WO2020079448A1 - Novel cancer antigens and methods - Google Patents

Novel cancer antigens and methods Download PDF

Info

Publication number
WO2020079448A1
WO2020079448A1 PCT/GB2019/052980 GB2019052980W WO2020079448A1 WO 2020079448 A1 WO2020079448 A1 WO 2020079448A1 GB 2019052980 W GB2019052980 W GB 2019052980W WO 2020079448 A1 WO2020079448 A1 WO 2020079448A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
polypeptide
cancer
sequence
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/GB2019/052980
Other languages
English (en)
French (fr)
Other versions
WO2020079448A9 (en
Inventor
George KASSIOTIS
George Young
Jan ATTIG
Bram SNIJDERS
David Perkins
Fabio MARINO
Nicola TERNETTE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Francis Crick Institute Ltd
Enara Bio Ltd
Original Assignee
Francis Crick Institute Ltd
Ervaxx Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2019360427A priority Critical patent/AU2019360427A1/en
Priority to EP19790765.2A priority patent/EP3866827A1/en
Priority to BR112021006941-0A priority patent/BR112021006941A2/pt
Priority to CA3112427A priority patent/CA3112427A1/en
Priority to CN201980068630.3A priority patent/CN112867501B/zh
Priority to EA202191081A priority patent/EA202191081A1/ru
Priority to JP2021546487A priority patent/JP7712207B2/ja
Priority to KR1020217010920A priority patent/KR20210080372A/ko
Priority to MX2021004453A priority patent/MX2021004453A/es
Priority to CN202411985215.3A priority patent/CN119978090A/zh
Application filed by Francis Crick Institute Ltd, Ervaxx Ltd filed Critical Francis Crick Institute Ltd
Publication of WO2020079448A1 publication Critical patent/WO2020079448A1/en
Publication of WO2020079448A9 publication Critical patent/WO2020079448A9/en
Priority to IL282308A priority patent/IL282308A/en
Priority to US17/232,597 priority patent/US12263216B2/en
Anticipated expiration legal-status Critical
Priority to JP2022173369A priority patent/JP7762132B2/ja
Priority to JP2024212437A priority patent/JP2025041678A/ja
Priority to US19/062,913 priority patent/US20250360206A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • C07K14/4701Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
    • C07K14/4748Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/34Antigenic peptides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4271Melanoma antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4271Melanoma antigens
    • A61K40/4272Melan-A/MART
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0639Dendritic cells, e.g. Langherhans cells in the epidermis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55505Inorganic adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55522Cytokines; Lymphokines; Interferons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55522Cytokines; Lymphokines; Interferons
    • A61K2039/55527Interleukins
    • A61K2039/55538IL-12
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55561CpG containing adjuvants; Oligonucleotide containing adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55572Lipopolysaccharides; Lipid A; Monophosphoryl lipid A
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55577Saponins; Quil A; QS21; ISCOMS
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/876Skin, melanoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2121/00Preparations for use in therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/57Skin; melanoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells

Definitions

  • the present invention relates to antigenic polypeptides and corresponding polynucleotides for use in the treatment or prevention of cancer, in particular for use in treating or preventing melanoma (e.g. cutaneous melanoma or uveal melanoma).
  • the present invention further relates inter alia to pharmaceutical and immunogenic compositions comprising said nucleic acids and polypeptides, immune cells loaded with and/or stimulated by said polypeptides and polynucleotides, antibodies specific for said polypeptides and cells (autologous or otherwise) genetically engineered with molecules that recognize said polypeptides.
  • MHC Major Histocompatibility Complex
  • This expanded T-cell population can produce effector CD8+ T-cells (including cytotoxic T-lymphocytes - CTLs) that can eliminate the foreign antigen- tagged cells, as well as memory CD8+ T-cells that can be re-amplified when the foreign antigen-tagged cells appear later in the animal’s life.
  • effector CD8+ T-cells including cytotoxic T-lymphocytes - CTLs
  • memory CD8+ T-cells that can be re-amplified when the foreign antigen-tagged cells appear later in the animal’s life.
  • MHC Class II molecules whose expression is normally limited to professional antigen-presenting cells (APCs) such as dendritic cells (DCs), are usually loaded with peptides which have been internalised from the exogenous environment.
  • APCs professional antigen-presenting cells
  • DCs dendritic cells
  • Binding of a complementary TCR from a naive CD4+ T-cell to the MHC ll-peptide complex induces the maturation of CD4+ T-cells into effector cells (e.g., TH1 , TH2, TH17, T FH, T reg cells).
  • effector CD4+T-cells can promote B-cell differentiation to antibody-secreting plasma cells as well as facilitate the differentiation of antigen-specific CD8+ CTLs, thereby helping induce the adaptive immune response to foreign antigens, that include both short-term effector functions and longer-term immunological memory.
  • DCs can perform the process of cross-presentation of peptide antigens by delivering exogenously-derived antigens (such as a peptide or protein released from a pathogen or a tumor cell) onto their MHC I molecules, contributing to the generation of immunological memory by providing an alternative pathway to stimulating the expansion of naive CD8+ T-cells.
  • exogenously-derived antigens such as a peptide or protein released from a pathogen or a tumor cell
  • Immunological memory (specifically antigen-specific B cells/antibodies and antigen-specific CTLs) are critical players in controlling microbial infections, and immunological memory has been exploited to develop numerous vaccines that prevent the diseases caused by important pathogenic microbes. Immunological memory is also known to play a key role in controlling tumor formation, but very few efficacious cancer vaccines have been developed.
  • Cancer is the second leading cause of morbidity, accounting for nearly 1 in 6 of all deaths globally. Of the 8.8 million deaths caused by cancer in 2015, the cancers which claimed the most lives were from lung (1.69 million), liver (788,000), colorectal (774,000), stomach (754,000) and breast (571 ,000) carcinomas. The economic impact of cancer in 2010 was estimated to be USD1.16 Trillion, and the number of new cases is expected to rise by approximately 70% over the next two decades (World Health Organisation Cancer Facts 2017).
  • HERVs Human endogenous retroviruses
  • LTRs Long Terminal Repeats
  • MaLRs Mammalian apparent LTR Retrotransposons
  • ERVs constitute a considerable proportion of the mammalian genome (8%), and can be grouped into approximately 100 families based on sequence homology. Many ERV sequences encode defective proviruses which share the prototypical retroviral genomic structure consisting of gag, pro, pot and env genes flanked by LTRs. Some intact ERV ORFs produce retroviral proteins which share features with proteins encoded by exogenous infectious retroviruses such as HIV-1. Such proteins may serve as antigens to induce a potent immune response (Hurst & Magiorkinis, 2015,
  • HERV-encoded proteins have been detected in a variety of human cancers.
  • splice variants of the HERV-K env gene, Rec and Np9 are found exclusively in malignant testicular germ cells and not in healthy cells (Ruprecht et. al, 2008, Cell Mol Life Sci 65:3366-3382).
  • Increased levels of HERV transcripts have also been observed in cancers such as those of the prostate, as compared to healthy tissue (Wang-Johanning, 2003, Cancer 98:187-197; Andersson et al., 1998, Int. J.
  • a wide range of vaccine modalities are known.
  • One well-described approach involves directly delivering an antigenic polypeptide to a subject with a view to raising an immune response (including B- and T-cell responses) and stimulating
  • a polynucleotide may be administered to the subject by means of a vector such that the polynuceotide-encoded immunogenic polypeptide is expressed in vivo.
  • viral vectors for example adenovirus vectors
  • adenovirus vectors has been well explored for the delivery of antigens in both prophylactic vaccination and therapeutic treatment strategies against cancer (Wold et al. Current Gene Therapy, 2013, Adenovirus Vectors for Gene Therapy, Vaccination and
  • Immunogenic peptides, polypeptides, or polynucleotides encoding them can also be used to load patient-derived antigen presenting cells (APCs), that can then be infused into the subject as a vaccine that elicits a therapeutic or prophylactic immune response.
  • APCs patient-derived antigen presenting cells
  • An example of this approach is Provenge, which is presently the only FDA-approved anti-cancer vaccine.
  • Cancer antigens may also be exploited in the treatment and prevention of cancer by using them to create a variety of non-vaccine therapeutic modalities.
  • Antigen-binding biologies typically consist of multivalent engineered
  • the antigen-binding components of these biologies may consist of TCR- based biologicals, including, but not limited to TCRs, high-affinity TCRs, and TCR mimetics produced by various technologies (including those based on monoclonal antibody technologies).
  • Cytolytic moieties of these types of multivalent biologies may consist of cytotoxic chemicals, biological toxins, targeting motifs and/or immune stimulating motifs that facilitate targeting and activation of immune cells, any of which facilitate the therapeutic destruction of tumor cells.
  • Adoptive cell therapies may be based on a patient’s own T-cells that are removed and stimulated ex vivo with vaccine antigen preparations (cultivated with T- cells in the presence or absence of other factors, including cellular and acellular components) (JCI Insight. 2018 Oct 4;3(19). pii: 122467. doi: 10.1172/jci. insight.122467).
  • adoptive cell therapies can be based on cells (including patient- or non-patient-derived cells) that have been deliberately engineered to express antigen-binding polypeptides that recognize cancer antigens. These antigen-binding polypeptides fall into the same classes as those described above for antigen-binding biologies.
  • lymphocytes autologous or non- autologous
  • that have been genetically manipulated to express cancer antigen- binding polypeptides can be administered to a patient as adoptive cell therapies to treat their cancer.
  • HERV-derived antigens in raising an effective immune response to cancer has shown promising results in promoting tumor regression and a more favourable prognosis in murine models of cancer (Kershaw et al. , 2001 , Cancer Res. 61 :7920-7924; Slansky et al., 2000, Immunity 13:529-538).
  • HERV antigen- centric immunotherapy trials have been contemplated in humans (Sacha et al.,2012, J. Immunol 189:1467-1479), although progress has been restricted, in part, due to a severe limitation of identified tumor-specific ERV antigens.
