL-2 polypeptide has two or more amino acid substitutions relative to the wild-type IL-2 amino acid sequence as depicted in Figure 2 and selected from a group of: Ql l, E15, H16, LI 8, L19, D20, Q22, R38, F42, K43, Y45, E62, P65, E68, V69, L72, N88, V91, 192, T123, Q126, S127, 1129, S130.
- the fusion protein of embodiment 6 wherein said mutant IL-2 polypeptide further comprises the amino acid mutation Cl 25 A to improve its biophysical properties compared to wild-type IL-2.
- One or more vectors comprising the polynucleotides of embodiment 10.
- a host cell comprising the polynucleotides of embodiment 10.
- a pharmaceutical composition comprising the fusion proteins according to any one of embodiments 1 -9 and a pharmaceutically acceptable carrier.
- the fusion proteins of any one of embodiments 1-9 for use as a medicament.
- a method of treating cancer or chronic infection comprising administering a composition according to any of embodiments 1-9 and 13 to a patient.
- a method of treating cancer comprising administering a composition according to any of embodiments 1-9 and 13 to a patient in combination with a T cell therapy or cancer vaccine.
- Desired gene segments were either generated by PCR using appropriate templates or synthesized at Thermo Scientific (Pleasanton, CA), ATUM (Newark, CA), Genewiz (South Plainfield, NJ), or GeneScript (Piscataway, NJ) from synthetic oligonucleotides.
- the gene segments flanked by designed restriction endonuclease cleavage sites were digested out and later cloned into their respective expression vectors. DNA was purified from transformed bacteria and concentration determined by UV visible spectroscopy. DNA sequencing was used to confirm the DNA sequences of the subcloned gene fragments.
- Antibodies binding to CD8 or PD1 antigens were generated using either in vitro display system or in vivo immunizations.
- in vitro display method a non-immune human antibody phage library was panned for 5 to 6 rounds to isolate antibodies against the target antigen. After the panning, individual phage clones that exhibited specific binding to target antigen over non specific antigens in ELISA were identified. DNA fragments of heavy and light chain V-domain of the specific binders were subsequently cloned and sequenced. Meanwhile, antibodies were also generated from immunizing mice and llamas with the recombinant form of the antigens. From the mouse immunization, hybridoma method was used to isolate the antibody.
- B cells from spleen and/or lymph nodes were fused with a myeloma cell line to generate the hybridoma cells.
- Hybridoma clones were then individually screened using ELISA to identify the clones expressing antibodies specific for the antigen.
- DNA fragments of heavy and light chain V-domain of the antibody were cloned from the specific hybridoma and later sequenced.
- antibody genes were cloned from peripheral B cells and ligated into the phagemid vector to generate a phage display antibody library. Antibodies were then isolated through panning the phage library against the antigens of interest.
- IMGT® the international ImMunoGeneTics information system®
- IMGT® the international ImMunoGeneTics information system® 25 years on. Nucleic Acids Res. 2015 Jan;43.
- the amplified DNA fragments of heavy and light chain V- domains were inserted in frame into the human IgGl containing mammalian expression vector.
- the IL-2 portions of the constructs were cloned in frame with the heavy chain using a (G4S)3 15-mer linker between the C-terminus of the IgG heavy chain and the N-terminus of IL-2.
- the C-terminal lysine residue of the IgG heavy chain was eliminated after fusing the IL-2 portion.
- two heavy chain plasmids needed to be constructed and transfected for heterodimerization facilitated by a knob- into-hole modification in the IgG CH3 domains.
- The“hole” heavy chain connected to the IL-2 portion carried the Y349C, T366S, L368A and Y407V mutations in the CH3 domain, whereas the unfused“knob” heavy chain carried the S354C and T366W mutations in the CH3 domain (EU numbering).
- the following mutations were introduced into the CH2 domain of each of the IgG heavy chains: L234A/L235A/G237A (EU numbering).
- the expression of the antibody-IL-2 fusion constructs was driven by an CMV promoter and transcription terminated by a synthetic polyA signal sequence located downstream of the coding sequence.
- Constructs encoding fusion proteins with IL-2 polypeptides as used in the examples were produced by co-transfecting exponentially growing Expi293 cells with the mammalian expression vectors using polyethylenimine (PEI). Briefly, IL-2 fusion constructs were first purified by affinity chromatography using a protein A matrix. The protein A column was equilibrated and washed in phosphate-buffered saline (PBS). The fusion constructs were eluted with 20 mM sodium citrate, 50 mM sodium chloride, pH 3.6. The eluted fractions were pooled and dialyzed into 10 mM MES, 25 mM sodium chloride pH 6.
- PBS phosphate-buffered saline
- the proteins were further purified using ion-exchange chromatograph (Mono-S, GE Healthcare) to purify the heterodimers over the homodimers.
- ion-exchange chromatograph (Mono-S, GE Healthcare) to purify the heterodimers over the homodimers.
- the column is washed with lOmM MES 25mM sodium chloride pH 6.
- the protein was then eluted with increasing gradient of sodium chloride from 25mM up to 500mM in lOmM MES pH 6 buffer.
- the major eluent peak corresponding to the heterodimer was collected and concentrated.
- the purified protein was then polished by size exclusion chromatography (Superdex 200, GE Healthcare) in PBS.
- the protein concentration of purified IL-2 fusion constructs was determined by measuring the optical density (OD) at 280 nm, using the molar extinction coefficient calculated on the basis of the amino acid sequence. Purity, integrity and monomeric state of the fusion constructs were analyzed by SDS-PAGE in the presence and absence of a reducing agent (5 mM 1,4-dithiothreitol) and stained with Coomassie blue (SimpleBlueTM SafeStain, Invitrogen). The NuPAGE® Pre-Cast gel system (Invitrogen) was used according to the manufacturer's instructions (4-20% Tris-glycine gels or 3-12% Bis-Tris). The aggregate content of
- immunoconjugate samples was analyzed using a Superdex 200 10/300 GL analytical size- exclusion column (GE Healthcare).
- PBMCs peripheral blood mononuclear cells
- IL-2 fusion proteins and control proteins such as recombinant human IL-2 and control (HA-targeted) fusion proteins, were diluted to desired concentrations and added to wells (50 m ⁇ added as 2x stimulus). Incubation was typically performed for 30 min at 37°C, after which it was stopped with 100 m ⁇ pre- warmed 4% PFA (2% final) for 10 min at 37°C. Cells were then stained with antibodies against surface markers: CD45 (clone HI30), CD3 (UCHT1, BD Biosciences), CD8a (SKI, Biolegend; RPA-T8, Biolegend), CD4 (RPA-T4, Biolegend), and CD25 (M-A251, Biolegend).
