WO2020242268A1 - 비오틴 모이어티와 결합된 생리활성 물질 및 이를 포함하는 경구 투여용 조성물 - Google Patents
비오틴 모이어티와 결합된 생리활성 물질 및 이를 포함하는 경구 투여용 조성물 Download PDFInfo
- Publication number
- WO2020242268A1 WO2020242268A1 PCT/KR2020/007053 KR2020007053W WO2020242268A1 WO 2020242268 A1 WO2020242268 A1 WO 2020242268A1 KR 2020007053 W KR2020007053 W KR 2020007053W WO 2020242268 A1 WO2020242268 A1 WO 2020242268A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- biotin moiety
- group
- seq
- bioactive substance
- bound
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 *C*C(CNC1CCC=C)C1*=C Chemical compound *C*C(CNC1CCC=C)C1*=C 0.000 description 6
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/41—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with two or more ring hetero atoms, at least one of which being nitrogen, e.g. tetrazole
- A61K31/4164—1,3-Diazoles
- A61K31/4188—1,3-Diazoles condensed with other heterocyclic ring systems, e.g. biotin, sorbinil
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/55—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug
- A61K47/551—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound the modifying agent being also a pharmacologically or therapeutically active agent, i.e. the entire conjugate being a codrug one of the codrug's components being a vitamin, e.g. niacinamide, vitamin B3, cobalamin, vitamin B12, folate, vitamin A or retinoic acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/61—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule the organic macromolecular compound being a polysaccharide or a derivative thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0053—Mouth and digestive tract, i.e. intraoral and peroral administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
Definitions
- the present invention relates to a physiologically active substance bound to a biotin moiety and a composition for oral administration comprising the same, and more specifically, to a physiologically active substance bound to a biotin moiety having excellent oral absorption rate in the body and a composition for oral administration comprising the same About.
- Diabetes due to the severe decrease in the quality of life of patients due to a moderate diet, the awareness of treatment and management is increasing, and the development of a therapeutic agent for improving or curing diabetes is urgently needed.
- Diabetes is divided into'type 1 diabetes', which is caused by a decrease in insulin secretion, and'type 2 diabetes,' which is caused by a decrease in metabolic control ability due to insulin resistance, but normal production of insulin.
- Type 2 diabetes and obesity are the causes of mutual pathogenesis, and are very dangerous diseases because they increase the risk of atherosclerosis, which is a major cause of death in diabetic patients as well as the cause of metabolic disease.
- glucagon is produced by the pancreas when blood sugar starts to drop due to drug treatment or disease, hormone or enzyme deficiency. Glucagon signals the liver to break down glycogen to release glucose, and is responsible for raising blood sugar levels to normal levels. In addition, it has been reported that glucagon has an anti-obesity effect by promoting fat breakdown by suppressing appetite and activating hormone sensitive lipase of adipocytes in addition to synergistic effects of blood sugar.
- GLP-1 glucagon-like peptide-1
- GLP-1 glucagon-like peptide-1
- Exendin-4 made from lizard venom, which has approximately 50% amino acid homology to GLP-1, is also known to activate GLP-1 receptors to reduce hyperglycemia in diabetic patients.
- An object of the present invention is to provide a physiologically active substance combined with a biotin moiety having excellent oral absorption rate in the body and a composition for oral administration comprising the same.
- One aspect of the present invention provides a bioactive substance combined with a biotin moiety and a method for preparing the same.
- compositions for oral administration comprising a bioactive substance bound to a biotin moiety.
- Another aspect of the present invention provides a pharmaceutical composition comprising a bioactive substance bound to a biotin moiety.
- Another aspect of the present invention provides a pharmaceutical composition for preventing or treating diabetes comprising a bioactive substance bound to a biotin moiety.
- Another aspect of the present invention provides a pharmaceutical composition for preventing or treating obesity comprising a bioactive substance bound to a biotin moiety.
- Another aspect of the present invention provides a pharmaceutical composition for preventing or treating osteoporosis comprising a bioactive substance bound to a biotin moiety.
- Another aspect of the present invention provides a pharmaceutical composition for preventing or treating fatty liver disease comprising a bioactive substance bound to a biotin moiety.
- Another aspect of the present invention provides a pharmaceutical composition for the prevention or treatment of irritable bowel syndrome comprising a bioactive substance combined with a biotin moiety.
- Another aspect of the present invention provides a pharmaceutical composition for preventing or treating neurodegenerative diseases comprising a bioactive substance combined with a biotin moiety.
- the bioactive material combined with the biotin moiety according to an embodiment of the present invention may have an excellent oral absorption rate by combining water-soluble biotin.
- the physiologically active substance combined with the biotin moiety can protect against degradation of physiologically active substances such as peptides from enzymes, and ultimately, the physiologically active substance penetrates the intestinal membrane to promote absorption in the intestine. Can be.
- bioactive substance combined with the biotin moiety can be absorbed through active transport through a sodium-dependent multivitamin transporter by being combined with biotin, a type of water-soluble vitamin B7.
- the biotin moiety may be bound to an inactive site of the physiologically active substance, and thus may not inhibit the activity of the physiologically active substance.
- Example 1 is a purification chromatogram of Example 3 according to an embodiment of the present invention.
- Examples 1 to 3 is a MALDI-TOF mass spectrometry spectrum of Examples 1 to 3 according to an embodiment of the present invention.
- 5 is a graph showing changes in blood sugar after administration of glucose to each sample.
- 6 is a graph showing changes in blood sugar after glucose was administered to each sample.
- Example 9 is a purification chromatogram of Example 10 according to an embodiment of the present invention.
- Example 10 is a chromatogram after purification of Example 10 according to an embodiment of the present invention.
- Example 11 is a reverse phase chromatogram of Example 11 according to an embodiment of the present invention.
- Example 12 is a MALDI-TOF mass spectrometry spectrum of Example 10 and Example 11 according to an embodiment of the present invention.
- Example 13 is a purification chromatogram for Examples 12 and 13 according to an embodiment of the present invention.
- Example 14 is a chromatogram after purification of Example 12 according to an embodiment of the present invention.
- Example 15 is a chromatogram after purification of Example 13 according to an embodiment of the present invention.
- the term “combination of these” included in the expression of the Makushi format refers to one or more mixtures or combinations selected from the group consisting of components described in the expression of the Makushi format, It means to include one or more selected from the group consisting of components.
- the description of “and/or B” means “and B, or A or B”.
- One aspect of the present invention provides a bioactive substance combined with a biotin moiety and a method for preparing the same.
- the bioactive material combined with the biotin moiety according to an aspect of the present invention may have an excellent oral absorption rate in the body.
- peptides and protein drugs correspond to BCS (Biopharmaceutical Classification System) Class 3, which has high water solubility and is restricted in the absorption site of the gastrointestinal tract.
- BCS Biopharmaceutical Classification System
- Peptide and protein drugs have high hydrophilicity and large molecular weight, can be degraded by gastric acid at a low pH, and are attacked by enzymes such as trypsin, and thus have low intestinal absorption.
- the oral bioavailability (BA) of peptide and protein drugs is about 0.1%, making it difficult to use as a pharmaceutical composition.