  • WO 2005/099750 identifies anchored sequences in existing vaccines against infectious pathogens, which are common in raising cross-reactive immune
  • WO 00/06598 relates to the identification of HERV-AVL3-B tumor associated genes which are preferentially expressed in melanomas, and methods and products for diagnosing and treating conditions characterised by expression of said genes.
  • WO 2006/119527 provides antigenic polypeptides derived from the
  • melanoma-associated endogenous retrovirus MMV
  • MMV melanoma-associated endogenous retrovirus
  • antigenic polypeptides as anticancer vaccines is also disclosed.
  • WO 2007/137279 discloses methods and compositions for detecting, preventing and treating HERV-K+ cancers, for example with use of a HERV-K+ binding antibody to prevent or inhibit cancer cell proliferation.
  • WO 2006/103562 discloses a method for treating or preventing cancers in which the immunosuppressive Np9 protein from the env gene of HERV-K is expressed.
  • the invention also relates to pharmaceutical compositions comprising nucleic acid or antibodies capable of inhibiting the activity of said protein, or immunogen or vaccinal composition capable of inducing an immune response directed against said protein.
  • WO 2007/109583 provides compositions and methods for preventing or treating neoplastic disease in a mammalian subject, by providing a composition comprising an enriched immune cell population reactive to a HERV-E antigen on a tumor cell.
  • Humer J, et al. , 2006, Cane. Res., 66:1658-63 identifies a melanoma marker derived from melanoma-associated endogenous retroviruses.
  • RNA transcripts which comprise LTR elements or are derived from genomic sequences adjacent to LTR elements which are found at high levels in cutaneous melanoma cells, but are undetectable or found at very low levels in normal, healthy tissues (see Example 1 ).
  • Such transcripts are herein referred to as cancer-specific LTR-element spanning transcripts (CLTs).
  • CLTs cancer-specific LTR-element spanning transcripts
  • CLT antigens open reading frames (ORFs)) encoded by these CLTs are translated in cancer cells, processed by components of the antigen-processing apparatus, and presented on the surface of cells found in tumor tissue in association with the class I and class II major histocompatibility complex (MHC Class I, and MHC Class II) and class I and class II human leukocyte antigen (HLA Class I, HLA Class II) molecules (see Example 2).
  • MHC Class I, and MHC Class II major histocompatibility complex
  • HLA Class I, HLA Class II human leukocyte antigen
  • cancer cell presentation of CLT antigens is expected to render these cells susceptible to elimination by T-cells that bear cognate T-cell receptors (TCRs) for the CLT antigens, and CLT antigen-based vaccination methods/regimens that amplify T-cells bearing these cognate TCRs are expected to elicit immune responses against cancer cells (and tumors containing them), particularly melanoma particularly cutaneous melanoma tumors.
  • T-cells from melanoma subjects are indeed reactive to peptides derived from CLT antigens disclosed herein and amplify T-cells and amplify T-cell receptor sequences (see Example 3).
  • T-cells specific for CLT antigens have not been deleted from normal subject’s T- cell repertoire by central tolerance (see Example 4).
  • the presence and killing activity of CLT antigen specific T-cells in ex vivo cultures of healthy donor T-cells has been determined (see Example 5).
  • qRT-PCR studies have confirmed that CLTs are specifically expressed in RNA extracted from melanoma cell lines as compared to non-melanoma cells lines (see Example 7).
  • the inventors have also surprisingly discovered that certain CLT antigen- encoding CLTs as well as being overexpressed in cutaneous melanoma are also overexpressed in uveal melanoma.
  • the CLT antigen polypeptide sequences encoded by these CLTs are expected to elicit immune responses against uveal melanoma cells and tumors containing them.
  • the CLTs and the CLT antigens that are the subject of the present invention are not canonical sequences which can be readily derived from known tumor genome sequences found in the cancer genome atlas.
  • the CLTs are transcripts resulting from complex transcription and splicing events driven by transcription control sequences of ERV origin. Since the CLTs are expressed at high level and since CLT antigen polypeptide sequences are not sequences of normal human proteins, it is expected that they will be capable of eliciting strong, specific immune responses (as indeed has been established - see Examples 3-5) and are thus suitable for therapeutic use in a cancer immunotherapy setting.
  • CLT antigens discovered in the highly expressed transcripts that characterize tumor cells which prior to the present invention were not known to exist and produce protein products in man and to stimulate immune responses, can be used in several formats.
  • CLT antigen polypeptides of the invention can be directly delivered to a subject as a vaccine that elicits a therapeutic or prophylactic immune response to tumor cells.
  • nucleic acids of the invention which may be codon optimised to enhance the expression of their encoded CLT antigens, can be directly administered or else inserted into vectors for delivery in vivo to produce the encoded protein products in a subject as a vaccine that elicits a therapeutic or prophylactic immune response to tumor cells.
  • polynucleotides and/or polypeptides of the invention can be used to load patient-derived antigen presenting cells (APCs), that can then be infused into the subject as a vaccine that elicits a therapeutic or prophylactic immune response to tumor cells.
  • APCs patient-derived antigen presenting cells
  • polynucleotides and/or polypeptides of the invention can be used for ex vivo stimulation of a subject’s T-cells, producing a stimulated T-cell preparation that can be administered to a subject as a therapy to treat cancer.
  • TCRs T-cell receptors
  • TCR mimetics that recognize CLT antigens complexed to MHC I molecules and have been further modified to permit them to kill (or facilitate killing) of cancer cells may be administered to a subject as a therapy to treat cancer.
  • chimeric versions of biological molecules that recognize CLT antigens complexed to MHC cells may be introduced into T-cells (autologous our non-autologous), and the resulting cells may be administered to a subject as a therapy to treat cancer.
  • the invention provides inter alia an isolated polypeptide comprising a sequence selected from:
  • polypeptide of the invention (hereinafter referred to as“a polypeptide of the invention”).
  • the invention also provides a nucleic acid molecule which encodes a polypeptide of the invention (hereinafter referred to as“a nucleic acid of the invention”).
  • polypeptides of the invention and the nucleic acids of the invention are expected to be useful in a range of embodiments in cancer immunotherapy and prophylaxis, particularly immunotherapy and prophylaxis of melanoma, as discussed in more detail below.
  • the top panel shows an extracted MS/MS spectrum (with assigned fragment ions) of a peptide isolated from a tumor sample of a patient and the bottom panel shows a rendering of the spectrum indicating the positions of the linear peptide sequences that have been mapped to the fragment ions.
  • Figure 1 Spectra for the peptide of SEQ ID NO. 11 isolated from a tumor sample of patient Mel-3.
  • Figure 3 Spectra for the peptide of SEQ ID NO. 13 isolated from a tumor sample of patient Mel-5.
  • Figure 4. Spectra for the peptide of SEQ ID NO. 13 isolated from a tumor sample of patient Mel-16. .
  • Figure 7 Spectra for the peptide of SEQ ID NO. 17 isolated from a tumor sample of patient Mel-35.
  • Figure 8 Spectra for the peptide of SEQ ID NO. 19 isolated from a tumor sample of patient Mel-3.
  • Figure 9 Spectra for the peptide of SEQ ID NO. 21 isolated from a tumor sample of patient Mel-27.
  • Figure 10 Spectra for the peptide of SEQ ID NO. 20 isolated from a tumor sample of patient Mel-27.
  • Figure 15 Spectra for the peptide of SEQ ID NO. 26 isolated from a tumor sample of patient Mel-41.
  • Figure 16 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-15 attributed to SEQ ID NO. 27.
  • Figure 17 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-10 attributed to SEQ ID NO. 29.
  • Figure 18 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-5 attributed to SEQ ID NO. 14.
  • Figure 19 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-4 attributed to SEQ ID NO. 21.
  • Figure 20 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-18 attributed to SEQ ID NO. 31.
  • Figure 21 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-16 attributed to SEQ ID NO. 13.
  • Figure 22 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-3 attributed to SEQ ID NO. 19.
  • Figure 23 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-6 attributed to SEQ ID NO. 28.
  • Figure 24 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-18 attributed to SEQ ID NO. 18.
  • Figure 25 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-4 attributed to SEQ ID NO. 30.
  • Figure 26 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-4 attributed to SEQ ID NO. 20.
  • Figure 27 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-20 attributed to SEQ ID NO. 16.
  • Figure 28 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient Mel-3 attributed to SEQ ID NO. 12.
  • the top panel shows an extracted MS/MS spectrum (with assigned fragment ions) of a peptide isolated from a tumor sample of a patient and the bottom panel shows a rendering of the spectrum indicating the positions of the linear peptide sequences that have been mapped to the fragment ions.
  • Figure 29 Spectra for the peptide of SEQ ID NO. 51 isolated from a tumor sample of patient Mel-40.
  • Figure 30 Spectra for the peptide of SEQ ID NO. 51 isolated from a tumor sample of patient Mel-41.
  • Figure 31 Spectra for the peptide of SEQ ID NO. 52 isolated from a tumor sample of patient Mel-27.
  • Figure 32 Spectra for the peptide of SEQ ID NO. 52 isolated from a tumor sample of patient Mel-39.
  • Figure 33 Spectra for the peptide of SEQ ID NO. 13 isolated from a tumor sample of patient 2MT3.
  • Figure 34 Spectra for the peptide of SEQ ID NO. 13 isolated from a tumor sample of patient 2MT10.
  • Figure 35 Spectra for the peptide of SEQ ID NO. 12 isolated from a tumor sample of patient 2MT3.
  • Figure 36 Spectra for the peptide of SEQ ID NO. 16 isolated from a tumor sample of patient 2MT4.
  • Figure 37 Spectra for the peptide of SEQ ID NO. 17 isolated from a tumor sample of patient 2MT3.
  • Figure 38 Spectra for the peptide of SEQ ID NO. 53 isolated from a tumor sample of patient 1 MT1.
  • Figure 39 Spectra for the peptide of SEQ ID NO. 51 isolated from a tumor sample of patient 2MT3.
  • Figure 40 Spectra for the peptide of SEQ ID NO. 19 isolated from a tumor sample of patient 2MT3.