- CD45 clone HI30
- CD3 UCHT1, BD Biosciences
- CD8a SKI, Biolegend; RPA-T8, Biolegend
- CD4 RA-T4, Biolegend
- CD25 M-A251, Biolegend
- Cells were washed 2x with wash buffer (2% FBS in PBS) and fixed with 4% PFA at room temperature for 10 min. After fixation, cells were permeabilized in pre-chilled Phosflow Perm buffer III (BD Biosciences) according to manufacturer’s protocol. After permeabilization, cells were stained with antibodies against intracellular markers (pSTAT5 [pY694], clone 47, BD Biosciences, and/or perforin, clone 5G9, BD Biosciences) and analyzed on a flow cytometer. Data were expressed as percent pSTAT5 positive, and in some cases as pSTAT5 mean fluorescence intensity (MFI), and imported into GraphPad Prism to determine ECso values for each construct.
- pSTAT5 intracellular markers
- MFI mean fluorescence intensity
- a flow cytometry assay was used to detect the expression of the intracellular proliferation marker Ki-67.
- PBMCs were isolated as described above and incubated in the presence of IL-2 fusion proteins and controls in serum-supplemented RPMI1640 (10% FBS) for 4 to 6 days or serum free AIM V media (Gibco). Staining for Ki-67 (clone Ki-67, Biolegend) was performed with Foxp3/ Transcription Factor Staining Buffer Set (Thermo Fisher Scientific) according to manufacturer’s protocol. Data were expressed as percent Ki-67 positive and imported into GraphPad Prism to determine ECso values for each construct when possible.
- Splenocytes were isolated from spleens of B6 mice by placing a spleen onto a 70 mM strainer and using a plunger to wash the cells with PBS through the strainer. Red blood cells were lysed with ACK lysis buffer and cells resuspended at 20x106/ml of RPMI media. Cells were plated in U-bottom plates at 50 ml per well. IL-2 fusion proteins and control proteins were added to cells (50 m ⁇ as 2x stimulus). CD49b antibody (5 ml, DX5 clone) was added to each well prior to incubating the cells at 37°C for 30 min. Cells were fixed with 8% PFA (4% final).
- Cells were washed 2x with PBS-2% FBS and resuspended in 75 ml Phosflow Perm buffer III buffer and incubated for 1 hr at 4°C. Cells were washed 3x with PBS-2% FBS and stained in 50 m ⁇ of FACS buffer containing antibodies against CD3 (17A2), CD4 (GK1.5), CD8a (53-6.7), CD8b (YTS156.7.7), CD25 (7D4), and pSTAT5 (clone 47). Samples were washed 2x and analyzed on a flow cytometer.
- Ki67 assay 1x105 splenocytes were plated in 96 well U-bottom plates in RPMI media supplemented with 10% FBS and cultured at 37°C for 5 days prior to staining for Ki-67. Briefly, cells were surface stained with antibodies against CD3 (145-201), CD4 (GK1.4), CD8 (53-6.7), CD25(PC61), and NK1.1 (PK136), then fixed and permeabilized using Foxp3/ Transcription Factor Staining Buffer Set (Thermo Fisher Scientific) according to manufacturer’s protocol. Ki67 antibody (clone 16A8) was added for 45min at 4°C, after which the cells were washed and analyzed on a flow cytometer.
- IL-2 fusion proteins were captured onto the CM4 sensor chip via their Fc by a covalently immobilized anti-human Fc capture antibody at 0.75 pg/mL and a flow rate of 10 pL/min for 30s. Antibody was not captured on flow cell 1 to serve as a reference
- antigens were first captured on the chip and IL-2 fusion proteins then injected as analytes.
- in-house generated or commercially purchased histidine- tagged IL-2 receptors were diluted in running buffer to 0.125pg/mL and captured on the CM4 sensor chip amine-coupled with anti-HIS antibody for 1 minute at 10 pL/min.
- IL-2 receptors were not captured on flow cell 1 to serve as a reference surface.
- IL-2 fusion proteins from lOOOnM to 4.1nM (3-fold dilution series) were injected over flowcell 1 and 2 for 2 min and allowed to dissociate for 1 min.
- This example describes experiments to test the capacity of IL-2 fusion compounds to activate STAT5 in mouse NK cells and to induce NK-mediated toxicity in mice.
- IL-2 and IL-2 variants with reduced binding to CD25/IL2Ra to activate splenic cell subsets were tested with a STAT5 assay.
- IL-2 and a previously published IL-2 variant (IL-2v) fused to control antibody (xHA), xHA-IL-2v were used to stimulate mouse splenocytes containing CD8 T cells, CD4 T cells and NK cells.
- STAT5 activation in different splenic subsets was measured by flow cytometry, as described in Example 1.
- CD8 T cells were identified in the CD3+CD4- gate/subset
- Treg cells were identified as CD3+CD4+CD25+
- NK cells were identified as CD3-CD49b+.
- FIG. 5 shows the results of this experiment.
- NK cells were ⁇ 10x more sensitive to IL-2 stimulation than CD8+ T cells, while Treg cells were the most sensitive (FIG. 5 at left).
- Treg cells were the most sensitive (FIG. 5 at left).
- IL-2v due to its lowered binding to CD25, NK cells were ⁇ 10x more sensitive to IL-2v stimulation than both CD8 T cells and Treg cells (FIG. 5 at right).
- NK-cell induced toxicity was measured in mice treated with an IL-2 variant with reduced binding CD25/IL2Ra.
- NK-cell induced toxicity upon treatment with the IL-2 variants can manifest as body weight loss.
- B6 mice of 8-10 weeks of age were injected subcutaneously with a single dose of indicated compounds and their body weights recorded daily.
- xHA-IL-2v was dosed at 1 mg/kg or 5mg/kg together with anti -PD 1 (xPDl) at 2.5 mg/kg, while TAg-IL-2v was dosed alone at 5 mg/kg.
- NK cells were depleted with anti-NKl.
- l antibody PK136 clone
- the depleting antibody was injected two days prior to TAg-IL-2v dosing and one day after dosing to maintain depletion.
- FIGS. 6A & 6B show the results of these experiments.
- IL-2 variant (IL-2v) fused to either control xHA antibody (xHA-IL-2v) or FAP antibody (TAg-IF-2v) induced body weight loss in mice (FIG. 6A).
- This body weight loss was mediated by NK cells as evident in mice where NK cells were depleted with NK1.1 antibody (FIG. 6B).
- Such toxicity mediated by NK cells could limit maximum tolerated dose of IF-2-based therapeutics in humans.