- BA oral bioavailability
- a technology that passes through the stomach using an enteric capsule is used, but there is a limitation in that the absorption rate of peptides and proteins cannot be fundamentally improved.
- the bioactive substance combined with the biotin moiety may increase intestinal membrane permeation, thereby promoting absorption in the intestine.
- physiologically active substance combined with the biotin moiety can be absorbed by active transport through a sodium-dependent multivitamin transporter by being combined with vitamin B7 and biotin, which are one type of water-soluble vitamin. have.
- unsubstituted or substituted means that can be unsubstituted or substituted, and “substituted” has one or more substituents, and the substituent is any of the main groups such as alkylene and heteroalkylene. It refers to a chemical moiety that is covalently bonded or fused with an atom.
- halo means fluorine, chlorine, bromine, iodine, and the like.
- alkyl refers to a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of an aliphatic or alicyclic, saturated or unsaturated hydrocarbon compound, for example, methyl, ethyl, propyl, butyl, pentyl, hexyl , n-propyl, n-butyl, n-pentyl, isopropyl, isobutyl, sec-butyl, tert-butyl, isopentyl, neopentyl, and the like.
- heteroalkyl is an alkyl containing one or more hetero atoms, and the hetero atom means that a hetero atom is located at one position of any carbon atom of the alkyl, replacing C, CH, CH 2 or CH 3 do.
- alkylene refers to a divalent moiety obtained by removing a hydrogen atom from a carbon atom of an aliphatic or alicyclic, saturated or unsaturated hydrocarbon compound.
- heteroalkylene means an alkylene containing one or more hetero atoms.
- aryl refers to a monovalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound having a ring atom.
- C 5-10 aryl refers to a monovalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound, wherein carbon has 5 to 10 ring atoms.
- Examples of aryl include groups derived from benzene, acenaphthene, fluorene, phenalene, acephenanthrene and aceanthrene.
- heteroaryl is an aryl containing one or more hetero atoms, for example, pyridine, pyrimidine, benzothiophene, furyl, dioxalanyl, pyrrolyl, oxazolyl, pyridyl, pyridazinyl, Pyrimidinyl, isobenzofuran, indole, isoindole, indolizine, indoline, isoindolin, purine, benzodioxane, quinoline, isoquinoline, quinolizine, benzoxazine, benzodiazine, pyridopyridine, quinoc Saline, quinazoline, cinnoline, phthalazine, naphthyridine, pteridine, perimidine, pyridoindole, oxantrene, phenoxatiin, phenazine, phenoxazine, and the like.
- arylene refers to a divalent portion obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound having a ring atom.
- heteroarylene refers to an arylene including one or more hetero atoms.
- alkynyl is an alkyl group having one or more carbon-carbon triple bonds, such as ethynyl and 2-propynyl.
- biotin moiety may be represented by the following general formula A.
- X is a functional group capable of binding to a bioactive substance
- Y is a spacer
- T is a terminal group
- n 1 to 10
- p is an integer of 0 or 1.
- X is a functional group capable of binding to a physiologically active substance.
- the functional group may include a functional group capable of reacting with a thiol group, a carboxyl group and/or an amine group, such as maleimide, succinimide, N-hydroxysuccinimide, aldehyde or carboxyl group. .
- the structure when the functional group X is combined with a physiologically active substance, the structure may be maintained, dropped, or modified.
- the Y may be a spacer and may have a structure having cleavability in the body.
- Y corresponds to a direct bond, or substituted or unsubstituted alkylene, -O-, -C(O)NR-, -C(O)O-, or -C(O) -, -NR-, -NOR-, etc. may be included.
- Y corresponds to a direct bond, or in the structure of Y, substituted or unsubstituted C 1-50 linear alkylene, substituted or unsubstituted C 1-50 nonlinear alkylene, substituted or unsubstituted C 1-50 Linear heteroalkylene, substituted or unsubstituted C 1-50 nonlinear heteroalkylene, substituted or unsubstituted C 1-50 arylene, substituted or unsubstituted C 1-50 heteroarylene, -O-, -C (O), -C(O)NR-, -C(O)O-, -S-, -NR- or -NOR-, wherein R is hydrogen, substituted Or unsubstituted C 1-50 alkyl, substituted or unsubstituted C 1-50 aryl, or ethylene glycol repeating unit (-(CH 2 CH 2 O) n -, n is an integer of 1 or more and 20 or less). .
- Z is a binding unit capable of binding to B, and is not limited thereto, but may include, for example, an amino acid, polypeptide, alkylene, amine, or polyamidoamine structure.
- the amino acid is lysine, 5-hydroxylysine, 4-oxallysine, 4-thialysine, 4-selenaisine, 4-thiahomolisine, 5,5-dimethyllysine, 5 ,5-difluorolysine, trans-4-dehydrolysine, 2,6-diamino-4-hexynoic acid, cis-4-dehydrolysine, 6-N-methyllysine, diminopimelic acid, ornithine, 3-methylornithine, ⁇ -methylornithine, citrulline, homocitrulline, arginine, aspartate, asparagine, glutamate, glutamine, histidine, ornithine, proline, Serine, or threonine.
- B or T may be directly bonded to Y (spacer).
- the T is not limited thereto as a terminal group, but may be, for example, hydrogen or NH 2 .
- B When p is 0, B may be a terminal.
- m may be an integer of 1 to 10, and specifically, may be an integer of 1 to 8, 1 to 5, and 1 to 4.
- X is maleimide, succinimide, N-hydroxysuccinimide, succinimidyl succinate, succinimidyl glutarate, succinimidyl methyl ester, succinimidyl pentyl ester, Succinimidyl carbonate, p-nitrophenyl carbonate, aldehyde, amine, thiol, oxyamine, iodoacetamide, aminoxyl, hydrazide, hydroxy, propionate, pyridyl, alkyl halide, vinylsulfone, carboxyl, Hydrazide, halogen acetamide, C 2-5 alkynyl, C 6-20 aryldisulfide, C 5-20 heteroaryldisulfide, isocyanate, thioester, iminoester, and derivatives thereof. .
- X is maleimide, N-hydroxysuccinimide, aldehyde or amine.
- Y is a substituted linear or branched C 1-50 heteroalkylene and includes at least one -C(O)-.
- Y is -(C(O)) q -(CH 2 ) r -(C(O)NH) s -(CH 2 ) r -(OCH 2 CH 2 ) t -(C( O)) q -, wherein q, r, s, t are independently selected, q, s are 0 or 1, r is an integer from 1 to 20, and t is an integer from 0 to 20.
- Y is -(CH 2 ) r C(O)NHNH-, where r is an integer from 1 to 20.
- Y comprises -C(O)-.
- Y comprises -C(O)NH-.
- Z is any one of the following and each may be independently selected.
- Z is connected through B and -NH-.
- Z is a hydrophilic amino acid or a derivative thereof.
- Z may be selected from the group consisting of lysine, arginine, histidine, glutamine, asparagine, threonine, cysteine, serine, and derivatives thereof.
- Z comprises at least one glycerol, at least one polyethylene glycol, or a bond thereof.
- Z is Including, Represents a bonding site, and at least one of the bonding sites One or more is combined, wherein u is an integer from 1 to 20.