  • Figure 41 Spectra for the peptide of SEQ ID NO. 19 isolated from a tumor sample of patient 2MT1.
  • Figure 42 Spectra for the peptide of SEQ ID NO. 54 isolated from a tumor sample of patient 2MT12.
  • FIG. 43-50 shows an alignment of a native MS/MS spectrum of a peptide isolated from a patient tumor sample (upper) to the native spectrum of a synthetic peptide corresponding to the same sequence (lower).
  • Figure 43 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT3 attributed to SEQ ID NO. 13.
  • Figure 44 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT3 attributed to SEQ ID NO. 12.
  • Figure 45 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT4 attributed to SEQ ID NO. 16.
  • Figure 46 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT3 attributed to SEQ ID NO. 17.
  • Figure 47 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 1 MT 1 attributed to SEQ ID NO. 53.
  • Figure 48 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT3 attributed to SEQ ID NO. 51.
  • Figure 49 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT3 attributed to SEQ ID NO. 19.
  • Figure 50 shows a mass spectrometry spectrum of a peptide fragment from immunopeptidomic analysis of patient 2MT12 attributed to SEQ ID NO. 54.
  • Figure 51 panels A to C shows tumor antigen-specific T-cell amplification from patient PBMC cultures in response to cultivation with specific tumor antigen-derived peptides.
  • FIG. 52 panels A to D provides a summary of CLT Antigen-derived peptides (SEQ ID NO.55 to SEQ ID NO. 72) that were capable of amplifying specific TCR-bearing T-cells from melanoma patient PBMCs.
  • Figure 53 shows CD8 T-cell responses from a normal blood donor to a HLA-A*0201- restricted peptide (SEQ ID NO. 73) from CLT Antigen 1.
  • Figure 54 shows CD8 T-cell responses from a normal blood donor to HLA-A*0201 - restricted peptide (SEQ ID NO. 75) from CLT Antigen 2.
  • Figure 55 shows CD8 T-cell responses from a normal blood donor to HLA-A*0201 - restricted peptide (SEQ ID NO. 76) from CLT Antigen 4.
  • Figure 56 panels A to D shows responsiveness to HLA-B*0702 restricted peptides (SEQ ID NO. 74 and 77) from CLT Antigen 1 and CLT Antigen 4 respectively in memory CD45RO-positive CD8 T-cells as compared with naive CD45RO-negative CD8 T-cells from the same donor.
  • Figure 57 shows HLA pentamer staining of normal CD8 T-cells specific for a peptide (SEQ ID NO. 73) derived from CLT Antigen 1 , a peptide (SEQ ID NO. 78) derived from CLT Antigen 2 and a peptide (SEQ ID NO. 77) derived from CLT Antigen 4.
  • Figure 58 shows expanded, pentamer-sorted CD8 T-cells killing C1 RB7-target cells pulsed with a peptide (SEQ ID NO. 77) derived from CLT Antigen 4.
  • Figure 59 panels A to C shows qRT-PCR assay results to verify the transcription of the CLT encoding CLT Antigen 1 (SEQ ID NO. 33), the CLT encoding CLT Antigen 2 (SEQ ID NO. 34) and the CLT encoding CLT Antigen 3 and 4 (SEQ ID NO. 35) in melanoma cancer cell lines.
  • SEQ ID NO. 1 is the polypeptide sequence of CLT Antigen 1
  • SEQ ID NO. 2 i is the polypeptide sequence of CLT Antigen 2
  • SEQ ID NO. 3 is the polypeptide sequence of CLT Antigen 3
  • SEQ ID NO. 4 is the polypeptide sequence of CLT Antigen 4
  • SEQ ID NO. 5 is the polypeptide sequence of CLT Antigen 5
  • SEQ ID NO. 6 is the polypeptide sequence of CLT Antigen 6
  • SEQ ID NO. 7 is the polypeptide sequence of CLT Antigen 7
  • SEQ ID NO. 8 is the polypeptide sequence of CLT Antigen 8
  • SEQ ID NO. 9 is the polypeptide sequence of CLT Antigen 9
  • SEQ ID NO. 10 is the polypeptide sequence of CLT Antigen 10
  • SEQ ID Nos. 11 -14 are peptide sequences derived from CLT Antigen 1
  • SEQ ID NOs. 15 and 16 are peptide sequences derived from CLT Antigen 2
  • SEQ ID NOs. 17 and 18 are peptide sequences derived from CLT Antigen 3
  • SEQ ID NO. 19 is a peptide sequence derived from CLT Antigen 4
  • SEQ ID NOs. 20-22 are peptide sequences derived from CLT Antigen 5
  • SEQ ID Nos. 23 and 24 are peptide sequences derived from CLT Antigen 6
  • SEQ ID NO. 25 is a peptide sequence derived from CLT Antigen 7
  • SEQ ID NO. 26 is a peptide sequence derived from CLT Antigen 8
  • SEQ ID Nos.. 27-29 are peptide sequences derived from CLT Antigen 9
  • SEQ ID Nos. 30-32 are peptide sequences derived from CLT Antigen 10
  • SEQ ID NO. 33 is the cDNA sequence of the CLT encoding CLT Antigen 1
  • SEQ ID NO. 34 is the cDNA sequence of the CLT encoding CLT Antigen 2
  • SEQ ID NO. 35 is the cDNA sequence of the CLT encoding CLT Antigens 3 and 4
  • SEQ ID NO. 36 is the cDNA sequence of the CLT encoding CLT Antigen 5
  • SEQ ID NO. 37 is the cDNA sequence of the CLT encoding CLT Antigen 6
  • SEQ ID NO. 38 is the cDNA sequence of the CLT encoding CLT Antigens 7 and 8
  • SEQ ID NO. 39 is the cDNA sequence of the CLT encoding CLT Antigen 9
  • SEQ ID NO. 40 is the cDNA sequence of the CLT encoding CLT Antigen 10
  • SEQ ID NO. 41 is a cDNA sequence encoding CLT Antigen 1
  • SEQ ID NO. 42 is a cDNA sequence encoding CLT Antigen 2
  • SEQ ID NO. 43 is a cDNA sequence encoding CLT Antigen 3
  • SEQ ID NO. 44 is a cDNA sequence encoding CLT Antigen 4
  • SEQ ID NO. 45 is a cDNA sequence encoding CLT Antigen 5
  • SEQ ID NO. 46 is a cDNA sequence encoding CLT Antigen 6
  • SEQ ID NO. 47 is a cDNA sequence encoding CLT Antigen 7
  • SEQ ID NO. 48 is a cDNA sequence encoding CLT Antigen 8
  • SEQ ID NO. 49 is a cDNA sequence encoding CLT Antigen 9
  • SEQ ID NO. 50 is a cDNA sequence encoding CLT Antigen 10
  • SEQ ID Nos. 51 -52 are peptide sequences derived from CLT Antigen 4
  • SEQ ID NO. 53 is a peptide sequence derived from CLT Antigen 3
  • SEQ ID NO. 54 is a peptide sequences derived from CLT Antigen 4
  • SEQ ID Nos. 55-57 are peptide sequences derived from CLT Antigen 1
  • SEQ ID NOs. 58-66 are peptide sequences derived from CLT Antigen 2
  • SEQ ID Nos. 67-69 are peptide sequences derived from CLT Antigen 3
  • SEQ ID Nos. 70-72 are peptide sequences derived from CLT Antigen 4
  • SEQ ID Nos. 73-74 are peptide sequences derived from CLT Antigen 1
  • SEQ ID NO. 75 is a peptide sequence derived from CLT Antigen 2
  • SEQ ID Nos. 76-77 are peptide sequences derived from CLT Antigen 4
  • SEQ ID NO. 78 is a peptide sequence derived from CLT Antigen 2
  • protein protein
  • polypeptide peptide
  • peptide refers to any peptide-linked chain of amino acids, regardless of length, co- translational or post-translational modification.
  • amino acid refers to any one of the naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner which is similar to the naturally occurring amino acids.
  • Naturally occurring amino acids are those 20 L-amino acids encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, g-carboxyglutamate, and 0- phosphoserine.
  • amino acid analogue refers to a compound that has the same basic chemical structure as a naturally occurring amino acid, i.e.
  • Examples include homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium and norleucine.
  • Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
  • an amino acid is a naturally occurring amino acid or an amino acid analogue, especially a naturally occurring amino acid and in particular one of those 20 L-amino acids encoded by the genetic code.
  • Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
  • the invention provides an isolated polypeptide comprising a sequence selected from:
  • the invention also provides an isolated polypeptide comprising a sequence selected from:
  • variants of polypeptide sequences of the invention include sequences having a high degree of sequence identity thereto.
  • variants suitably have at least about 80% identity, more preferably at least about 85% identity and most preferably at least about 90% identity (such as at least about 95%, at least about 98% or at least about 99%) to the associated reference sequence over their whole length.
  • the variant is an immunogenic variant.
  • a variant is considered to be an immunogenic variant where it elicits a response which is at least 20%, suitably at least 50% and especially at least 75% (such as at least 90%) of the activity of the reference sequence (i.e.
  • the sequence of which the variant is a variant e.g., in an in vitro restimulation assay of PBMC or whole blood with the polypeptide as antigen (e.g., restimulation for a period of between several hours to up to 1 year, such as up to 6 months, 1 day to 1 month or 1 to 2 weeks), that measures the activation of the cells via lymphoproliferation (e.g., T-cell proliferation), production of cytokines (e.g., IFN-gamma) in the supernatant of culture (measured by ELISA etc.) or
  • the variant may, for example, be a conservatively modified variant.
  • a “conservatively modified variant” is one where the alteration(s) results in the substitution of an amino acid with a functionally similar amino acid or the
  • substitution/deletion/addition of residues which do not substantially impact the biological function of the variant will be to induce an immune response against a melanoma e.g. a cutaneous melanoma cancer antigen.
  • Variants can include homologues of polypeptides found in other species.
  • a variant of a polypeptide of the invention may contain a number of substitutions, for example, conservative substitutions (for example, 1 -25, such as 1 - 10, in particular 1 -5, and especially 1 amino acid residue(s) may be altered) when compared to the reference sequence.