- Maximum tolerated dose for control antibody targeted-IF2v or tumor antigen targeted-IF2v in mice was well below 5mg/kg.
- Example 3 Characterization of anti-mouse CD8 antibodies
- This example describes the characterization of anti-mouse CD8 antibodies.
- the binding affinity of anti-mouse CD8 antibodies was determined through flow cytometry analysis. Fresh splenocytes were incubated with the either xCD8abl (clone 2.43), xCD8ab2 (clone YTS156.7.7) or xCD8ab2.1 for 2 hours at 4 °C. xCD8abl (clone 2.43) and xCD8ab2 (clone YTS156.7.7) sequences have been previously published.
- the xCD8ab2.1 clone is derived from xCD8ab2 by introduction of mutations N95A (VH) and D92A (VK).
- xCD8ab2 had a higher affinity for CD8+ T cells than xCD8abl .
- xCD8ab2.1 is a lower affinity variant of xCD8ab2 that was generated by introducing two mutations (N95A (VH) and D92A (VK)) in xCD8ab2.
- CD8+ T cells were purified from splenocytes from OT-I transgenic mice and co cultured with EL-4-OVA cancer line (ATCC), at 100,000 cells each for 24hr. The cells were analyzed for upregulation of activation markers such as CD25 and CD69 by cell surface staining and flow cytometry. As shown in FIG. 8, both xCD8abl and xCD8ab2 blocked T cell activation, suggesting that these antibodies interfered with and blocked the interaction of CD8 with MHC. xCD8ab2 blocked T cell activation more potently, correlating with its higher binding affinity to CD8.
- mice C57BL6 female mice (Jackson Labs) at 8-10 weeks of age were housed and acclimated at the vivarium facility.
- B6 mice were injected with B16 tumor cells and tumors allowed to grow to 200-250 mm 3 before they were dosed with indicated IL-2 fusions at 1 mg/kg. Tumors were removed day 5 post dose, digested to single cells and profiled by flow cytometry to detect CD8+ T cells and NK cells (NK1.1+CD3-). Briefly, tumors were digested using Mouse Tumor Dissociation Kit (Miltenyi Biotec, 130-096-730) in Miltenyi Gentle MACS C tubes according to manufacturer’s protocol. Isolated cells were counted and lOxlO 6 cells were stained with antibodies against CD45, CD3, CD4, CD8, CD25, and CD49b.
- Mouse Tumor Dissociation Kit Miltenyi Biotec, 130-096-730
- Isolated cells were counted and lOxlO 6 cells were stained with antibodies against CD45, CD3, CD4, CD8, CD25, and CD49b.
- IL-2 mutein variants fused to CD8 antibodies were tested for selective targeting of CD8+ T cells over other immune cells expressing IL-2R.
- IL-2 muteins were fused to a previously published anti-mouse CD8 antibody, xmCD8abl (2.43 clone) in a B format.
- Mouse splenocytes were treated with the IL-2 mutein fusions and a STAT5 assay was performed as described in Example 1.
- Table 1 and FIG. 9 summarize the results of this experiment.
- IL-2 muteins fused to CD8 antibody in format B selectively targeted CD8+ T cells over other cells that express IL-2R, including NK cells.
- Activity on Tregs was used as a proxy for IL- 2Ra/CD25 binding, since Tregs express CD25 while other cells do not.
- Other sequences also preferentially targeted CD8 T cells over NK cells but had increased activity on Tregs as a result of higher CD25 binding.
- activity of IL-2 in this assay is ⁇ 0.001 nM (panel A of FIG. 5)
- all of sequences included in Table 1 showed at least 50% reduced binding to IL2Ra/CD25.
- several sequences were identified with lowest activity on Tregs (m3, m4, m5, mlO, as indicated in Table 1).
- Table 1 Identification of IL-2 muteins fused to CD8 antibodies with lowest selective activity on Tregs and highest activity on CD8 T cells, as measured by STAT5 assay (% pSTAT5+).
- CD8-IL2 muteins induced more complete tumor regressions than TAg-IL-2v in a single dose regimen when co-administered with anti-PDl.
- the CD8ab2 fusion induced more complete tumor regressions than CD8abl fusion.
- IL-2 mutein IL-2m4 was fused to either xmCD8ab2 or xmCD8ab2.1 in format C.
- xmCD8ab2.1 is a lower affinity version of xmCD8ab2.
- a STAT5 assay on mouse splenocytes was performed as described in Example 1. As shown in FIG. 13, the xmCD8ab2.1- IL-2m4 fusion had lower potency and lower selectivity for CD8+ T cells over NK cells as compared to xmCD8ab2-IL-2m4.
- the xmCD8ab2-IL2m4 and xmCD8ab2.1 -IL2m4 were also tested for their ability to expand CD8+ T cells in vivo.
- Blood was collected from naive B6 mice treated with the indicated compounds at 1 mg/kg.
- Levels of NK cells and CD8+ T cells were determined by flow cytometry. As shown in FIG. 14, both fusions induced higher in vivo expansion of CD8 T cells than NK cells.
- Example 5 Characterization of anti-CD8:IL-2 mutein fusion proteins with decreased binding to IL-2RP and IL-2Ry
- This example describes the characterization of xmCD8-IL-2 muteins with decreased binding to IL-2Rp/y.
- Splenocytes from B6 mice bearing B16 tumors were incubated with indicated protein for 30 min in RPMI media together with anti-CD49b staining antibody after which cells were stained for cell surface markers (CD3, CD4, CD8, CD25) and for intracellular STAT5, according to the protocol in Example 1.
- Data was represented as mean fluorescence intensity (MFI) for STAT5 in indicated cell subsets.
- Splenocytes from B6 mice bearing B16 tumors were incubated with indicated protein for 5 days in complete RPMI media after which cells were stained for cell surface markers (CD3, CD4, CD8, CD25, NK1.1) and for intracellular marker of proliferation, Ki67, a downstream signaling event from IL-2Rp/y and STAT5 according to the protocol in Example 1.
- cell surface markers CD3, CD4, CD8, CD25, NK1.1
- Ki67 intracellular marker of proliferation
- Table 2 STAT5 assay of IL-2 mutein sequences fused to higher affinity CD8 antibodies.
- Table 3 STAT5 assay of sequences of IL-2 muteins fused to lower affinity CD8 antibodies.
- IL-2 muteins with selected mutations were fused to xmCD8ab2 antibody in format C and tested in Ki67 assay on mouse splenocytes.
- Ki67 is an intracellular marker of proliferation and represents a downstream signaling event of IL-2Rp/y and STAT5.