- Z is Including, -(CH 2 ) 3 NH- is further bonded to.
- T is an amine, C 1-8 alkyl, C 1-8 alkenyl, halo, hydroxy, thiol, sulfonic acid, carboxyl, phenyl, benzyl, aldehyde, azide, cyanate, It may be selected from the group consisting of isocyanate, thiocyanate, isothiocyanate, nitrile and phosphonic acid.
- T is an amine
- biotin moiety is N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl-N-(2-aminoethyl)-2-aminoethyl
- a biotin moiety and a bioactive substance may be formed by various bonds.
- the functional group of the biotin moiety and the functional group of the physiologically active substance may be combined to form, but are not limited thereto, but may be formed by, for example, a thiol-ether bond or an amide bond.
- the combination of the biotin moiety and the bioactive material may be combined in the same manner as in Scheme 1 below.
- Scheme 1 Represents a physiologically active substance containing a thiol group, and represents a reaction between a biotin moiety containing maleimide according to an embodiment of the present invention and a thiol group (-SH) of a cysteine residue present in the physiologically active substance.
- the binding of the biotin moiety and the bioactive substance may be combined in the same manner as in Scheme 2 below.
- Scheme 2 below Represents a bioactive substance containing an amine group, and represents a reaction between a biotin moiety containing N-hydroxysuccinimide according to an embodiment of the present invention and an amine group (-NH 2 ) present in the bioactive substance. .
- the bioactive substance may not be particularly limited.
- the physiologically active substance means a polymer substance that can be administered into the body for a specific purpose.
- the bioactive substance may be a substance used in a pharmaceutical composition.
- a pharmaceutical composition may be a substance used for preventing or treating diabetes, preventing or treating obesity, preventing or treating osteoporosis, preventing or treating fatty liver disease, preventing or treating irritable bowel syndrome, preventing or treating neurodegenerative diseases. .
- the bioactive substance is not limited thereto, but may be, for example, a polypeptide or a non-peptidic polymer. Although not limited thereto, for example, it may be a polypeptide, a protein, a polysaccharide, or a derivative thereof.
- the physiologically active substance is glucagon, GLP-1 (Glucagon-like peptide-1), GLP-2 (Glucagon-like peptide-2), GIP (glucose-dependent insulinotropic polypeptide).
- exendin-4 insulin, parathyroid hormone, interferon, erythropoietin, calcitonin, serotonin, rituximab, trastzumab, uricase, tissue plasminogen activator, thymoglobin, vaccine, heparin Or heparin analogs, antithrombin III, pilgrastim, pramlintide acetate, exenatide, eptifibatide, antivenin, IgG, IgM, HGH, thyroxine, coagulation factor VII, and VIII, monoclonal antibodies, glycolipids acting as therapeutic agents, and derivatives thereof.
- the biotin moiety may be bound to an inactive site of a bioactive substance.
- the biotin moiety may not inhibit the biological activity of the biologically active material by binding to the inactive site of the biologically active material, and thus may have the same biological activity as the biologically active material or improved biological activity.
- the bioactive substance may contain a -SH group exposed to an inactive site, and thus a biotin moiety may be bound to the -SH group.
- the physiologically active substance may contain a -NH 3 + group or -NH 2 group exposed to an inactive site, so that a biotin moiety may be bonded to the exposed -NH 3 + group or -NH 2 group.
- the physiologically active substance includes an N-terminus exposed to an inactive site, and a biotin moiety may be bound to the exposed N-terminus.
- the physiologically active substance may not inhibit the activity of the polypeptide by binding to the N-terminus when the -NH 3 + group, the -NH 2 group of the inactive site lysine amino acid or the N-terminus of the polypeptide is an inactive site.
- the biotin moiety may be bound by avoiding a position exhibiting activity by controlling a position of binding to a physiologically active substance.
- the physiologically active substance may be a polypeptide having an amino acid sequence of any one of SEQ ID NOs: 1 to 7 or a derivative thereof.
- SEQ ID NO: 2 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
- SEQ ID NO: 3 HADGSFSDEMNTILDNLAARDFINWLIQTKITD
- SEQ ID NO: 4 YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
- SEQ ID NO: 6 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
- SEQ ID NO: 7 HSQGTFTSDYSKYLDSRRAQDFVQWLMN
- the physiologically active substance may be a protein having an amino acid sequence of SEQ ID NO: 15 and 16 or a protein having an amino acid sequence of SEQ ID NO: 17 and 16, wherein the protein is the 6th and 11th cysteine of SEQ ID NO: 15 or 17 , The 7th cysteine of SEQ ID NO: 15 or 17 and the 7th cysteine of SEQ ID NO: 16, and the 20th and 19th cysteines of SEQ ID NO: 15 or 17 are bonded to each other by a disulfide bond.
- SEQ ID NO: 16 FVNQHLCGSHLVEALYLVCGERGFFYTPKT
- cysteine may be substituted or inserted into the polypeptide in order to control the binding site to the biotin moiety.
- any one or more of the amino acids at the inactive site of the polypeptide selected from the group consisting of amino acid sequences represented by SEQ ID NOs: 1 to 7 may be substituted or inserted with a cysteine amino acid.
- a biotin moiety is bound to the -SH group of the cysteine amino acid.
- the cysteine amino acid-inserted polypeptide may be a polypeptide having an amino acid sequence of any one of SEQ ID NOs: 8 to 14 below.
- SEQ ID NO: 8 H(Aib)QGTFTSDYSKYLDEQAAKEFVQWLMNTC
- SEQ ID NO: 9 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRC
- SEQ ID NO: 10 HADGSFSDEMNTILDNLAARDFINWLIQTKITDC
- SEQ ID NO: 12 HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSC
- SEQ ID NO: 13 SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFC
- SEQ ID NO: 14 HSQGTFTSDYSKYLDSRRAQDFVQWLMNTC
- the bioactive substance having a biotin moiety is a peptide and a non-peptidic polymer, fatty acid, cholesterol, antibody, antibody fragment, albumin and fragment thereof, nucleotide, fibronectin, transferrin, FcRn. It may be covalently bonded with any one or more selected from the group consisting of binding substances, saccharides, elastin, heparin, and derivatives thereof, or to form microspheres.
- the non-peptidic polymer is polyethylene glycol (PEG), polypropylene glycol, a copolymer of ethylene glycol and propylene glycol, polyoxyethylated polyol, polyvinyl alcohol (PVA), polysaccharide, dextran, polyvinylethyl ether, PLA (polylactic acid), PLGA (polylactic-glycolic acid), lipid polymers, chitin, hyaluronic acid, and may be selected from the group consisting of a combination thereof.
- PEG polyethylene glycol
- PVA polyvinyl alcohol
- PLA polylactic acid
- PLGA polylactic-glycolic acid
- lipid polymers chitin, hyaluronic acid
- Another aspect of the present invention is to obtain a biotin moiety; Reacting the biotin moiety with a bioactive substance; And separating the physiologically active substance bound to the biotin moiety after completion of the reaction.
- the biotin moiety in the step of obtaining the biotin moiety, may be represented by the general formula A.
- the reaction molar ratio of the biotin moiety to the bioactive substance may be 0.5 or more.
- the reaction molar ratio of the biotin moiety to the physiologically active substance may be 0.5 to 5.