  • the number of substitutions for example, conservative substitutions, may be up to 20% e.g., up to 10% e.g., up to 5% e.g., up to 1 % of the number of residues of the reference sequence.
  • conservative substitutions will fall within one of the amino-acid groupings specified below, though in some circumstances other substitutions may be possible without substantially affecting the immunogenic properties of the antigen.
  • the following eight groups each contain amino acids that are typically conservative substitutions for one another:
  • substitutions do not alter the immunological structure of an epitope (e.g., they do not occur within the epitope region as mapped in the primary sequence), and do not therefore have a significant impact on the immunogenic properties of the antigen.
  • Polypeptide variants also include those wherein additional amino acids are inserted compared to the reference sequence, for example, such insertions may occur at 1 -10 locations (such as 1 -5 locations, suitably 1 or 2 locations, in particular 1 location) and may, for example, involve the addition of 50 or fewer amino acids at each location (such as 20 or fewer, in particular 10 or fewer, especially 5 or fewer). Suitably such insertions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen.
  • One example of insertions includes a short stretch of histidine residues (e.g., 2-6 residues) to aid expression and/or purification of the antigen in question.
  • Polypeptide variants include those wherein amino acids have been deleted compared to the reference sequence, for example, such deletions may occur at 1 -10 locations (such as 1 -5 locations, suitably 1 or 2 locations, in particular 1 location) and may, for example, involve the deletion of 50 or fewer amino acids at each location (such as 20 or fewer, in particular 10 or fewer, especially 5 or fewer). Suitably such deletions do not occur in the region of an epitope, and do not therefore have a significant impact on the immunogenic properties of the antigen.
  • a particular protein variant may comprise substitutions, deletions and additions (or any combination thereof).
  • substitutions/deletions/additions might enhance (or have neutral effects) on binding to desired patient HLA molecules, potentially increasing immunogenicity (or leaving immunogenicity unchanged).
  • Immunogenic fragments according to the present invention will typically comprise at least 9 contiguous amino acids from the full-length polypeptide
  • the immunogenic fragments will be at least 10%, such as at least 20%, such as at least 50%, such as at least 70% or at least 80% of the length of the full-length polypeptide sequence.
  • Immunogenic fragments typically comprise at least one epitope.
  • Epitopes include B cell and T-cell epitopes and suitably immunogenic fragments comprise at least one T-cell epitope such as a CD4+ or a CD8+ T-cell epitope.
  • T-cell epitopes are short contiguous stretches of amino acids which are recognised by T-cells (e.g., CD4+ or CD8+ T-cells) when bound to HLA molecules. Identification of T-cell epitopes may be achieved through epitope mapping
  • fragments of the full-length polypeptides of SEQ ID NOs. 1 -10 which contain at least one T-cell epitope may be immunogenic and may contribute to immunoprotection.
  • an immunogenic fragment contains a plurality of the epitopes from the full-length sequence (suitably all epitopes within a CLT antigen).
  • Particular fragments of the polypeptides of SEQ ID NOs. 1 -10 which may be of use include those containing at least one CD8+ T-cell epitope, suitably at least two CD8+ T-cell epitopes and especially all CD8+ T-cell epitopes, particularly those associated with a plurality of HLA alleles, e.g., those associated with 2, 3, 4, 5 or more alleles). Particular fragments of the polypeptides of SEQ ID NOs.
  • CD4+ T-cell epitopes which may be of use include those containing at least one CD4+ T-cell epitope, suitably at least two CD4+ T-cell epitopes and especially all CD4+ T-cell epitopes (particularly those associated with a plurality of HLA alleles, e.g., those associated with 2, 3, 4, 5 or more alleles).
  • a person skilled in design of vaccines could combine exogenous CD4+ T-cell epitopes with CD8+ T-cells epitopes of this invention and achieve desired responses to the invention’s CD8+ T-cell epitopes.
  • an individual fragment of the full-length polypeptide is used, such a fragment is considered to be immunogenic where it elicits a response which is at least 20%, suitably at least 50% and especially at least 75% (such as at least 90%) of the activity of the reference sequence (i.e.
  • the sequence of which the fragment is a fragment e.g., activity in an in vitro restimulation assay of PBMC or whole blood with the polypeptide as antigen (e.g., restimulation for a period of between several hours to up to 1 year, such as up to 6 months, 1 day to 1 month or 1 to 2 weeks,) that measures the activation of the cells via lymphoproliferation (e.g., T-cell proliferation), production of cytokines (e.g., IFN-gamma) in the supernatant of culture (measured by ELISA etc.) or characterisation of T-cell responses by intra and extracellular staining (e.g., using antibodies specific to immune markers, such as CD3, CD4, CD8, IL2, TNF-alpha, IFN-gamma, Type 1 IFN, CD40L, CD69 etc.) followed by analysis with a flow cytometer.
  • lymphoproliferation e.g., T-cell proliferation
  • cytokines e.g., I
  • a plurality of fragments of the full-length polypeptide may be used to obtain an equivalent biological response to the full-length sequence itself.
  • at least two immunogenic fragments such as three, four or five as described above, which in combination provide at least 50%, suitably at least 75% and especially at least 90% activity of the reference sequence in an in vitro restimulation assay of PBMC or whole blood (e.g., a T-cell proliferation and/or IFN-gamma production assay).
  • Example immunogenic fragments of polypeptides of SEQ ID NOs. 1 -10, and thus example peptides of the invention, include polypeptides which comprise or consist of the sequences of SEQ ID NOs. 11 -32.
  • Further example immunogenic fragments of polypeptides of SEQ ID NOs. 1 -4, and thus example peptides of the invention include polypeptides which comprise or consist of the sequences of SEQ ID NOs. 51 -78.
  • the sequences of SEQ ID NOs. 11 -17, 19-28, 30-31 and 51 -54 were identified as being bound to HLA Class I molecules from immunopeptidomic analysis (see Examples 2 and 2.1 ).
  • SEQ ID NOs 55-78 were predicted by NetMHC software eas being bound to HLA Class I molecules and were used in immunological validation assays (see Examples 3, 4 and 5).
  • the invention provides an isolated nucleic acid encoding a polypeptide of the invention (referred to as a nucleic acid of the invention).
  • a nucleic acid of the invention comprises or consists of a sequence selected from SEQ ID NOs. 33-40 or 41 -50.
  • nucleic acid and “polynucleotide” are used interchangeably herein and refer to a polymeric macromolecule made from nucleotide monomers particularly deoxyribonucleotide or ribonucleotide monomers.
  • the term encompasses nucleic acids containing known nucleotide analogs or modified backbone residues or linkages, which are naturally occurring and non-naturally occurring, which have similar properties as the reference nucleic acid, and which are intended to be metabolized in a manner similar to the reference nucleotides or are intended to have extended half- life in the system.
  • nucleic acid refers to naturally occurring polymers of deoxyribonucleotide or ribonucleotide monomers.
  • nucleic acid molecules of the invention are recombinant.
  • nucleic acid molecule is the product of at least one of cloning, restriction or ligation steps, or other procedures that result in a nucleic acid molecule that is distinct from a nucleic acid molecule found in nature (e.g., in the case of cDNA).
  • nucleic acid of the invention is an artificial nucleic acid sequence (e.g., a cDNA sequence or nucleic acid sequence with non- naturally occurring codon usage).
  • the nucleic acids of the invention are DNA.
  • the nucleic acids of the invention are RNA.
  • DNA deoxyribonucleic acid
  • RNA ribounucleic acid
  • the sugar moieties may be linked to bases which are the 4 natural bases (adenine (A), guanine (G), cytosine (C) and thymine (T) in DNA and adenine (A), guanine (G), cytosine (C) and uracil (U) in RNA).
  • a “corresponding RNA” is an RNA having the same sequence as a reference DNA but for the substitution of thymine (T) in the DNA with uracil (U) in the RNA.
  • the sugar moieties may also be linked to unnatural bases such as inosine, xanthosine, 7- methylguanosine, dihydrouridine and 5-methylcytidine. Natural phosphodiester linkages between sugar (deoxyribosyl/ribosyl) moieties may optionally be replaced with phosphorothioates linkages.
  • nucleic acids of the invention consist of the natural bases attached to a deoxyribosyl or ribosyl sugar backbone with phosphodiester linkages between the sugar moieties.
  • the nucleic acid of the invention is a DNA.
  • the nucleic acid comprises or consists of a sequence selected from SEQ ID NOs. 33-40 or 41 -50.
  • nucleic acids can encode any given polypeptide.
  • the codons GCA, GCC, GCG and GCU all encode the amino acid alanine.
  • the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
  • Such nucleic acid variations lead to“silent” (sometimes referred to as “degenerate” or“synonymous”) variants, which are one species of conservatively modified variations. Every nucleic acid sequence disclosed herein which encodes a polypeptide also enables every possible silent variation of the nucleic acid.
  • each codon in a nucleic acid can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid that encodes a polypeptide is implicit in each described sequence and is provided as an aspect of the invention.
  • Degenerate codon substitutions may also be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et at., 1991 , Nucleic Acid Res. 19:5081 ; Ohtsuka et al., 1985, J. Biol. Chem. 260:2605-2608; Rossolini et al., 1994, Mol. Cell. Probes 8:91 -98).
  • a nucleic acid of the invention which comprises or consists of a sequence selected from SEQ ID NOs. 33-40 or 41 -50 may contain a number of silent variations (for example, 1 -50, such as 1 -25, in particular 1 -5, and especially 1 codon(s) may be altered) when compared to the reference sequence.
  • the nucleic acid of the invention is an RNA.
  • RNA sequences are provided which correspond to a DNA sequence provided herein and have a ribonucleotide backbone instead of a deoxyribonucleotide backbone and have the sidechain base uracil (U) in place of thymine (T).
  • U sidechain base uracil
  • T thymine
  • a nucleic acid of the invention comprises or consists of the RNA equivalent of a cDNA sequence selected from SEQ ID NOs. 33-40 or 41 -50 and may contain a number of silent variations (for example, 1 -50, such as 1 -25, in particular 1 - 5, and especially 1 codon(s) may be altered) when compared to the reference sequence.