- Table 4 and FIGS. 17A & 17B summarize the results of these experiments.
- TAg-2v fusion in format B was included as a reference.
- Table 4 Ki67 assay for sequences of IL-2 muteins fused to xmCD8ab2 anti-CD8 antibody.
- IL-2 muteins with selected mutations listed in the table below were fused to xmCD8ab2.1 antibody in format C and tested in Ki67 assay on mouse splenocytes.
- Table 5 and FIGS. 18A & 18B show the results of these experiments.
- Table 5 Ki67 assay of preferred sequences of IL-2 muteins fused to xmCD8ab2.1 anti-CD8 antibody.
- CD8-IL2 fusions have a range of selectivity for CD8 T cells over NK cells with xmCD8ab2-IL2m4 and xmCD8ab2-IL2m4.2 being the highest (>1000x), followed by xmCD8ab2.1-IL2m4 ( ⁇ 50-100x) and xmCD8ab2.1-IL2m4.2 the lowest ( ⁇ 10x).
- the m4 mutein fusion has lowered binding to IL-2Ra, while the m4.1 and m4.2 muteins have contain additional mutations that lower binding to IL-2RPy.
- Example 6 Testing effects of CD8:IL2 fusion proteins in combination with anti-PD-1 in a B16 tumor model
- CD8-IL2 fusions with varying degrees of selectivity for CD8 T cells over NK cells were tested in the B16 tumor model as described in Example 4. All mice were dosed with 1 mg/kg of the indicated fusions together with 5 mg/kg of anti-PDl. As shown in FIG. 20, CD8-IL-2 performed better than TAg-IL-2v (see FIG. 10) at a lower dose. CD8-IL2 fusion with the lowest selectivity for CD8 T cells had the least efficacy in the B16 model, approaching that observed for TAg-IL-2v (FIG. 10). Selectivity of >10x was required for best efficacy and >40% tumor free mice.
- CD8-IL-2 The performance of CD8-IL-2 was further tested by analyzing the expansion of tumor- antigen specific T cells upon treatment.
- B6 mice were injected with B16 tumor cells and tumors allowed to grow to 200-250 mm 3 before they were dosed with indicated IL-2 fusions at 1 mg/kg together with 5mg/kg of xPDl .
- Tumors were removed day 5 post dose, digested to single cells and profiled by flow cytometry to detect CD8+ T cells and NK cells (NK1.1+CD3-).
- Cells were also stained with pl5E tetramer (TB-M507-2, MBL) according to manufacturer’s protocol to detect T cells that recognize pl 5E tumor antigen. As shown in FIG.
- both xmCD8ab2- IL2m4.2 and xmCD8ab2.1-IL2m4 induced >15x expansion of total intratumoral CD8+ T cells and 5-17x expansion in pl5E tumor antigen-specific T cells with low to no expansion of NK cells.
- a STAT5 assay was performed to compare the potency of a bivalent low affinity fusion and a high affinity monovalent fusion.
- Splenocytes from B6 mice bearing B16 tumors were incubated with a fusion protein for 30min in RPMI media after which cells were stained for cell surface markers (CD3, CD4, CD8, CD25) and for intracellular STAT5, according to the protocol in Example 1.
- the bivalent low affinity fusion had similar potency as a high affinity monovalent fusion.
- bivalent xmCD8ab2.1 antibody in format A was tested in the B16 tumor model as described in Example 4. Mice were dosed with PBS as control or 1 mg/kg of the indicated fusion together with 5 mg/kg of anti -PD 1 (9 mice per group). As shown in FIG. 23, IL-2m4.2 fusion fused to high affinity xmCD8ab2 antibody (in format C) or to bivalent xmCD8ab2.1 antibody (in format A) had similar in vivo efficacy to IL-2m4.2 fusion fused to high affinity xmCD8ab2 antibody (in format C) (see FIG. 20). Thus, bivalent C-terminal format (format A) is also very efficacious.
- CD8+ T cells were purified from splenocytes from OT-I mice and co-cultured with EL-4-OVA line (ATCC), at 100,000 cells each for 24hr. Cells were analyzed for upregulation of activation markers such as CD25 and CD69 by cell surface staining and flow cytometry as described in Example 3. As shown in FIG. 24, certain CD8 antibodies did not block CD8 T cell activation. The xmCD8ab3 antibody did not block CD8 T cell activation even at 200nM concentration. The xmCD8ab3 antibody was bivalent.
- CD8+ T cells were purified from splenocytes from OT-I mice and co-cultured with EL-4-OVA line (ATCC), at 100,000 cells each for 24hr. Cells were analyzed for upregulation of activation markers such as CD25 and CD69 by cell surface staining and flow cytometry as described in Example 3. As shown in FIG. 24, certain CD8 antibodies did not block CD8 T cell activation. The xmCD8ab3 antibody did not block CD8 T cell activation even at 200nM concentration. The xmCD8ab3 antibody was bivalent.
- splenocytes from B6 mice bearing B16 tumors were incubated with indicated protein for 30min in RPMI media after which cells were stained for cell surface markers (CD3, CD4, CD8, CD25, NK1.1) and for intracellular STAT5, according to the protocol in Example 1.
- cell surface markers CD3, CD4, CD8, CD25, NK1.1
- STAT5 intracellular STAT5
- IL-2m4.2 fused to MHC non-blocking antibodies were also tested in a B16 tumor model as described in Example 4. Mice were dosed with PBS, 0.3 mg/kg (FIG. 26A) or 1 mg/kg (FIG. 26B) of the indicated fusions together with 5 mg/kg of anti -PD 1 (9 per group). As shown in FIGS. 26A & 26B, the MHC non-blocking antibody was more optimal in vivo. IL-2m4.2 fusion fused to MHC non-blocking xmCD8ab3 antibody (in format C) was much more efficacious than IL-2m4.2 fusion fused to MHC blocking xmCD8ab2 antibody (in format C).
- CD45+ cells were purified (Miltenyi’s LS columns according to manufacturer’s protocol) and stimulated with indicated fusion proteins for 30min. Cells were stained for cell surface markers (CD3, CD4, CD8, CD25, CD49b, and PD1) and for intracellular phospho-STAT5. As shown in FIG.
- fusion of IL-2 mutein IL2mlO with anti-PDl antibody preferentially targeted PD1+ T cells over PD1- T cells; however both CD8+PD1+ T cells and CD4+CD25+PD1+ Treg cells were targeted.
- Example 7 Impact of IL-2 mutations on activity and selectivity of CD8-IL-2 fusions in hPBMCs
- This example describes the impact of IL-2 mutations on the activity and selectivity of CD 8 -IL-2 fusions in hPBMCs.