- the appropriate molar ratio of the reaction may be selected in consideration of the molecular structure, molecular weight, solubility of the biotin moiety, the pH of the reaction solution, the reaction temperature, and the reaction time.
- the reaction may be carried out using a buffer solution or an organic solvent.
- the buffer solution or organic solvent is not particularly limited, and a buffer solution commonly used in the art may be appropriately selected according to the structure of the biotin moiety.
- the temperature and time of the reaction step may be appropriately adjusted according to the characteristics of the biotin moiety and bioactive substance used. Although not limited thereto, for example, it may be performed at 4° C. for 3 hours or longer, or at room temperature for a shorter time. This can be related to the degree of reactivity of the biotin moiety used.
- the reaction can be stopped by lowering the pH of the reaction solution.
- the step of removing unreacted material may be performed after the reaction step.
- the method of removing the unreacted material may be performed by a method commonly used in the art. Although not limited thereto, for example, it may be removed by dialysis or the like using a suitable buffer solution, for example, a solution such as phosphate buffered saline (PBS).
- PBS phosphate buffered saline
- a purification step may be included after the separation step.
- the separation and purification steps may be performed using size exclusion chromatography, reverse phase high performance liquid chromatography, ion exchange chromatography, or the like, but is not limited thereto.
- Another aspect of the present invention is to provide a composition for oral administration comprising a physiologically active substance bound to the biotin moiety described above.
- bioactive substance combined with the biotin moiety can be absorbed through active transport through a sodium-dependent multivitamin transporter by being combined with biotin, which is a type of water-soluble vitamin B7. Absorption can be promoted.
- Another aspect of the present invention is to provide a pharmaceutical composition comprising a bioactive substance bound to the biotin moiety described above.
- the use of the pharmaceutical composition may be determined according to the type of bioactive substance.
- the pharmaceutical composition may be a composition for oral administration.
- a pharmaceutical composition for preventing or treating diabetes comprising a bioactive substance bound to a biotin moiety.
- the physiologically active substance may be used for prevention or treatment of diabetes.
- the physiologically active substance is a polypeptide having an amino acid sequence of SEQ ID NOs: 1 to 14, a protein having an amino acid sequence of SEQ ID NOs: 15 and 16, a protein having an amino acid sequence of SEQ ID NOs: 17 and 16, Or it may be a derivative thereof.
- the protein is the 6th and 11th cysteine of SEQ ID NO: 15 or 17, the 7th and 7th cysteine of SEQ ID NO: 15 or 17, and the 20th and 19th of SEQ ID NO: 15 or 17 Is bonded by a disulfide bond between the th cysteine.
- a pharmaceutical composition for preventing or treating obesity comprising a bioactive substance bound to a biotin moiety.
- the physiologically active substance may be used for the prevention or treatment of obesity.
- the physiologically active substance is a polypeptide having an amino acid sequence of SEQ ID NOs: 1 to 14, a protein having an amino acid sequence of SEQ ID NOs: 15 and 16, a protein having an amino acid sequence of SEQ ID NOs: 17 and 16, Or it may be a derivative thereof.
- the protein is the 6th and 11th cysteine of SEQ ID NO: 15 or 17, the 7th and 7th cysteine of SEQ ID NO: 15 or 17, and the 20th and 19th of SEQ ID NO: 15 or 17 Is bonded by a disulfide bond between the th cysteine.
- a pharmaceutical composition for preventing or treating fatty liver disease comprising a bioactive substance bound to a biotin moiety.
- the physiologically active substance may be used for the prevention or treatment of fatty liver disease.
- the physiologically active substance is a polypeptide having an amino acid sequence of SEQ ID NOs: 1 to 14, a protein having an amino acid sequence of SEQ ID NOs: 15 and 16, a protein having an amino acid sequence of SEQ ID NOs: 17 and 16, Or it may be a derivative thereof.
- the protein is the 6th and 11th cysteine of SEQ ID NO: 15 or 17, the 7th and 7th cysteine of SEQ ID NO: 15 or 17, and the 20th and 19th of SEQ ID NO: 15 or 17 Is bonded by a disulfide bond between the th cysteine.
- a pharmaceutical composition for preventing or treating irritable bowel syndrome comprising a bioactive substance combined with a biotin moiety.
- the physiologically active substance may be one used for preventing or treating irritable bowel syndrome.
- the physiologically active substance is a polypeptide having an amino acid sequence of SEQ ID NOs: 1 to 14, a protein having an amino acid sequence of SEQ ID NOs: 15 and 16, or a protein having an amino acid sequence of SEQ ID NOs: 17 and 16, or It may be a derivative.
- the protein is the 6th and 11th cysteine of SEQ ID NO: 15 or 17, the 7th and 7th cysteine of SEQ ID NO: 15 or 17, and the 20th and 19th of SEQ ID NO: 15 or 17 Is bonded by a disulfide bond between the th cysteine.
- a pharmaceutical composition for preventing or treating neurodegenerative diseases comprising a bioactive substance bound to a biotin moiety.
- the physiologically active substance may be one used for preventing or treating neurodegenerative diseases.
- the physiologically active substance is a polypeptide having an amino acid sequence of SEQ ID NOs: 1 to 14, a protein having an amino acid sequence of SEQ ID NOs: 15 and 16, or a protein having an amino acid sequence of SEQ ID NOs: 17 and 16, or It may be a derivative.
- the protein is the 6th and 11th cysteine of SEQ ID NO: 15 or 17, the 7th and 7th cysteine of SEQ ID NO: 15 or 17, and the 20th and 19th of SEQ ID NO: 15 or 17 Is bonded by a disulfide bond between the th cysteine.
- the pharmaceutical composition containing the bioactive substance bound to the biotin moiety as an active ingredient may be formulated and administered in various oral or parenteral dosage forms, but is not limited thereto.
- diluents or excipients such as commonly used fillers, dissolution aids, extenders, binders, wetting agents, disintegrants, and surfactants can be used to prepare them.
- Solid preparations for oral administration include tablets, pills, powders, granules, capsules, and the like, and these solid preparations contain at least one excipient in the compound, such as starch, calcium carbonate, sucrose, or It can be prepared by mixing lactose and gelatin.
- Liquid preparations for oral use include suspensions, liquid solutions, emulsions, syrups, and the like.In addition to water and liquid paraffin, which are commonly used simple diluents, various excipients such as wetting agents, sweetening agents, fragrances, and preservatives may be included. Preparations for parenteral administration include sterilized aqueous solutions, non-aqueous solutions, suspensions, emulsions, lyophilized preparations, and suppositories. As the non-aqueous solvent and the suspension solvent, propylene glycol, polyethylene glycol (PEG), vegetable oil such as olive oil, and injectable ester such as ethyl oleate may be used.
- PEG polyethylene glycol
- injectable ester such as ethyl oleate
- calcium or vitamin D3 may be added to enhance efficacy as a therapeutic agent for proliferative diseases or autoimmune diseases.
- the dosage of the pharmaceutical composition according to an embodiment of the present invention may vary depending on the patient's weight, age, sex, health status, diet, administration time, administration method, excretion rate, and severity of the disease. In general, it can be administered once or several times a day within the range of effective daily dosage. In addition, it may be possible to administer an effective dose by administering several times every 1 to 2 weeks.