  • RNA equivalent is meant an RNA sequence which contains the same genetic information as the reference cDNA sequence (i.e. contains the same codons with a ribonucleotide backbone instead of a deoxyribonucleotide backbone and having the sidechain base uracil (U) in place of thymine (T)).
  • the invention also comprises sequences which are complementary to the aforementioned cDNA and RNA sequences.
  • nucleic acids of the invention are codon optimised for expression in a human host cell.
  • nucleic acids of the invention are capable of being transcribed and translated into polypeptides of the invention in the case of DNA nucleic acids, and translated into polypeptides of the invention in the case of RNA nucleic acids.
  • polypeptides and nucleic acids used in the present invention are isolated.
  • An“isolated” polypeptide or nucleic acid is one that is removed from its original environment.
  • a naturally-occurring polypeptide or nucleic acid is isolated if it is separated from some or all of the coexisting materials in the natural system.
  • a nucleic acid is considered to be isolated if, for example, it is cloned into a vector that is not a part of its natural environment.
  • Naturally occurring when used with reference to a polypeptide or nucleic acid sequence means a sequence found in nature and not synthetically modified.
  • “Artificial” when used with reference to a polypeptide or nucleic acid sequence means a sequence not found in nature which is, for example, a synthetic modification of a natural sequence, or contains an unnatural sequence.
  • heterologous when used with reference to the relationship of one nucleic acid or polypeptide to another nucleic acid or polypeptide indicates that the two or more sequences are not found in the same relationship to each other in nature.
  • A“heterologous” sequence can also mean a sequence which is not isolated from, derived from, or based upon a naturally occurring nucleic acid or polypeptide sequence found in the host organism.
  • polypeptide variants preferably have at least about 80% identity, more preferably at least about 85% identity and most preferably at least about 90% identity (such as at least about 95%, at least about 98% or at least about 99%) to the associated reference sequence over their whole length.
  • the“% sequence identity" between a first sequence and a second sequence may be calculated.
  • Polypeptide sequences are said to be the same as or identical to other polypeptide sequences, if they share 100% sequence identity over their entire length. Residues in sequences are numbered from left to right, i.e. from N- to C- terminus for polypeptides.
  • identity in the context of two or more polypeptide sequences, refer to two or more sequences or sub-sequences that are the same or have a specified percentage of amino acid residues that are the same (i.e., 70% identity, optionally 75%, 80%, 85%, 90%, 95%, 98% or 99% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window.
  • the comparison is performed over a window corresponding to the entire length of the reference sequence.
  • sequence comparison For sequence comparison, one sequence acts as the reference sequence, to which the test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percentage sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • A“comparison window”, as used herein, refers to a segment in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
  • Methods of alignment of sequences for comparison are well-known in the art.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, 1981 , Adv. Appi Math. 2:482, by the homology alignment algorithm of Needleman & Wunsch, 1970, J. Mol. Biol. 48:443, by the search for similarity method of Pearson & Lipman, 1988, Proc. Natl. Acad. Sci.
  • PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity. It also plots a tree or dendogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng & Doolittle, 1987, J. Mol. Evol. 35:351 -360. The method used is similar to the method described by Higgins & Sharp, 1989, CABIOS 5: 151 -153. The program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids.
  • the multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster is then aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pairwise alignments.
  • the program is run by designating specific sequences and their amino acid coordinates for regions of sequence comparison and by designating the program parameters.
  • PILEUP a reference sequence is compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps.
  • PILEUP can be obtained from the GCG sequence analysis software package, e.g., version 7.0 (Devereaux et al., 1984, Nuc. Acids Res. 12:387-395).
  • HSPs high scoring sequence pairs
  • T is referred to as the neighbourhood word score threshold (Altschul et al., supra).
  • These initial neighbourhood word hits act as seeds for initiating searches to find longer HSPs containing them.
  • the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased.
  • Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0).
  • M forward score for a pair of matching residues
  • N penalty score for mismatching residues; always ⁇ 0
  • a scoring matrix is used to calculate the cumulative score.
  • Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, 1993, Proc. Natl. Acad. Sci. USA 90:5873-5787).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • A“difference” between sequences refers to an insertion, deletion or substitution of a single residue in a position of the second sequence, compared to the first sequence.
  • Two sequences can contain one, two or more such differences. Insertions, deletions or substitutions in a second sequence which is otherwise identical (100% sequence identity) to a first sequence result in reduced % sequence identity. For example, if the identical sequences are 9 residues long, one substitution in the second sequence results in a sequence identity of 88.9%. If the identical sequences are 17 amino acid residues long, two substitutions in the second sequence results in a sequence identity of 88.2%.
  • the number of additions, substitutions and/or deletions made to the first sequence to produce the second sequence may be ascertained.
  • An addition is the addition of one residue into the first sequence (including addition at either terminus of the first sequence).
  • a substitution is the substitution of one residue in the first sequence with one different residue.
  • a deletion is the deletion of one residue from the first sequence (including deletion at either terminus of the first sequence).
  • Polypeptides of the invention can be obtained and manipulated using the techniques disclosed for example in Green and Sambrook 2012 Molecular Cloning:
  • a gene encoding a polypeptide of the invention can be synthetically produced by, for example, solid-phase DNA synthesis.
  • Entire genes may be synthesized de novo, without the need for precursor template DNA.
  • the building blocks are sequentially coupled to the growing oligonucleotide chain in the order required by the sequence of the product.
  • the product Upon the completion of the chain assembly, the product is released from the solid phase to solution, deprotected, and collected. Products can be isolated by high- performance liquid chromatography (HPLC) to obtain the desired oligonucleotides in high purity (Verma and Eckstein, 1998, Annu. Rev. Biochem. 67:99-134).
  • nucleic acids of the invention will comprise suitable regulatory and control sequences (including promoters,
  • polypeptides of the invention could be produced by transducing cultures of eukaryotic cells (e.g., Chinese hamster ovary cells or drosophila S2 cells) with nucleic acids of the invention which have been combined with suitable regulatory and control sequences (including promoters, termination signals etc) and sequences to promote polypeptide secretion suitable for protein production in these cells.
  • eukaryotic cells e.g., Chinese hamster ovary cells or drosophila S2 cells
  • suitable regulatory and control sequences including promoters, termination signals etc
  • Improved isolation of the polypeptides of the invention produced by recombinant means may optionally be facilitated through the addition of a stretch of histidine residues (commonly known as a His-tag) towards one end of the polypeptide.
  • His-tag a stretch of histidine residues
  • Polypeptides may also be produced synthetically.
  • nucleic acid e.g., DNA
  • the nucleic acid may be present within any of a variety of delivery systems known to those of ordinary skill in the art, including nucleic acid expression systems, bacteria and some viral expression systems. Numerous gene delivery techniques are well known in the art, such as those described by Rolland, 1998, Crit. Rev. Therap. Drug Carrier Systems 15: 143-198, and references cited therein. Several of these approaches are outlined below for the purpose of illustration.
  • a vector also referred to herein as a ⁇ NA expression construct’ or‘construct’
  • construct comprising a nucleic acid molecule of the invention.
  • the vector comprises nucleic acid encoding regulatory elements (such as a suitable promoter and terminating signal) suitable for permitting
  • translationally active RNA molecule is an RNA molecule capable of being
  • vector of the invention comprising a nucleic acid of the invention (herein after a“vector of the invention”).
  • the vector may be a viral vector.
  • the viral vector may be an adenovirus, adeno-associated virus (AAV) (e.g., AAV type 5 and type 2), alphavirus (e.g., Venezuelan equine encephalitis virus (VEEV), Sindbis virus (SIN), Semliki Forest virus (SFV)), herpes virus, arenavirus (e.g., lymphocytic choriomeningitis virus (LCMV)), measles virus, poxvirus (such as modified vaccinia Ankara (MVA)), paramyxovirus, lentivirus, or rhabdovirus (such as vesicular stomatitis virus (VSV)) vector i.e. the vector may be derived from any of the aforementioned viruses.
  • AAV adeno-associated virus
  • alphavirus e.g., Venezuelan equine encephalitis virus (VEEV), Sindbis virus (SIN), Semliki
  • Adenoviruses are particularly suitable for use as a gene transfer vector because of its mid-sized genome, ease of manipulation, high titre, wide target-cell range and high infectivity. Both ends of the viral genome contain 100-200 base pair inverted repeats (ITRs), which are cis elements necessary for viral DNA replication and packaging.
  • ITRs inverted repeats
  • the early (E) and late (L) regions of the genome contain different transcription units that are divided by the onset of viral DNA replication.
  • the E1 region (E1 A and E1 B) encodes proteins responsible for the regulation of
  • E2A and E2B results in the synthesis of the proteins for viral DNA
  • MLP major late promoter
  • TPL 5‘-tripartite leader
  • the expression construct comprising one or more polynucleotide sequences may simply consist of naked recombinant DNA plasmids. See Ulmer et al., 1993, Science 259:1745-1749 and reviewed by Cohen, 1993, Science 259:1691 -1692. Transfer of the construct may be performed, for example, by any method which physically or chemically permeabilises the cell membrane. This is particularly applicable for transfer in vitro but it may be applied to in vivo use as well. It is envisioned that DNA encoding a gene of interest may also be transferred in a similar manner in vivo and express the gene product. Multiple delivery systems have been used to deliver DNA molecules into animal models and into man. Some products based on this technology have been licensed for use in animals, and others are in phase 2 and 3 clinical trials in man. RNA delivery
  • the expression construct comprising one or more polynucleotide sequences may consist of naked, recombinant DNA- derived RNA molecules (Ulmer et al. , 2012, Vaccine 30:4414-4418).
  • DNA- based expression constructs a variety of methods can be utilized to introduce RNA molecules into cells in vitro or in vivo.
  • the RNA-based constructs can be designed to mimic simple messenger RNA (mRNA) molecules, such that the introduced biological molecule is directly translated by the host cell’s translation machinery to produce its encoded polypeptide in the cells to which it has been introduced.