- Tregs are shown as representative examples of cells expressing IL-2RPy.
- Table 6 depicts activity of IL-2 muteins IL-2ml to IL-2mlO fused to xmCD8abl on human Tregs as it compares to IL-2v fused to control xHA antibody, all in format B.
- Table 6 shows that IL-2 muteins IL-2ml to IL-2mlO fused to xmCD8abl all had significantly reduced activity on Tregs, thereby significantly reduced binding to IL-2Ra, compared to wild-type IL-2, and comparable to IL-2v which has no binding to IL-2Ra (Klein et al, Oncoimmunol. 2017; 6(3); el 277306).
- *IL-2v was fused to control xHA antibody.
- Table 7 depicts the activity of IL-2 muteins IL-2ml0.1 to IL-2ml0.11 fused to xmCD8abl on human Tregs as compared to IL-2mlO fused to xmCD8abl, all in format B.
- Table 7 shows that IL-2mlO.1 to IL-2mlO.11 fused to xmCD8abl all have significantly reduced activity on Tregs compared to IL-2mlO.
- IL-2mlO has reduced to no activity on IL2Ra, therefore additional mutations present in IL-2mlO.1 to IL-2mlO.11 reduced activity of the molecules by decreasing the binding to IL-2RPy.
- Table 8 depicts the activity of IL-2 muteins IL-2m4.1 to IL-2m4.6 and IL-2m4.9 to IL- 2m4.24 fused to xmCD8abl on human Tregs as compared to IL-2m4 fused to xmCD8abl , all in format B.
- IL-2m4 has reduced to no activity on IL2Ra, therefore additional mutations present in the IL-2 mutein fusion proteins shown in Table 8 reduced activity of the molecules by decreasing the binding to IL-2RPy.
- Table 8 Impact of IL-2 mutations on activity of CD8-IL-2 fusions in hPBMCs
- CD8-IL-2 mutein fusions The selective stimulation of human CD8+ T cells by the CD8-IL-2 mutein fusions was also tested. Indicated IL-2 muteins were fused to previously published anti-human CD8 antibody clone OKT8 (xhCD8ab) in format C and tested in STAT5 assay on hPBMCs. Tables 9 and 10 summarize the results of this experiment. CD8-IL2 mutein fusions selectively and potently stimulated human CD8 T cells. IL-2m4 had reduced to no activity on IL2Ra, therefore additional mutations present in the IL-2 mutein fusion proteins shown in Table 9 reduced activity of the molecules by decreasing the binding to IL-2Rbg.
- Table 9 Stimulation of human Tregs by CD8-IL-2 molecules.
- Table 10 Stimulation of human CD8+ T cells by CD8-IL-2 molecules.
- Tables 11 and Table 12 depict the activity of IL-2ml0.12 mutein containing Q126A mutation in the context of the fusion to either control antibody (xHA) or xhCD8ab antibody.
- This mutation in the context of CD8-IL2 fusion decreased the activity of the CD8-IL2 fusion on human Tregs compared to that containing the IL-2mlO mutein (Tables 6 and 7) but enabled potent and selective activation of CD8+ T cells.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Epidemiology (AREA)
- Cell Biology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202080051337.9A CN114786708A (zh) | 2019-06-05 | 2020-06-05 | 用于调节免疫细胞功能的突变体白介素-2多肽与抗原结合分子的融合物 |
| JP2021572298A JP7778571B2 (ja) | 2019-06-05 | 2020-06-05 | 免疫細胞機能をモジュレートするための変異体インターロイキン-2ポリペプチドと抗原結合分子の融合体 |
| CA3142738A CA3142738A1 (en) | 2019-06-05 | 2020-06-05 | Fusions of mutant interleukin-2 polypeptides with antigen binding molecules for modulating immune cell function |
| AU2020287373A AU2020287373B2 (en) | 2019-06-05 | 2020-06-05 | Fusions of mutant interleukin-2 polypeptides with antigen binding molecules for modulating immune cell function |
| EP20819187.4A EP3980051A4 (en) | 2019-06-05 | 2020-06-05 | FUSIONS OF MUTANT INTERLEUKIN-2 POLYPEPTIDES WITH ANTIGEN-BINDING MOLECULES TO MODULATE THE FUNCTION OF IMMUNE CELLS |
| US17/616,157 US20220251202A1 (en) | 2019-06-05 | 2020-06-05 | Fusions of mutant interleukin-2 polypeptides with antigen binding molecules for modulating immune cell function |
| KR1020227000163A KR20220083660A (ko) | 2019-06-05 | 2020-06-05 | 면역 세포 기능을 조정하기 위한 돌연변이체 인터류킨-2 폴리펩티드와 항원 결합 분자의 융합체 |
| JP2025000023A JP2025060983A (ja) | 2019-06-05 | 2025-01-05 | 免疫細胞機能をモジュレートするための変異体インターロイキン-2ポリペプチドと抗原結合分子の融合体 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201962857726P | 2019-06-05 | 2019-06-05 | |
| US62/857,726 | 2019-06-05 |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO2020247843A2 true WO2020247843A2 (en) | 2020-12-10 |
| WO2020247843A3 WO2020247843A3 (en) | 2021-03-04 |
| WO2020247843A8 WO2020247843A8 (en) | 2021-04-22 |
Family
ID=73652315
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2020/036454 Ceased WO2020247843A2 (en) | 2019-06-05 | 2020-06-05 | Fusions of mutant interleukin-2 polypeptides with antigen binding molecules for modulating immune cell function |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US20220251202A1 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3980051A4 (cg-RX-API-DMAC7.html) |
| JP (2) | JP7778571B2 (cg-RX-API-DMAC7.html) |
| KR (1) | KR20220083660A (cg-RX-API-DMAC7.html) |
| CN (1) | CN114786708A (cg-RX-API-DMAC7.html) |
| AU (1) | AU2020287373B2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3142738A1 (cg-RX-API-DMAC7.html) |
| WO (1) | WO2020247843A2 (cg-RX-API-DMAC7.html) |
Cited By (31)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20220170028A1 (en) * | 2019-06-14 | 2022-06-02 | Cugene Inc | Novel interleukin-2 variants and bifunctional fusion molecules thereof |
| WO2022200525A1 (en) | 2021-03-26 | 2022-09-29 | Innate Pharma | Multispecific proteins comprising an nkp46-binding site, a cancer antgienge binding site fused to a cytokine for nk cell engaging |