- HBTU 3-[Bis(dimethylamino)methyliumyl]-3H-bencotrizol-1-oxide hexafluorophosphate (: 3-[Bis(dimethylamino)methyliumyl]-3H-benzotriazol-1-oxide hexafluorophosphate)
- HATU 1-[bis(dimethylamino)methylene]-1H-1,2,3-triacolo[4,5-b]pyridinium-3 oxide hexafluorophosphate (1-[Bis(dimethylamino)methylene]- 1H-1,2,3-triazolo[4,5-b]pyridinium 3-oxide hexafluorophosphate)
- HOBt 1-hydroxybenzotriazole (1-Hydroxybenzotriazole)
- the solid phase synthesis of the peptide is a di-peptide amide with a group that can be cleaved under acidic conditions, e.g. 2-Fmoc-oxy-4-methoxybenzyl, or 2,4,6-trimethoxybenzyl. It can be improved by the use of a di-peptide protected in binding.
- the Fmoc-protected amino acid derivative used was the recommended standard: for example Fmoc-Ala-OH, Fmoc-Arg(Pbf)-OH, Fmoc-Asn(Trt) from Anaspec, Bachem, Iris Biotech, or Novabiochem.
- the N-terminal amino acid was Boc protected at the alpha amino group.
- Fmoc-8-amino-3,6-dioxaoctanoic acid Fmoc-tranexamic acid, Fmoc-isonifecot acid, Fmoc-Glu-OtBu supplied from Anaspec, Bachem, Iris Biotech, or Novabiochem.
- Fmoc-Lys(Fmoc)-OH was used.
- Peptides can be synthesized using HBTU/DIEA, HATU/DIEA, or DIC/HOBt as a coupling reagent, using general Fmoc chemistry in Linkamide MBHA resin.
- the reactants and coupling reagents used in the synthesis include the following combinations.
- An exemplary protocol for the process of synthesizing a peptide using SPPS includes the following.
- Exemplary protocols of 1) to 5) above may perform repetitive synthesis by using a combination of reactants #1 to #5 and coupling reagents at least once. To remove Fmoc, a 20% piperidine/DMF solution was treated for 30 minutes.
- the crude peptide was dissolved in an appropriate mixture of water, TFA, and ACN, purified using preparative HPLC, and then dried and quantified. Purification conditions using preparative HPLC include those shown in Table 2 below.
- biotin moieties were obtained through the protocol, purification, and analysis of peptide synthesis 1) to 5) using the SPPS.
- Table 4 X, Y, Z and B are included in the definition of general formula A in the present specification.
- Biotin moiety X Y Z B (Biotin) count B6 Aldehyde propane Lysine 2 B7 Maleimide butyrate Glycerol and PEG 2 B8 Maleimide butyrate Glycerol and PEG 2 B9 N-hydroxysuccinimide butyrate Lysine 2 B10 N-hydroxysuccinimide glutarate Glycerol and PEG 2 B11 Maleimide PEG 12 Lysine 3 B12 N-hydroxysuccinimide PEG 12 Lysine 3 B13 amine - Lysine 3 B14 Aldehyde pentane Lysine 2 B15 Maleimide adipate Glycerol and PEG 2 B16 Maleimide suberate Glycerol and PEG 2 B17 Maleimide sebacate Glycerol and PEG 2 B18 N-hydroxysuccinimide adipate Glycerol and PEG 2 B19 N-hydroxysuccinimide suberate Lysine 4 B20 N-hydroxysuccinimide sebacate
- the reaction solvent was DMSO solution to which 0.3% triethylamine (TEA, Sigma) was added, and the polypeptide-biotin moiety shown in Table 5 below was the polypeptide of SEQ ID NO: 12 and the biotin moiety (B1, A mixture was prepared in a molar ratio of 1:2 (polypeptide of SEQ ID NO: 12: B1, B2, or B3) using B2 and B3, respectively. The mixture was allowed to react for at least 30 minutes at room temperature, and the reaction was stopped by adding a 1% trifluoroacetic acid solution equal to the volume of the mixture.
- TAA triethylamine
- the column was a SUPERSIL ODS-1 column (10x250 mm, 5 ⁇ m, LB Science, South Korea), and the mobile phase conditions were 30-50% solvent B (0.1% TFA added acetonitrile) and solvent A (0.1% TFA-added distilled water) was linearly changed while maintaining a flow rate of 4.7 ml/min. Peaks detected between 12 and 14 minutes were collected by monitoring at 280 nm with a UV spectrometer. The collected peaks were concentrated and purified using an ultracentrifugal filter having an appropriate molecular weight cutoff after volatilizing an organic solvent and TFA under vacuum. The purity of the purified material was confirmed through HPLC analysis.
- Example 3 is a purification chromatogram of Example 3.
- the molecular weight was confirmed through MALDI-TOF mass spectrometry.
- a matrix solution a solution in which CHCA ( ⁇ -Cyano-4-hydroxycinnamic acid) was saturated in 50% acetonitrile containing 0.1% TFA was used.
- the mass spectrum was confirmed in linear and positive modes, and the molecular weight was confirmed by setting the concentration of the final material to 0.1 mg/mL.
- Figure 3 is a MALDI-TOF mass spectra of Examples 1 to 3. Referring to FIG. 3, it was confirmed that the molecular weight of the materials separated through MALDI-TOF mass spectrometry was consistent with the theoretical molecular weight.
- polypeptide-biotin moiety was prepared by combining a polypeptide having an amino acid sequence of SEQ ID NOs: 8 and 13 and a biotin moiety, as shown in Table 6 below.
- the reaction rate was determined by comparing the HPLC peak areas of Examples 1 to 3 when the mixture mixed with the biotin moiety was analyzed by HPLC based on the amount of the polypeptide added in the step of obtaining the first mixture.
- the yield of the present invention was determined as the yield by quantifying the amount of the final purified material finally obtained based on the amount of the polypeptide added in the step of obtaining the first mixture. The results are shown in Table 7 below.
- Enzyme-linked immunosorbent test method for changes in blood drug concentration over time by collecting serum after intravenous and oral administration of samples in amounts of 100 and 500 ⁇ g/kg, respectively, to SD rats weighing about 200 g It was measured as. Blood samples were taken from the jugular vein. The result was calculated as an average value, and a polypeptide having the amino acid sequence of SEQ ID NO: 5 was used as a control. As a result of the experiment, it was found that the oral absorption rate was improved about 257 times in Example 1, 270 times in Example 2, and about 557 times in Example 3 compared to the control group.
- the blood glucose control efficacy was measured through an intraperitoneal glucose tolerance test (IPGTT) after oral administration of Examples 1 to 3 of the oral GLP-1 agonist formulation to mice.
- IPGTT intraperitoneal glucose tolerance test
- a sample (10 ug/mouse, based on SEQ ID NO: 1) was orally administered to a 9-week-old male mouse (C57BL/6) at -60 minutes, and then 200 ⁇ l of glucose. (2 g/kg) was injected intraperitoneally, and changes in blood glucose were observed in the blood collected from the tail vein at -60, 0, 20, 40, 60, 90, and 120 minutes.