  • mRNA simple messenger RNA
  • RNA molecules may be designed in a manner that allows them to self- amplify within cells they are introduced into, by incorporating into their structure genes for viral RNA-dependent RNA polymerases.
  • SAMTM self-amplifying mRNA
  • Either mRNA-based or SAMTM RNAs may be further modified (e.g., by alteration of their sequences, or by use of modified nucleotides) to enhance stability and translation (Schlake et al., RNA Biology, 9: 1319-1330), and both types of RNAs may be formulated (e.g., in emulsions (Brito et al., Molecular Therapy, 2014
  • RNA-based vaccines have been tested as vaccines in animal models and in man, and multiple RNA-based vaccines are being used in ongoing clinical trials.
  • compositions of the invention may be formulated for delivery in pharmaceutical compositions such as immunogenic compositions and vaccine compositions (all hereinafter“compositions of the invention”).
  • compositions of the invention suitably comprise a polypeptide, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier.
  • an immunogenic pharmaceutical composition comprising a polypeptide, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier.
  • a vaccine composition comprising a polypeptide, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier.
  • Preparation of pharmaceutical compositions is generally described in, for example, Powell & Newman, eds., Vaccine Design (the subunit and adjuvant approach), 1995.
  • Compositions of the invention may also contain other compounds, which may be biologically active or inactive.
  • the composition of the invention is a sterile composition suitable for parenteral administration.
  • compositions of the invention which comprise one or more (e.g., one) polypeptides of the invention in combination with a pharmaceutically acceptable carrier.
  • compositions of the invention which comprise one or more (e.g., one) nucleic acids of the invention or one or more (e.g., one) vectors of the invention in combination with a pharmaceutically acceptable carrier.
  • compositions of the invention may comprise one or more (e.g., one) polynucleotide and one or more (e.g., one) polypeptide
  • compositions may comprise one or more (e.g., one) vector and one or more (e.g., one) polypeptide components.
  • compositions may comprise one or more (e.g., one) vector and one or more (e.g., one) polynucleotide components. Such compositions may provide for an enhanced immune response.
  • composition of the invention may contain
  • salts of the nucleic acids or polypeptides provided herein may be prepared from pharmaceutically acceptable non-toxic bases, including organic bases (e.g., salts of primary, secondary and tertiary amines and basic amino acids) and inorganic bases (e.g., sodium, potassium, lithium, ammonium, calcium and magnesium salts).
  • organic bases e.g., salts of primary, secondary and tertiary amines and basic amino acids
  • inorganic bases e.g., sodium, potassium, lithium, ammonium, calcium and magnesium salts.
  • compositions of the present invention may be formulated for any appropriate manner of administration, including for example, parenteral, topical, oral, nasal, intravenous, intracranial, intraperitoneal, subcutaneous or intramuscular administration, preferably parenteral e.g., intramuscular, subcutaneous or intravenous administration.
  • the carrier preferably comprises water and may contain buffers for pH control, stabilising agents e.g., surfactants and amino acids and tonicity modifying agents e.g., salts and sugars.
  • the formulation may contain a lyoprotectant e.g., sugars such as trehalose.
  • a lyoprotectant e.g., sugars such as trehalose.
  • any of the above carriers or a solid carrier such as mannitol, lactose, starch, magnesium stearate, sodium saccharine, talcum, cellulose, glucose, sucrose, and magnesium carbonate, may be employed.
  • compositions of the invention may comprise buffers (e.g., neutral buffered saline or phosphate buffered saline), carbohydrates (e.g., glucose, mannose, sucrose or dextrans), mannitol, proteins, polypeptides or amino acids such as glycine, antioxidants, bacteriostats, chelating agents such as EDTA or
  • compositions of the invention may be formulated as a lyophilizate.
  • compositions of the invention may also comprise one or more
  • An immunostimulant may be any substance that enhances or potentiates an immune response (antibody and/or cell-mediated) to an exogenous antigen.
  • immunostimulants which are often referred to as adjuvants in the context of vaccine formulations, include aluminium salts such as aluminium hydroxide gel (alum) or aluminium phosphate, saponins including QS21 ,
  • immunostimulatory oligonucleotides such as CPG, oil-in-water emulsion (e.g., where the oil is squalene), aminoalkyl glucosaminide 4-phosphates, lipopolysaccharide or a derivative thereof e.g., 3-de-O-acylated monophosphoryl lipid A (3D-MPL®) and other TLR4 ligands, TLR7 ligands, TLR8 ligands, TLR9 ligands, IL-12 and
  • the one or more immunostimulants of the composition of the invention are selected from aluminium salts, saponins, immunostimulatory oligonucleotides, oil-in-water emulsions, aminoalkyl glucosaminide 4-phosphates, lipopolysaccharides and derivatives thereof and other TLR4 ligands, TLR7 ligands, TLR8 ligands and TLR9 ligands.
  • Immunostimulants may also include monoclonal antibodies which specifically interact with other immune components, for example monoclonal antibodies that block the interaction of immune checkpoint receptors, including PD-1 and CTLA4.
  • the genes encoding protein-based immunostimulants may be readily delivered along with the genes encoding the polypeptides of the invention.
  • compositions described herein may be administered as part of a sustained-release formulation (i.e., a formulation such as a capsule, sponge, patch or gel (composed of polysaccharides, for example)) that effects a slow/sustained release of compound following administration.
  • a sustained-release formulation i.e., a formulation such as a capsule, sponge, patch or gel (composed of polysaccharides, for example)
  • compositions of the invention may be presented in unit-dose or multi-dose containers, such as sealed ampoules or vials. Such containers are preferably hermetically sealed to preserve sterility of the formulation until use.
  • formulations may be stored as suspensions, solutions or emulsions in oily or aqueous vehicles.
  • a composition of the invention may be stored in a freeze-dried condition requiring only the addition of a sterile liquid carrier (such as water or saline for injection) immediately prior to use.
  • each composition of the invention may be prepared is such a way that a suitable dosage for therapeutic or prophylactic use will be obtained.
  • Factors such as solubility, bioavailability, biological half-life, route of administration, product shelf life, as well as other pharmacological considerations will be contemplated by one skilled in the art of preparing such compositions, and as such, a variety of dosages and treatment regimens may be desirable.
  • compositions comprising a therapeutically or prophylactically effective amount deliver about 0.1 ug to about 1000 ug of polypeptide of the invention per administration, more typically about 2.5 ug to about 100 ug of polypeptide per administration. If delivered in the form of short, synthetic long peptides, doses could range from 1 to 200ug/peptide/dose.
  • these typically deliver about 10 ug to about 20 mg of the nucleic acid of the invention per administration, more typically about 0.1 mg to about 10 mg of the nucleic acid of the invention per administration.
  • SEQ ID NOs. 1 -10 are polypeptide sequences
  • the invention provides a polypeptide, nucleic acid, vector or composition of the invention for use in medicine.
  • Further aspects of the invention relate to a method of raising an immune response in a human which comprises administering to said human the polypeptide, nucleic acid, vector or composition of the invention.
  • the present invention also provides a polypeptide, nucleic acid, vector or composition of the invention for use in raising an immune response in a human.
  • polypeptide, nucleic acid, vector or composition of the invention for the manufacture of a medicament for use in raising an immune response in a human.
  • the immune response is raised against a cancerous tumor expressing a corresponding sequence selected from SEQ ID NOs. 1 -10 and variants and immunogenic fragments of any one thereof.
  • corresponding in this context is meant that if the tumor expresses, say, SEQ ID NO. A (A being one of SEQ ID NOs. 1 -10) or a variant or immunogenic fragment thereof then the polypeptide, nucleic acid, vector or composition of the invention and medicaments involving these will be based on SEQ ID NO. A or a variant or immunogenic fragment thereof.
  • the immune response comprises CD8+ T-cell, a CD4+ T-cell and/or an antibody response, particularly CD8+ cytolytic T-cell response and a CD4+ helper T- cell response.
  • the immune response is raised against a tumor, particularly one expressing a sequence selected from SEQ ID NOs. 1 -10 and variants thereof and immunogenic fragments thereof.
  • the tumor is a melanoma tumor e.g. a cutaneous melanoma tumor.
  • the tumor may be a primary tumor or a metastatic tumor.
  • Further aspects of the invention relate to a method of treating a human patient suffering from cancer wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments and variants of any one thereof, or of preventing a human from suffering from cancer which cancer would express a sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments and variants of any one thereof, which method comprises administering to said human a corresponding polypeptide, nucleic acid, vector or composition of the invention.
  • the present invention also provides a polypeptide, nucleic acid, vector or composition of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments of any one thereof.
  • the tumor is a uveal melanoma tumor and/or the tumor expresses a sequence selected from SEQ ID NOs. 1 , 3, 4, 5 and 10.
  • the invention provides a method or a polypeptide, nucleic acid, vector or composition for use according to the invention wherein the polypeptide comprises a sequence selected from:
  • polypeptide comprises or consists of a sequence selected from any one of SEQ ID NOs. 1 1 -14, 17-18, 19, 20-22, 30-32, 51 - 57, 67-74 and 76-77 and for example the nucleic acid comprises or consists of a sequence selected from any one of SEQ ID NOs. 33, 35, 36 or 40 or selected from any one of 41 , 43, 44, 45 and 50;
  • cancer is uveal melanoma.
  • a therapeutic regimen may involve either simultaneous (such as co- administration) or sequential (such as a prime-boost) delivery of (i) a polypeptide, nucleic acid or vector of the invention with (ii) one or more further polypeptides, nucleic acids or vectors of the invention and/or (iii) a further component such as a variety of other therapeutically useful compounds or molecules such as antigenic proteins optionally simultaneously administered with adjuvant.
  • co- administration include homo-lateral co-administration and contra-lateral co- administration.
  • “Simultaneous” administration suitably refers to all components being delivered during the same round of treatment. Suitably all components are administered at the same time (such as simultaneous administration of both DNA and protein), however, one component could be administered within a few minutes (for example, at the same medical appointment or doctor’s visit) or within a few hours.