| US11471490B2 (en) | 2017-07-03 | 2022-10-18 | Torque Therapeutics, Inc. | T cells surface-loaded with immunostimulatory fusion molecules and uses thereof |
| WO2022245500A1 (en) * | 2021-05-19 | 2022-11-24 | Asher Biotherapeutics, Inc. | Il-21 polypeptides and targeted constructs |
| WO2022258673A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific antibodies binding to cd20, nkp46, cd16 and conjugated to il-2 |
| WO2022258691A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkg2d, a cytokine receptor, a tumour antigen and cd16a |
| WO2022258678A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp30, a cytokine receptor, a tumour antigen and cd16a |
| WO2022258662A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp46, a cytokine receptor, a tumour antigen and cd16a |
| WO2023004305A1 (en) * | 2021-07-20 | 2023-01-26 | Inhibrx, Inc. | Cd8-targeted modified il-2 polypeptides and uses thereof |
| WO2023004304A1 (en) * | 2021-07-20 | 2023-01-26 | Inhibrx, Inc. | Cd8-binding polypeptides and uses thereof |
| WO2023010032A1 (en) * | 2021-07-28 | 2023-02-02 | Anwita Biosciences, Inc. | Interleukin-2 muteins, fusion proteins, pharmaceutical compositions, and therapeutic applications |
| US11642417B2 (en) | 2020-05-13 | 2023-05-09 | Bonum Therapeutics, Inc. | Compositions of protein complexes and methods of use thereof |
| WO2023092006A1 (en) * | 2021-11-17 | 2023-05-25 | Good Therapeutics, Inc. | Compositions of protein complexes and methods of use thereof |
| US11702461B2 (en) | 2018-01-09 | 2023-07-18 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides |
| US11708400B2 (en) | 2016-12-22 | 2023-07-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US20230235005A1 (en) * | 2020-07-02 | 2023-07-27 | Inhibrx, Inc. | Polypeptides Comprising Modified IL-2 Polypeptides and Uses Thereof |
| US11767355B2 (en) | 2017-03-15 | 2023-09-26 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11845801B2 (en) | 2019-06-12 | 2023-12-19 | AskGene Pharma, Inc. | IL-15 prodrugs and methods of use thereof |
| US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| WO2023245097A3 (en) * | 2022-06-16 | 2024-02-01 | Cephalon Llc | Anti-pd-1 antibody-attenuated il-2 immunoconjugates and uses thereof |
| US11896648B2 (en) | 2020-10-22 | 2024-02-13 | Gilead Sciences, Inc. | Interleukin-2 variant proteins fused to human IgG4 Fc and uses thereof |
| JP2024515263A (ja) * | 2021-04-09 | 2024-04-08 | オーエスイー・イミュノセラピューティクス | 改善された特性を有する二機能性分子のための新規足場構造 |
| JP2024522949A (ja) * | 2021-04-16 | 2024-06-24 | オリオンズ バイオサイエンス インコーポレイテッド | Il-2系構築物 |
| US12024559B2 (en) | 2020-10-23 | 2024-07-02 | Asher Biotherapeutics, Inc. | Fusions with CD8 antigen binding molecules for modulating immune cell function |
| US12029782B2 (en) | 2020-09-09 | 2024-07-09 | Cue Biopharma, Inc. | MHC class II T-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (T1D) and methods of use thereof |
| US12269855B2 (en) | 2018-09-21 | 2025-04-08 | Innovent Biologics (Suzhou) Co., Ltd. | Interleukin-2 and use thereof |
| WO2025137093A1 (en) * | 2023-12-19 | 2025-06-26 | Cephalon Llc | Uses for attenuated il-2 immunoconjugates |
| US12459980B2 (en) | 2018-07-25 | 2025-11-04 | AskGene Pharma, Inc. | IL-21 prodrugs and methods of use thereof |
| EP4471068A4 (en) * | 2022-01-30 | 2026-02-11 | Inst Biophysics Cas | BIFUNCTIONAL MOLECULE FORMED BY THE FUSSION OF PD1 ANTIBODIES AND INTERLEUKIN 2 |
| US12600762B2 (en) | 2020-01-11 | 2026-04-14 | AskGene Pharma, Inc. | Masked cytokines and methods of use thereof |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP4556493A1 (en) * | 2022-07-11 | 2025-05-21 | Genuv Inc. | Cytokine fusion protein |
| EP4605422A2 (en) * | 2022-10-20 | 2025-08-27 | Repertoire Immune Medicines, Inc. | Cd8 t cell targeted il2 |
| CN116041539B (zh) * | 2022-10-31 | 2023-07-21 | 山东博安生物技术股份有限公司 | Il-2突变体免疫缀合物 |
| CN118680877A (zh) * | 2023-03-21 | 2024-09-24 | 信达生物制药(苏州)有限公司 | 抗pd-1与突变il-2免疫缀合物制剂 |
| TW202545980A (zh) * | 2024-02-01 | 2025-12-01 | 瑞典商阿斯特捷利康公司 | Cd8結合細胞介素銜接器及其使用方法 |
| CN118373896B (zh) * | 2024-04-19 | 2025-07-29 | 上海科棋药业科技有限公司 | 抗pd-1抗体与il-2突变体的双功能融合蛋白 |
Family Cites Families (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2010206840B2 (en) | 2009-01-21 | 2015-02-05 | Amgen Inc. | Compositions and methods of treating inflammatory and autoimmune diseases |
| JP5764127B2 (ja) * | 2009-08-17 | 2015-08-12 | ロシュ グリクアート アーゲー | 標的化イムノコンジュゲート |
| EA201892619A1 (ru) * | 2011-04-29 | 2019-04-30 | Роше Гликарт Аг | Иммуноконъюгаты, содержащие мутантные полипептиды интерлейкина-2 |
| US9580486B2 (en) | 2013-03-14 | 2017-02-28 | Amgen Inc. | Interleukin-2 muteins for the expansion of T-regulatory cells |
| EP2970486B1 (en) * | 2013-03-15 | 2018-05-16 | Xencor, Inc. | Modulation of t cells with bispecific antibodies and fc fusions |
| PT3102595T (pt) | 2014-02-06 | 2019-01-11 | Hoffmann La Roche | Proteínas de fusão de interleucina-2 e suas utilizações |
| AU2016304794B2 (en) * | 2015-08-07 | 2021-07-15 | ALX Oncology Inc. | Constructs having a SIRP-alpha domain or variant thereof |
| CN116769054A (zh) * | 2016-02-05 | 2023-09-19 | 奥里尼斯生物科学私人有限公司 | 双特异性信号传导剂及其用途 |
| US20200010528A1 (en) | 2017-03-15 | 2020-01-09 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| MY201482A (en) * | 2017-04-03 | 2024-02-26 | Hoffmann La Roche | Immunoconjugates of an anti-pd-1 antibody with a mutant il-2 or with il-15 |