- a polypeptide having the amino acid sequence of SEQ ID NO: 5 was administered subcutaneously as a control 1, and orally administered as a control 2.
- FIG. 5 is a graph showing changes in blood sugar after administration of glucose to each sample. As shown in Figure 5, it was confirmed that Examples 1 to 3 have glucose control ability.
- the blood glucose control efficacy was measured through an intraperitoneal glucose tolerance test after oral administration of Examples 5 and 6 to mice.
- peritoneal glucose tolerance in an animal model, 100 ⁇ l of a sample (500 ug/kg, based on SEQ ID NO: 2) was orally administered to a 9-week-old male mouse (C57BL/6) at -20 minutes, and then 200 ⁇ l of glucose. (2 g/kg) was injected intraperitoneally, and changes in blood glucose were observed in the blood collected from the tail vein at -20, 0, 20, 40, 60, 90, and 120 minutes.
- FIG. 6 is a graph showing changes in blood sugar after glucose was administered to each sample. As shown in Figure 6, it was confirmed that Examples 5 and 6 have glucose control ability.
- Example 8 and 9 The oral absorption rates of Examples 8 and 9 were measured. After subcutaneous injection and oral administration of a sample in an amount of 20 ⁇ g/kg to SD rats weighing about 200 g, plasma is separated for changes in blood drug concentration and then enzyme-linked immunosorbent test method It was measured as. Blood samples were taken from the jugular vein. The measurement results are shown in Table 8 below. A polypeptide having the amino acid sequence of SEQ ID NO: 6 was used as a control.
- the polypeptide bound to the biotin moiety has a high absorption rate in the intestine.
- a polypeptide to which a biotin moiety is bound was prepared using a biotin moiety B4 described in Table 3 and a polypeptide having the amino acid sequence of SEQ ID NO: 5 shown in Table 9 below.
- the reaction solvent was a DMSO solution to which 0.3% triethylamine (TEA, Sigma) was added, and a mixture was prepared with a molar ratio of a polypeptide having an amino acid sequence of SEQ ID NO: 5 and B4 of Table 3 in a molar ratio of 1:4.
- the mixture was reacted at room temperature for 2 hours, and then stopped by adding a 30% acetoniryl/distilled water solution containing 1% trifluoroacetic acid equal to the volume of the mixture.
- Example 10 The reaction product of Example 10 was separated and purified by reverse phase HPLC.
- the column was a SUPERSIL ODS-1 column (10x250 mm, 5 ⁇ m, LB Science, South Korea), and the mobile phase conditions were 30-50% solvent B (0.1% TFA added acetonitrile) and solvent A (0.1% Distilled water to which TFA was added) was linearly changed while maintaining the flow rate of 4.7 ml/min.
- the peak detected at 12.7 minutes was collected while monitoring at 280 nm with a UV spectrometer.
- the collected peaks were concentrated and purified using an ultracentrifugal filter having an appropriate molecular weight cutoff after volatilizing an organic solvent and TFA under vacuum. The purity of the purified material was confirmed through HPLC analysis.
- Example 9 is a purification chromatogram for Example 10.
- the unreacted polypeptide of SEQ ID NO: 1 was detected at 11.7 minutes, and the material of Example 10 to which the biotin moiety was bound was detected at 12.7 minutes.
- Example 10 is a chromatogram of Example 10 after purification. It was identified as a single peak of the polypeptide bound to the biotin moiety, and no other peaks were observed. When the area of the peak generated from the chromatogram was expressed as a percentage, it was confirmed that the purity was 95% or more.
- the molecular weight of the final material obtained in Example 10 was measured.
- the molecular weight was confirmed through MALDI-TOF mass spectrometry.
- a matrix solution a solution in which CHCA ( ⁇ -Cyano-4-hydroxycinnamic acid) was saturated in 50% acetonitrile containing 0.1% TFA was used. Mass spectra were confirmed in linear and positive modes.
- a polypeptide to which a biotin moiety is bound was prepared using the biotin moiety B5 shown in Table 3 and the polypeptide having the amino acid sequence of SEQ ID NO: 12 shown in Table 10 below.
- the reaction solvent was a DMSO solution to which 0.3% triethylamine (TEA, Sigma) was added, and a mixture was prepared using the polypeptide of SEQ ID NO: 12 and B5 of Table 3 in a molar ratio of 1:2.
- the mixture was reacted at room temperature for 30 minutes and then stopped by adding a 30% acetoniacryl/distilled water solution containing 1% trifluoroacetic acid in the same volume as the volume of the mixture.
- Example 11 The reaction product of Example 11 was separated and purified by reverse phase HPLC.
- the column was a SUPERSIL ODS-1 column (10x250 mm, 5 ⁇ m, LB Science, South Korea), and the mobile phase conditions were 30-50% solvent B (0.1% TFA added acetonitrile) and solvent A (0.1% Distilled water to which TFA was added) was linearly changed while maintaining the flow rate of 4.7 ml/min.
- solvent B (0.1% TFA added acetonitrile
- solvent A 0.1% Distilled water to which TFA was added
- the peaks detected between 11 and 13 minutes were collected while monitoring at 280 nm with a UV spectrometer.
- the collected peaks were concentrated and purified using an ultracentrifugal filter having an appropriate molecular weight cutoff after volatilizing an organic solvent and TFA under vacuum. The purity of the purified material was confirmed through HPLC analysis.
- Gemini C18 column (4.6x250 mm, 5 ⁇ m; Phenomenex, CA, USA) was analyzed in a 50 degree column oven condition. Analysis was carried out using a mobile phase consisting of a trifluoroacetic acid solution: acetonitrile mixture (mixing ratio of 70:30 to 50:50 after 20 minutes), and a flow rate of 1 mL/min was used, and the UV detector was observed at 280 nm. I did.
- Example 11 is a reverse phase chromatogram of Example 11. It was identified as a single peak of the polypeptide bound to the biotin moiety, and no other peaks were observed. When the area of the peak generated from the chromatogram was expressed as a percentage, it was confirmed that the purity was 90% or more.
- the molecular weight of the final material obtained in Example 11 was measured.
- the molecular weight was confirmed through MALDI-TOF mass spectrometry.
- a matrix solution a solution in which CHCA ( ⁇ -Cyano-4-hydroxycinnamic acid) was saturated in 50% acetonitrile containing 0.1% TFA was used. Mass spectra were confirmed in linear and positive modes.
- Example 12 is a MALDI-TOF mass spectrometry spectrum of Example 10 and Example 11. Referring to FIG. 12, it was confirmed that the molecular weight of the materials separated through MALDI-TOF mass spectrometry was consistent with the theoretical molecular weight.
- a polypeptide to which a biotin moiety is bound was prepared using a protein having the biotin moiety B4 shown in Table 3 and the amino acid sequences of SEQ ID NOs: 15 and 16 shown in Table 11 below.