  • a“priming” or first administration of a polypeptide, nucleic acid or vector of the invention is followed by one or more“boosting” or subsequent administrations of a polypeptide, nucleic acid or vector of the invention (“prime and boost” method).
  • the polypeptide, nucleic acid or vector of the invention is used in a prime-boost vaccination regimen.
  • both the prime and boost are of a polypeptide of the invention, the same polypeptide of the invention in each case.
  • both the prime and boost are of a nucleic acid or vector of the invention, the same nucleic acid or vector of the invention in each case.
  • the prime may be performed using a nucleic acid or vector of the invention and the boost performed using a polypeptide of the invention or the prime may be performed using a polypeptide of the invention and the boost performed using a nucleic acid or vector of the invention.
  • administration are given about 1 -12 weeks later, or up to 4-6 months later.
  • Subsequent“booster” administrations may be given as frequently as every 1 -6 weeks or may be given much later (up to years later).
  • polypeptides, nucleic acids or vectors of the invention can be used in combination with one or more other polypeptides or nucleic acids, vectors of the invention and/or with other antigenic polypeptides (or polynucleotides or vectors encoding them) which cause an immune response to be raised against melanoma e.g. cutaneous or uveal melanoma.
  • antigenic polypeptides or polynucleotides or vectors encoding them
  • antigenic polypeptides could be derived from diverse sources, they could include well-described melanoma- associated antigens, such as GPR143, PRAME, MAGE-A3 or pMel (gp100).
  • melanoma antigens including patient-specific neoantigens (Lauss et al. (2017). Nature Communications, 8(1 ), 1738.
  • antigenic peptides from these various sources could also be combined with (i) non-specific immunostimulant/adjuvant species and/or (ii) an antigen, e.g. comprising universal CD4 helper epitopes, known to elicit strong CD4 helper T-cells (delivered as a polypeptides, or as polynucleotides or vectors encoding these CD4 antigens), to amplify the anti-melanoma-specific responses elicited by co-administered antigens.
  • an antigen e.g. comprising universal CD4 helper epitopes, known to elicit strong CD4 helper T-cells (delivered as a polypeptides, or as polynucleotides or vectors encoding these CD4 antigens
  • polypeptides may be formulated in the same formulation or in separate formulations.
  • polypeptides may be provided as fusion proteins in which a polypeptide of the invention is fused to a second or further polypeptide (see below).
  • Nucleic acids may be provided which encode the aforementioned fusion proteins.
  • polynucleotides e.g., a single polynucleotide, such as one encoding a single fusion protein.
  • Fusion proteins (fusion polypeptides)
  • the invention also provides an isolated polypeptide according to the invention fused to a second or further polypeptide of the invention (herein after a“combination polypeptide of the invention”), by creating nucleic acid constructs that fuse together the sequences encoding the individual antigens.
  • Combination polypeptides of the invention are expected to have the utilities described herein for polypeptides of the invention, and may have the advantage of superior immunogenic or vaccine activity or prophylactic or therapeutic effect (including increasing the breadth and depth of responses), and may be especially valuable in an outbred population. Fusions of polypeptides of the invention may also provide the benefit of increasing the efficiency of construction and manufacture of vaccine antigens and/or vectored vaccines (including nucleic acid vaccines).
  • polypeptides of the invention and combination polypeptides of the invention may also be fused to polypeptide sequences which are not polypeptides of the invention, including one or more of:
  • polypeptide sequences which are capable of enhancing an immune response i.e. immunostimulant sequences.
  • Polypeptide sequences e.g. comprising universal CD4 helper epitopes, which are capable of providing strong CD4+ help to increase CD8+ T-cell responses to CLT antigen epitopes.
  • exemplary fusion polypeptides comprises two or more (e.g. two, three or four) sequences selected from the sequences of SEQ ID NOs. 1 , 2, 3 and 4; or, in respect of each of the said sequences, a variant of the sequence or an immunogenic fragment of the sequence.
  • An exemplary fusion polypeptide comprises:
  • the fusion polypeptide comprises the sequences of SEQ ID NOs. 1 , 2, 3 and 4.
  • Another exemplary fusion polypeptide comprises:
  • the fusion polypeptide comprises the sequences of SEQ ID NOs. 1 , 2 and 4.
  • the invention also provides nucleic acids encoding the aforementioned fusion polypeptides and other aspects of the invention (vectors, compositions, cells etc) mutatis mutandis as for the polypeptides of the invention.
  • Antigen-binding polypeptides which are immunospecific for tumor-expressed antigens may be designed to recruit cytolytic cells to antigen-decorated tumor cells, mediating their destruction.
  • One such mechanism of recruitment of cytolytic cells by antigen-binding polypeptides is known as antibody- dependent cell-mediated cytotoxicity (ADCC).
  • ADCC antibody- dependent cell-mediated cytotoxicity
  • Antigen-binding polypeptides including antibodies such as monoclonal antibodies and fragments thereof e.g., domain antibodies, Fab fragments, Fv fragments, and VHH fragments which may produced in a non-human animal species (e.g., rodent or camelid) and humanised or may be produced in a non-human species (e.g., rodent genetically modified to have a human immune system).
  • Antigen-binding polypeptides may be produced by methods well known to a skilled person.
  • monoclonal antibodies can be produced using hybridoma technology, by fusing a specific antibody-producing B cell with a myeloma (B cell cancer) cell that is selected for its ability to grow in tissue culture and for an absence of antibody chain synthesis (Kohler and Milstein, 1975, Nature 256(5517): 495-497 and Nelson et al. , 2000 (Jun), Mol Pathol. 53(3): 111 -7 herein incorporated by reference in their entirety).
  • a monoclonal antibody directed against a determined antigen can, for example, be obtained by:
  • Monoclonal antibodies can be obtained by a process comprising the steps of: a) cloning into vectors, especially into phages and more particularly filamentous bacteriophages, DNA or cDNA sequences obtained from lymphocytes especially peripheral blood lymphocytes of an animal (suitably previously immunized with determined antigens),
  • the selected antibodies may then be produced using conventional recombinant protein production technology (e.g., from genetically engineered CHO cells).
  • the invention provides an isolated antigen-binding polypeptide which is immunospecific for a polypeptide of the invention.
  • the antigen-binding polypeptide is a monoclonal antibody or a fragment thereof.
  • the antigen-binding polypeptide is coupled to a cytotoxic moiety.
  • cytotoxic moieties include the Fc domain of an antibody, which will recruit Fc receptor-bearing cells facilitating ADCC.
  • the antigen-binding polypeptide may be linked to a biological toxin, or a cytotoxic chemical.
  • Another important class of antigen-binding polypeptides include T-cell receptor (TCR)-derived molecules that bind to HLA-displayed fragments of the antigens of this invention.
  • TCR-based biologicals that recognize CLT antigens (or derivatives thereof) on the surface of tumor cells may also include a targeting moiety which recognizes a component on a T-cell (or another class of immune cell) that attract these immune cells to tumors, providing therapeutic benefit.
  • the targeting moiety may also stimulate beneficial activities (including cytolytic activities) of the redirected immune cells.
  • the antigen-binding polypeptide is immunospecific for an HLA-bound polypeptide that is or is part of a polypeptide of the invention.
  • the antigen-binding polypeptide is a T-cell receptor.
  • an antigen-binding polypeptide of the invention may be coupled to another polypeptide that is capable of binding to cytotoxic cells or other immune components in a subject.
  • the antigen-binding polypeptide is for use in medicine.
  • a pharmaceutical composition comprising an antigen-binding polypeptide of the invention together with a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier may be a sterile composition suitable for parenteral administration. See e.g., disclosure of pharmaceutical compositions supra.
  • the invention a method of treating a human suffering from cancer wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments and variants of any one thereof, or of preventing a human from suffering from cancer wherein the cells of the cancer would express a sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments and variants of any one thereof, which comprises administering to said human an antigen-binding polypeptide or composition comprising said antigen-binding polypeptide of the invention.
  • an antigen-binding polypeptide of the invention which may be coupled to a cytotoxic moiety, or composition comprising said antigen-binding polypeptide of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments of any one thereof.
  • the cancer is melanoma
  • polypeptide comprises a sequence selected from:
  • polypeptide comprises or consists of a sequence selected from any one of SEQ ID NOs. 11 -14, 17-18, 19, 20-22, 30-32, 51 -57, 67-74 and 76-77 and for example the nucleic acid comprises or consists of a sequence selected from any one of SEQ ID NOs. 33, 35, 36 or 40 or selected from any one of 41 , 43, 44, 45 and 50;
  • cancer is uveal melanoma.
  • Antigen-binding polypeptides may be administered at a dose of e.g. 5-1000 mg e.g. 25-500 mg e.g. 100-300 mg e.g. ca. 200 mg.
  • the invention provides a cell which is an isolated antigen presenting cell modified by ex vivo loading with a polypeptide of the invention or genetically engineered to express the polypeptide of the invention (herein after referred to as a “APC of the invention”).
  • APC Antigen presenting cells
  • APCs such as dendritic cells, macrophages, B cells, monocytes and other cells that may be engineered to be efficient APCs.
  • APCs may generally be isolated from any of a variety of biological fluids and organs, and may be autologous, allogeneic, syngeneic or xenogeneic cells. Certain preferred embodiments of the present invention use dendritic cells or progenitors thereof as APCs. Thus, in an embodiment, the APC of the invention is a dendritic cell.
  • Dendritic cells are highly potent APCs (Banchereau & Steinman, 1998, Nature, 392:245-251 ) and have been shown to be effective as a physiological adjuvant for eliciting prophylactic or therapeutic immunity ( see Timmerman & Levy, 1999, Ann. Rev. Med. 50:507-529).
  • dendritic cells may be identified based on their typical shape (stellate in situ, with marked cytoplasmic processes (dendrites) visible in vitro), their ability to take up, process and present antigens with high efficiency and their ability to activate naive T-cell responses.