| CN110505883A (zh) * | 2017-04-13 | 2019-11-26 | 豪夫迈·罗氏有限公司 | 供治疗癌症的方法中使用的白介素-2免疫缀合物,cd40激动剂,和任选地pd-1轴结合拮抗剂 |
| US10676516B2 (en) * | 2017-05-24 | 2020-06-09 | Pandion Therapeutics, Inc. | Targeted immunotolerance |
| CN111201035A (zh) | 2017-06-19 | 2020-05-26 | 梅迪塞纳医疗股份有限公司 | Il-2超激动剂、激动剂及其融合体的用途和方法 |
| CN111511763B (zh) | 2017-08-09 | 2024-05-31 | 奥里尼斯生物科学有限公司 | Cd8结合剂 |
| KR102777151B1 (ko) | 2017-11-21 | 2025-03-05 | 더 보드 어브 트러스티스 어브 더 리랜드 스탠포드 주니어 유니버시티 | 인터루킨-2의 부분 효능제 |
| KR20230112632A (ko) * | 2020-10-23 | 2023-07-27 | 애셔 바이오테라퓨틱스, 인크. | 면역 세포 기능을 조절하기 위한 cd8 항원 결합 분자와의 융합 |
-
2020
- 2020-06-05 EP EP20819187.4A patent/EP3980051A4/en active Pending
- 2020-06-05 US US17/616,157 patent/US20220251202A1/en active Pending
- 2020-06-05 WO PCT/US2020/036454 patent/WO2020247843A2/en not_active Ceased
- 2020-06-05 CN CN202080051337.9A patent/CN114786708A/zh active Pending
- 2020-06-05 KR KR1020227000163A patent/KR20220083660A/ko active Pending
- 2020-06-05 CA CA3142738A patent/CA3142738A1/en active Pending
- 2020-06-05 JP JP2021572298A patent/JP7778571B2/ja active Active
- 2020-06-05 AU AU2020287373A patent/AU2020287373B2/en active Active
-
2025
- 2025-01-05 JP JP2025000023A patent/JP2025060983A/ja active Pending
Cited By (54)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11905320B2 (en) | 2016-12-22 | 2024-02-20 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11708400B2 (en) | 2016-12-22 | 2023-07-25 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11739133B2 (en) | 2016-12-22 | 2023-08-29 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12180258B2 (en) | 2016-12-22 | 2024-12-31 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12152061B2 (en) | 2016-12-22 | 2024-11-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12145973B2 (en) | 2016-12-22 | 2024-11-19 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11987610B2 (en) | 2016-12-22 | 2024-05-21 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851467B2 (en) | 2016-12-22 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US12421287B2 (en) | 2016-12-22 | 2025-09-23 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11851471B2 (en) | 2017-01-09 | 2023-12-26 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides and methods of use thereof |
| US11993641B2 (en) | 2017-03-15 | 2024-05-28 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11767355B2 (en) | 2017-03-15 | 2023-09-26 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11958893B2 (en) | 2017-03-15 | 2024-04-16 | Cue Biopharma, Inc. | Methods for modulating an immune response |
| US11471490B2 (en) | 2017-07-03 | 2022-10-18 | Torque Therapeutics, Inc. | T cells surface-loaded with immunostimulatory fusion molecules and uses thereof |
| US11702461B2 (en) | 2018-01-09 | 2023-07-18 | Cue Biopharma, Inc. | T-cell modulatory multimeric polypeptides comprising reduced-affinity immunomodulatory polypeptides |
| US12459980B2 (en) | 2018-07-25 | 2025-11-04 | AskGene Pharma, Inc. | IL-21 prodrugs and methods of use thereof |
| US12269855B2 (en) | 2018-09-21 | 2025-04-08 | Innovent Biologics (Suzhou) Co., Ltd. | Interleukin-2 and use thereof |
| US11845801B2 (en) | 2019-06-12 | 2023-12-19 | AskGene Pharma, Inc. | IL-15 prodrugs and methods of use thereof |
| US20220170028A1 (en) * | 2019-06-14 | 2022-06-02 | Cugene Inc | Novel interleukin-2 variants and bifunctional fusion molecules thereof |
| US12600762B2 (en) | 2020-01-11 | 2026-04-14 | AskGene Pharma, Inc. | Masked cytokines and methods of use thereof |
| US12485183B2 (en) | 2020-05-12 | 2025-12-02 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US11878062B2 (en) | 2020-05-12 | 2024-01-23 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12485184B2 (en) | 2020-05-12 | 2025-12-02 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US12257311B2 (en) | 2020-05-12 | 2025-03-25 | Cue Biopharma, Inc. | Multimeric T-cell modulatory polypeptides and methods of use thereof |
| US11642417B2 (en) | 2020-05-13 | 2023-05-09 | Bonum Therapeutics, Inc. | Compositions of protein complexes and methods of use thereof |
| US12303567B2 (en) | 2020-05-13 | 2025-05-20 | Bonum Therapeutics, Inc. | Compositions of protein complexes and methods of use thereof |
| US20230235005A1 (en) * | 2020-07-02 | 2023-07-27 | Inhibrx, Inc. | Polypeptides Comprising Modified IL-2 Polypeptides and Uses Thereof |
| JP2023532904A (ja) * | 2020-07-02 | 2023-08-01 | インヒブルクス インコーポレイテッド | 修飾il-2ポリペプチドを含むポリペプチド及びその使用 |
| US12029782B2 (en) | 2020-09-09 | 2024-07-09 | Cue Biopharma, Inc. | MHC class II T-cell modulatory multimeric polypeptides for treating type 1 diabetes mellitus (T1D) and methods of use thereof |
| US11896648B2 (en) | 2020-10-22 | 2024-02-13 | Gilead Sciences, Inc. | Interleukin-2 variant proteins fused to human IgG4 Fc and uses thereof |
| US12024559B2 (en) | 2020-10-23 | 2024-07-02 | Asher Biotherapeutics, Inc. | Fusions with CD8 antigen binding molecules for modulating immune cell function |
| WO2022200525A1 (en) | 2021-03-26 | 2022-09-29 | Innate Pharma | Multispecific proteins comprising an nkp46-binding site, a cancer antgienge binding site fused to a cytokine for nk cell engaging |
| JP2024515263A (ja) * | 2021-04-09 | 2024-04-08 | オーエスイー・イミュノセラピューティクス | 改善された特性を有する二機能性分子のための新規足場構造 |