- SEQ ID NO: 15 GIVEQCCTSICSLEQLENYCN (A chain) SEQ ID NO: 16FVNQHLCGSHLVEALYLVCGERGFFYTPKT (B chain) C11 of the C6-A chain of the A chain, C7 of the C7-B chain of the A chain, and C19 of the C20-B chain of the A chain Protein present B4 B chain K29
- SEQ ID NO: 15 GIVEQCCTSICSLEQLENYCN (A chain) SEQ ID NO: 16FVNQHLCGSHLVEALYLVCGERGFFYTPKT (B chain) C11 of the C6-A chain of the A chain, C7 of the C7-B chain of the A chain, and C19 of the C20-B chain of the A chain Protein present B4 F1 of the B chain and K29 of the B chain
- the reaction solvent was a DMSO solution to which 0.3% triethylamine (TEA, Sigma) was added, and a mixture was prepared by using a protein having an amino acid sequence of SEQ ID NOs: 15 and 16 and B4 of Table 3 in a molar ratio of 1:16. .
- the mixture was reacted at room temperature for 2 hours, and then stopped by adding a 30% acetoniryl/distilled water solution containing 1% trifluoroacetic acid equal to the volume of the mixture.
- the column was a SUPERSIL ODS-1 column (10x250 mm, 5 ⁇ m, LB Science, South Korea), and the mobile phase conditions were 30-40% solvent B (0.1% TFA added acetonitrile) and solvent A (0.1% Distilled water to which TFA was added) was linearly changed while maintaining the flow rate of 4.7 ml/min.
- the peak detected at 12.7 minutes was collected while monitoring at 280 nm with a UV spectrometer.
- the collected peaks were concentrated and purified using an ultracentrifugal filter having an appropriate molecular weight cutoff after volatilizing an organic solvent and TFA under vacuum. The purity of the purified material was confirmed through HPLC analysis.
- Example 13 is a purification chromatogram for Examples 12 and 13.
- the unreacted polypeptide of SEQ ID NO: 7 was detected at 12.1 minutes, the material of Example 12 to which the biotin moiety was bound was detected at 12.3 minutes, and the material of Example 13 was detected at 12.5 minutes.
- Example 14 is a chromatogram of Example 12 after purification. It was identified as a single peak of the polypeptide bound to the biotin moiety, and no other peaks were observed. When the area of the peak generated from the chromatogram was expressed as a percentage, it was confirmed that the purity was 95% or more.
- Example 15 is a chromatogram of Example 13 after purification. It was identified as a single peak of the polypeptide bound to the biotin moiety, and no other peaks were observed. When the area of the peak generated from the chromatogram was expressed as a percentage, it was confirmed that the purity was 95% or more.
- the molecular weight was confirmed through MALDI-TOF mass spectrometry.
- a matrix solution a solution in which CHCA ( ⁇ -Cyano-4-hydroxycinnamic acid) was saturated in 50% acetonitrile containing 0.1% TFA was used. Mass spectra were confirmed in linear and positive modes.
- the blood glucose control efficacy was measured through an intraperitoneal glucose tolerance test after oral administration of Examples 10 and 11 of the oral GLP-1 agonist formulation to mice.
- FIG. 7 is a graph showing changes in blood sugar after administration of glucose to each sample. As shown in FIG. 7, it was confirmed that Examples 10 to 11 have glucose control ability.
- the biological activity of the polypeptide before and after binding of the biotin moiety was compared.
- biological activity according to the binding site of the biotin moiety was compared.
- PathHunter U2OS INSRb Bioassay cells were aliquoted into a 96-well plate and cultured for 24 hours in AssayCompleteTM Cell Plating Reagent 5 (CP5). Then, each of the drugs was added at a concentration of 300, 60, 20, 6.67, 2.22, 0.74, 0.25, 0.05, and 0.01 by 20 ⁇ l per well. After 3 hours of incubation time, 10 ⁇ l of detection reagent 1 was added to react for 15 minutes, and 40 ⁇ l of detection reagent 2 was added to react for 60 minutes. Then, luminescence was measured with a 96-well microplate reader.
- a protein consisting of the A chain consisting of the amino acid sequence of SEQ ID NO: 15 and the B chain consisting of the amino acid sequence of SEQ ID NO: 16 was used as a control.
- a disulfide bond exists between C11 of the C6-A chain of the A chain, C7 of the C7-B chain of the A chain, and C19 of the C20-B chain of the A chain.
- glucose control efficacy was measured through an intraperitoneal glucose tolerance test after oral administration of Examples 12 and 13 of the oral protein formulation to mice.
- FIG. 8 is a graph showing changes in blood glucose after glucose is administered to each sample. As shown in Figure 8, it was confirmed that Examples 12 to 13 have glucose control ability.
- the present invention is a biotin moiety combined with a biotin moiety having an excellent oral absorption rate in the body and a composition for oral administration comprising the same.
- the biotin moiety is mixed with the physiologically active material. It is possible to prepare a bioactive substance combined with.
- the present invention has the advantage that bioactive substances can be prevented from being decomposed due to the binding of biotin moieties, and ultimately, bioactive substances can penetrate the intestinal membrane to promote absorption in the intestine.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicinal Chemistry (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical & Material Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Diabetes (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Endocrinology (AREA)
- Organic Chemistry (AREA)
- Emergency Medicine (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Molecular Biology (AREA)
- Physiology (AREA)
- Nutrition Science (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Heterocyclic Carbon Compounds Containing A Hetero Ring Having Oxygen Or Sulfur (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP20814628.2A EP3978027A4 (en) | 2019-05-31 | 2020-05-29 | PHYSIOLOGICALLY ACTIVE SUBSTANCE LINKED TO A BIOTIN FRACTION, AND COMPOSITION FOR ORAL ADMINISTRATION COMPRISING IT |
| JP2021568005A JP7655860B2 (ja) | 2019-05-31 | 2020-05-29 | ビオチン部分に結合した生理活性物質、及びその生理活性物質を含む経口投与用組成物 |
| US17/615,504 US20230000834A1 (en) | 2019-05-31 | 2020-05-29 | Physiologically active substance bound to biotin moiety, and composition for oral administration including same |
| CN202080039061.2A CN113924124A (zh) | 2019-05-31 | 2020-05-29 | 与生物素部分结合的生理活性物质和包含所述生理活性物质的用于口服施用的组合物 |
| CA3142322A CA3142322A1 (en) | 2019-05-31 | 2020-05-29 | Physiologically active substance bound to biotin moiety, and composition for oral administration including the same |
| JP2025020196A JP2025065438A (ja) | 2019-05-31 | 2025-02-10 | ビオチン部分に結合した生理活性物質、及びその生理活性物質を含む経口投与用組成物 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR20190064370 | 2019-05-31 | ||
| KR10-2019-0064370 | 2019-05-31 | ||
| KR1020200065484A KR102480393B1 (ko) | 2019-05-31 | 2020-05-29 | 비오틴 모이어티와 결합된 생리활성 물질 및 이를 포함하는 경구 투여용 조성물 |
| KR10-2020-0065484 | 2020-05-29 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020242268A1 true WO2020242268A1 (ko) | 2020-12-03 |
Family
ID=73551925
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/KR2020/007053 Ceased WO2020242268A1 (ko) | 2019-05-31 | 2020-05-29 | 비오틴 모이어티와 결합된 생리활성 물질 및 이를 포함하는 경구 투여용 조성물 |
Country Status (4)
| Country | Link |
|---|---|
| US (1) | US20230000834A1 (https=) |
| JP (2) | JP7655860B2 (https=) |
| CA (1) | CA3142322A1 (https=) |
| WO (1) | WO2020242268A1 (https=) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023093758A1 (zh) * | 2021-11-24 | 2023-06-01 | 成都奥达生物科技有限公司 | 一种长效胰岛素类似物 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20060228325A1 (en) * | 1996-02-08 | 2006-10-12 | Wilbur D S | Water soluble multi-biotin-containing compounds |
| KR100864584B1 (ko) * | 2008-02-25 | 2008-10-24 | 성균관대학교산학협력단 | 비오틴으로 수식된 엑센딘 유도체, 이의 제조방법 및 이의용도 |
| KR20160110762A (ko) * | 2015-03-12 | 2016-09-22 | 주식회사 레모넥스 | 생리활성물질 전달을 위한 탄소나노입자-고분자 복합체의 합성과 이의 용도 |
| CN109485655A (zh) * | 2018-12-20 | 2019-03-19 | 河北百灵威超精细材料有限公司 | 一种生物素马来酰亚胺的制备方法 |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100111856A1 (en) * | 2004-09-23 | 2010-05-06 | Herman Gill | Zirconium-radiolabeled, cysteine engineered antibody conjugates |
| EP2751291B1 (en) * | 2011-09-01 | 2018-08-15 | University of Southern California | Methods for preparing high throughput peptidomimetics, orally bioavailable drugs and compositions containing same |
| US9648458B2 (en) * | 2013-07-03 | 2017-05-09 | Qualcomm Incorporated | Systems and methods for labeling crowd sourced data |
-
2020
- 2020-05-29 WO PCT/KR2020/007053 patent/WO2020242268A1/ko not_active Ceased
- 2020-05-29 JP JP2021568005A patent/JP7655860B2/ja active Active
- 2020-05-29 CA CA3142322A patent/CA3142322A1/en active Pending
- 2020-05-29 US US17/615,504 patent/US20230000834A1/en active Pending
-
2025
- 2025-02-10 JP JP2025020196A patent/JP2025065438A/ja active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20060228325A1 (en) * | 1996-02-08 | 2006-10-12 | Wilbur D S | Water soluble multi-biotin-containing compounds |
| KR100864584B1 (ko) * | 2008-02-25 | 2008-10-24 | 성균관대학교산학협력단 | 비오틴으로 수식된 엑센딘 유도체, 이의 제조방법 및 이의용도 |
| KR20160110762A (ko) * | 2015-03-12 | 2016-09-22 | 주식회사 레모넥스 | 생리활성물질 전달을 위한 탄소나노입자-고분자 복합체의 합성과 이의 용도 |
| CN109485655A (zh) * | 2018-12-20 | 2019-03-19 | 河北百灵威超精细材料有限公司 | 一种生物素马来酰亚胺的制备方法 |
Non-Patent Citations (1)
| Title |
|---|
| SINGH, S. ET AL.: "Self-Assembly of a Functional Triple Protein: Hemoglobin-Avklin-Hemoglobin via Biotin-Avidin Interactions", BIOCHEMISTRY, vol. 55, 2016, pages 2875 - 2882, XP055438679, DOI: 10.1021/acs.biochem.6b00215 * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023093758A1 (zh) * | 2021-11-24 | 2023-06-01 | 成都奥达生物科技有限公司 | 一种长效胰岛素类似物 |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2022535685A (ja) | 2022-08-10 |
| JP7655860B2 (ja) | 2025-04-02 |
| CA3142322A1 (en) | 2020-12-03 |
| US20230000834A1 (en) | 2023-01-05 |
| JP2025065438A (ja) | 2025-04-17 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2017116205A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체의 지속형 결합체 | |
| WO2012173422A9 (en) | A conjugate comprising oxyntomodulin and an immunoglobulin fragment, and use thereof | |
| WO2017052321A1 (ko) | 다수의 생리활성 폴리펩타이드 및 면역글로불린 Fc 영역을 포함하는, 단백질 결합체 | |
| WO2015152618A1 (ko) | 면역글로불린 fc 단편 결합을 이용한 단백질 및 펩타이드의 용해도를 개선시키는 방법 | |
| WO2021066600A1 (ko) | 글루카곤, 및 glp-1 수용체 및 gip 수용체 이중 작용제를 포함하는 조성물 및 이의 치료학적 용도 | |
| WO2020130749A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 및 인슐린을 포함하는 약학 조성물 | |
| WO2018147641A1 (ko) | 비펩티드성 중합체 링커 화합물, 그 링커 화합물을 포함하는 결합체, 및 이들의 제조방법 | |
| WO2019066586A1 (ko) | 글루카곤 유사 펩타이드-2(glp-2) 유도체의 지속형 결합체 | |
| WO2022211537A1 (ko) | 신규한 면역 활성 인터루킨 2 아날로그 결합체 및 이의 제조 방법 | |
| WO2022139538A1 (ko) | 신규한 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중활성체 및 이의 용도 | |
| US20080146500A1 (en) | Selective Vpac2 Receptor Peptide Agonists | |
| WO2022035302A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체를 포함하는 혈압 강하용 약학 조성물 | |
| WO2021235913A1 (ko) | Glp-2의 지속형 결합체의 액상 제제 | |
| WO2020242268A1 (ko) | 비오틴 모이어티와 결합된 생리활성 물질 및 이를 포함하는 경구 투여용 조성물 | |
| WO2021010532A1 (ko) | 신규 중간체 제조를 통한 지속형 약물 결합체의 제조 방법 | |
| WO2020214013A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체의 고지혈증에 대한 치료적 용도 | |
| WO2021235907A1 (ko) | 글루카곤 유도체의 지속형 결합체의 액상 제제 | |
| WO2022035271A1 (ko) | 삼중 활성체 지속형 결합체를 유효성분으로 포함하는 약학 조성물 | |
| WO2022015082A1 (ko) | 글루카곤 유도체 또는 이의 결합체의 간질환에 대한 치료적 용도 | |
| WO2021215801A1 (ko) | 글루카곤, glp-1 및 gip 수용체 모두에 활성을 갖는 삼중 활성체 또는 이의 결합체를 포함하는 고지혈증 예방 또는 치료용 약학적 조성물 및 예방 또는 치료 방법 | |
| WO2021221482A1 (ko) | 신규한 단백질 결합체, 및 이의 비알콜성 지방간염, 비만 및 당뇨 질환의 예방 또는 치료 용도 | |
| WO2024136573A1 (ko) | 신규한 glp-1, gip, 및 글루카곤 수용체 모두에 활성을 갖는 삼중 활성체 및 이를 포함하는 비만의 예방 또는 치료용 약학적 조성물 | |
| WO2021107519A1 (en) | Biotin moiety-conjugated polypeptide and pharmaceutical composition for oral administration comprising the same | |
| EP1756156B1 (en) | Selective vpac2 receptor peptide agonists | |
| WO2019172605A1 (ko) | 선택적으로 기능화된 타이로신을 가지는 생체 물질의 제조방법, 선택적으로 기능화된 타이로신을 가지는 생체 물질 및 이를 유효성분으로 함유하는 약학적 조성물 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 20814628 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2021568005 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3142322 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2020814628 Country of ref document: EP Effective date: 20220103 |