| JP2024522949A (ja) * | 2021-04-16 | 2024-06-24 | オリオンズ バイオサイエンス インコーポレイテッド | Il-2系構築物 |
| EP4323392A4 (en) * | 2021-04-16 | 2025-03-19 | Orionis Biosciences, Inc. | IL-2-BASED CONSTRUCTS |
| GB2623654A (en) * | 2021-05-19 | 2024-04-24 | Asher Biotherapeutics Inc | Il-21 polypeptides and targeted constructs |
| JP2024522069A (ja) * | 2021-05-19 | 2024-06-11 | アシャ バイオセラピューティクス,インク. | Il-21ポリペプチド及び標的化コンストラクト |
| US12122827B2 (en) | 2021-05-19 | 2024-10-22 | Asher Biotherapeutics, Inc. | IL-21 polypeptides and targeted constructs |
| GB2623654B (en) * | 2021-05-19 | 2025-08-06 | Asher Biotherapeutics Inc | IL-21 polypeptides and targeted constructs |
| WO2022245500A1 (en) * | 2021-05-19 | 2022-11-24 | Asher Biotherapeutics, Inc. | Il-21 polypeptides and targeted constructs |
| US12247072B2 (en) | 2021-05-19 | 2025-03-11 | Asher Biotherapeutics, Inc. | IL-21 polypeptides and targeted constructs |
| WO2022258691A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkg2d, a cytokine receptor, a tumour antigen and cd16a |
| WO2022258673A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific antibodies binding to cd20, nkp46, cd16 and conjugated to il-2 |
| WO2022258678A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp30, a cytokine receptor, a tumour antigen and cd16a |
| WO2022258662A1 (en) | 2021-06-09 | 2022-12-15 | Innate Pharma | Multispecific proteins binding to nkp46, a cytokine receptor, a tumour antigen and cd16a |
| WO2023004305A1 (en) * | 2021-07-20 | 2023-01-26 | Inhibrx, Inc. | Cd8-targeted modified il-2 polypeptides and uses thereof |
| WO2023004304A1 (en) * | 2021-07-20 | 2023-01-26 | Inhibrx, Inc. | Cd8-binding polypeptides and uses thereof |
| EP4376870A4 (en) * | 2021-07-28 | 2025-07-23 | Anwita Biosciences Inc | INTERLEUKIN-2 MUTEINS, FUSION PROTEINS, PHARMACEUTICAL COMPOSITIONS AND THERAPEUTIC APPLICATIONS |
| WO2023010032A1 (en) * | 2021-07-28 | 2023-02-02 | Anwita Biosciences, Inc. | Interleukin-2 muteins, fusion proteins, pharmaceutical compositions, and therapeutic applications |
| WO2023092006A1 (en) * | 2021-11-17 | 2023-05-25 | Good Therapeutics, Inc. | Compositions of protein complexes and methods of use thereof |
| EP4471068A4 (en) * | 2022-01-30 | 2026-02-11 | Inst Biophysics Cas | BIFUNCTIONAL MOLECULE FORMED BY THE FUSSION OF PD1 ANTIBODIES AND INTERLEUKIN 2 |
| US12281148B2 (en) | 2022-06-16 | 2025-04-22 | Cephalon Llc | Anti-pd-1 antibody-attenuated IL-2 immunoconjugates and uses thereof |
| WO2023245097A3 (en) * | 2022-06-16 | 2024-02-01 | Cephalon Llc | Anti-pd-1 antibody-attenuated il-2 immunoconjugates and uses thereof |
| WO2025137093A1 (en) * | 2023-12-19 | 2025-06-26 | Cephalon Llc | Uses for attenuated il-2 immunoconjugates |
Also Published As
| Publication number | Publication date |
|---|---|
| AU2020287373B2 (en) | 2026-01-29 |
| JP2022535130A (ja) | 2022-08-04 |
| CA3142738A1 (en) | 2020-12-10 |
| KR20220083660A (ko) | 2022-06-20 |
| CN114786708A (zh) | 2022-07-22 |
| EP3980051A2 (en) | 2022-04-13 |
| JP2025060983A (ja) | 2025-04-10 |
| EP3980051A4 (en) | 2023-09-13 |
| WO2020247843A8 (en) | 2021-04-22 |
| AU2020287373A1 (en) | 2022-01-06 |
| US20220251202A1 (en) | 2022-08-11 |
| JP7778571B2 (ja) | 2025-12-02 |
| WO2020247843A3 (en) | 2021-03-04 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2020287373B2 (en) | Fusions of mutant interleukin-2 polypeptides with antigen binding molecules for modulating immune cell function | |
| US20230055445A1 (en) | Pd-1 targeted il-15/il-15ralpha fc fusion proteins and uses in combination therapies thereof | |
| US12240911B2 (en) | Bispecific antibodies specific for OX40 | |
| JP7847584B2 (ja) | 免疫細胞機能をモジュレートするためのcd8抗原結合分子を有する融合物 | |
| US20220073646A1 (en) | Bispecific antibodies with tetravalency for a costimulatory tnf receptor | |
| JP2019533444A (ja) | IL−15/IL−15RアルファFc融合タンパク質およびPD−1抗体の断片を含む二重特異性ヘテロ二量体融合タンパク質 | |
| CN121779568A (zh) | 与t细胞结合的多功能分子及其治疗自身免疫性病症的用途 | |
| WO2022125694A1 (en) | Fusions of interleukin polypeptides with bispecific antigen binding molecules for modulating immune cell function | |
| US20250215081A1 (en) | Anti-cd19 agent and b cell targeting agent combination therapy for treating b cell malignancies | |
| US20240010695A1 (en) | Fusions of mutant interleukin-10 polypeptides with antigen binding molecules for modulating immune cell function | |
| US20250339519A1 (en) | Combination of cytokine fusion proteins with cd8 antigen binding molecules | |
| CN116829577A (zh) | 用于调节免疫细胞功能的突变型白介素-10多肽与抗原结合分子的融合物 | |
| EA052306B1 (ru) | Слитые белки и их применение, полинуклеотид, кодирующий их, вектор экспрессии, выделенная клетка-хозяин, способ получения слитого белка, фармацевтическая композиция, способ лечения рака, способ размножения т-клеток ex vivo | |
| CN116997362A (zh) | 含调节免疫细胞功能的cd8抗原结合分子的融合物 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20819187 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2021572298 Country of ref document: JP Kind code of ref document: A Ref document number: 3142738 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020287373 Country of ref document: AU Date of ref document: 20200605 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2020819187 Country of ref document: EP Effective date: 20220105 |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20819187 Country of ref document: EP Kind code of ref document: A2 |