  • Dendritic cells may, of course be engineered to express specific cell-surface receptors or ligands that are not commonly found on dendritic cells in vivo or ex vivo, and such modified dendritic cells are contemplated by the present invention.
  • antigen-loaded secreted vesicles may be used within an immunogenic composition (see Zitvogel et ai, 1998, Nature Med. 4:594- 600).
  • exosomes antigen-loaded secreted vesicles
  • Dendritic cells and progenitors may be obtained from peripheral blood, bone marrow, lymph nodes, spleen, skin, umbilical cord blood or any other suitable tissue or fluid.
  • dendritic cells may be differentiated ex vivo by adding a combination of cytokines such as GM-CSF, IL-4, IL-13 and/or TNFa to cultures of monocytes harvested from peripheral blood.
  • CD34-positive cells harvested from peripheral blood, umbilical cord blood or bone marrow may be differentiated into dendritic cells by adding to the culture medium combinations of GM-CSF, IL-3, TNFa, CD40 ligand, LPS, flt3 ligand and/or other compound(s) that induce differentiation, maturation and proliferation of dendritic cells.
  • Dendritic cells are conveniently categorised as“immature” and“mature” cells, which allows a simple way to discriminate between two well-characterised phenotypes. However, this nomenclature should not be construed to exclude all possible intermediate stages of differentiation. Immature dendritic cells are characterised as APCs with a high capacity for antigen uptake and processing, which correlates with the high expression of Fey receptor and mannose receptor.
  • the mature phenotype is typically characterized by a lower expression of these markers, but a high expression of cell surface molecules responsible for T-cell activation such as class I and class II MHC, adhesion molecules (e.g., CD54 and CD11 ) and costimulatory molecules (e.g., CD40, CD80, CD86 and 4-1 BB).
  • class I and class II MHC cell surface molecules responsible for T-cell activation
  • adhesion molecules e.g., CD54 and CD11
  • costimulatory molecules e.g., CD40, CD80, CD86 and 4-1 BB.
  • APCs may also be genetically engineered e.g., transfected with a
  • a gene delivery vehicle that targets a dendritic or other antigen presenting cell may be administered to a patient, resulting in transfection that occurs in vivo.
  • In vivo and ex vivo transfection of dendritic cells may generally be performed using any methods known in the art, such as those described in WO 97/24447, or the gene gun approach described by Mahvi et al., 1997, Immunology and Cell Biology 75:456-460.
  • Antigen loading of dendritic cells may be achieved by incubating dendritic cells or progenitor cells with the polypeptide, DNA (e.g., a plasmid vector) or RNA; or with antigen-expressing recombinant bacteria or viruses (e.g., an adenovirus, adeno-associated virus (AAV) (e.g., AAV type 5 and type 2), alphavirus (e.g., Venezuelan equine encephalitis virus (VEEV), Sindbis virus (SIN), Semliki Forest virus (SFV), herpes virus, arenavirus (e.g., lymphocytic choriomeningitis virus (LCMV)), measles virus, poxvirus (such as modified vaccinia Ankara (MVA) or fowlpox), paramyxovirus, lentivirus, or
  • AAV adeno-associated virus
  • alphavirus e.g., Venezuelan equine encephalitis virus
  • the polypeptides Prior to polypeptide loading, the polypeptides may be covalently conjugated to an immunological partner that provides T-cell help (e.g., a carrier molecule). Alternatively, a dendritic cell may be pulsed with a non-conjugated immunological partner, separately or in the presence of the polypeptide or vector.
  • an immunological partner e.g., a carrier molecule.
  • a dendritic cell may be pulsed with a non-conjugated immunological partner, separately or in the presence of the polypeptide or vector.
  • the invention provides for delivery of specifically designed short, chemically synthesized epitope-encoded fragments of polypeptide antigens to antigen presenting cells.
  • polypeptide antigens also known as synthetic long peptides (SLPs) provide a therapeutic platform for using the antigenic polypeptides of this invention to stimulate (or load) cells in vitro (Gornati et al., 2018, Front. Imm, 9:1484), or as a method of introducing polypeptide antigen into antigen- presenting cells in vivo (Melief & van der Burg, 2008, Nat Rev Cancer, 8:351 -60).
  • a pharmaceutical composition comprising an antigen-presenting cell of the invention, which is suitably a dendritic cell, together with a pharmaceutically acceptable carrier.
  • a composition may be a sterile composition suitable for parenteral administration. See e.g., disclosure of pharmaceutical compositions supra.
  • an antigen-presenting cell of the invention which is suitably a dendritic cell, for use in medicine.
  • an antigen presenting cell of the invention which is suitably a dendritic cell, or composition comprising said antigen presenting cell of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1 - 10 and immunogenic fragments of any one thereof.
  • compositions comprising an exosome of the invention together with a pharmaceutically acceptable carrier.
  • a composition may be a sterile composition suitable for parenteral administration. See e.g., disclosure of pharmaceutical compositions supra.
  • Compositions may optionally comprise immunostimulants - see disclosure of immunostimulants supra.
  • an exosome of the invention for use in medicine.
  • an exosome of the invention or composition comprising said exosome of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments of any one thereof.
  • the cancer is melanoma particularly cutaneous melanoma.
  • autologous or non-autologous T- cells may be isolated from a subject, e.g., from peripheral blood, umbilical cord blood and/or by apheresis, and stimulated in the presence of a tumor-associated antigens which are loaded onto MHC molecules (signal 1 ) of APC cells, to induce proliferation of T-cells with a TCR immunospecific for this antigen.
  • T-cell activation requires the binding of the costimulatory surface molecules B7 and CD28 on antigen-presenting cells and T-cells, respectively (signal 2). To achieve optimal T-cell activation, both signals 1 and 2 are required. Conversely, antigenic peptide stimulation (signal 1 ) in the absence of costimulation (signal 2) cannot induce full T-cell activation, and may result in T-cell tolerance. In addition to costimulatory molecules, there are also inhibitory molecules, such as CTLA-4 and PD- 1 , which induce signals to prevent T-cell activation.
  • Autologous or non-autologous T-cells may therefore be stimulated in the presence of a polypeptide of the invention, and expanded and transferred back to the patient at risk of or suffering from cancer whose cancer cells express a corresponding polypeptide of the invention provided that the antigen-specific TCRs will recognize the antigen presented by the patient’s MHC, where they will target and induce the killing of cells of said cancer which express said corresponding polypeptide.
  • a polypeptide, nucleic acid, vector or composition of the invention for use in the ex vivo stimulation and/or amplification of T-cells derived from a human suffering from cancer, for subsequent reintroduction of said stimulated and/or amplified T-cells into the said human for the treatment of the said cancer in the said human.
  • the invention provides a method of treatment of cancer in a human, wherein the cells of the cancer express a sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments and variants of any one thereof, which comprises taking from said human a population of white blood cells comprising at least T-cells optionally with antigen-presenting cells, stimulating and/or amplifying said T-cells in the presence of a corresponding polypeptide, nucleic acid, vector or composition of the invention, and reintroducing some or all of said white blood cells comprising at least stimulated and/or amplified T-cells into the human.
  • the cancer is melanoma particularly cutaneous melanoma.
  • a process for preparing a T-cell population which is cytotoxic for cancer cells which express a sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments and variants of any one thereof which comprises (a) obtaining T-cells and antigen-presenting cells from a cancer patient and (ii) stimulating and amplifying the T-cell population ex vivo with a corresponding polypeptide, nucleic acid, vector or composition of the invention.
  • cancer cells express, say, SEQ ID NO. A (A being one of SEQ ID NOs. 1 -10) or a variant or immunogenic fragment thereof then the T-cell population is stimulated and amplified ex vivo with SEQ ID NO. A or a variant or immunogenic fragment thereof in the form of a polypeptide, nucleic acid or vector, or a composition containing one of the foregoing.
  • the culturing and expanding is performed in the presence of dendritic cells.
  • the dendritic cells may be transfected with a nucleic acid molecule or with a vector of the invention and express a polypeptide of the invention.
  • the invention provides a T-cell population obtainable by any of the aforementioned processes (hereinafter a T-cell population of the invention).
  • a cell which is a T-cell which has been stimulated with a polypeptide, nucleic acid, vector or composition of the invention (hereinafter a T-cell of the invention).
  • a pharmaceutical composition comprising a T-cell population or a T-cell of the invention together with a pharmaceutically acceptable carrier.
  • a pharmaceutically acceptable carrier may, for example, be a sterile composition suitable for parenteral administration.
  • T-cell population or T-cell of the invention for use in medicine.
  • a T-cell population of the invention T-cell of the invention or composition comprising said T-cell population or T-cell of the invention for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments of any one thereof.
  • the cancer is melanoma particularly cutaneous melanoma.
  • polypeptide comprises a sequence selected from:
  • polypeptide comprises or consists of a sequence selected from any one of SEQ ID NOs. 1 1 -14, 17-18, 19, 20-22, 30-32, 51 -57, 67-74 and 76-77 and for example the nucleic acid comprises or consists of a sequence selected from any one of SEQ ID NOs. 33, 35, 36 or 40 or selected from any one of 41 , 43, 44, 45 and 50;
  • cancer is uveal melanoma.
  • Derivatives of all types of CLT antigen-binding polypeptides described above, including TCRs or TCR mimetics (see Dubrovsky et al., 2016, Oncoimmunology) that recognize CLT antigen-derived peptides complexed to human HLA molecules, may be engineered to be expressed on the surface of T-cells (autologous or non- autologous), which can then be administered as adoptive T-cell therapies to treat cancer.
  • CARs which, as used herein, may refer to artificial T-cell receptors, chimeric T-cell receptors, or chimeric immunoreceptors, for example, and encompass engineered receptors that graft an artificial specificity onto a particular immune effector cell.
  • CARs may be employed to impart the specificity of a monoclonal antibody onto a T- cell, thereby allowing a large number of specific T-cells to be generated, for example, for use in adoptive cell therapy.
  • CARs may direct specificity of the cell to a tumor associated antigen, a polypeptide of the invention, wherein the polypeptide is HLA- bound.
  • CARs chimeric antigen receptors
  • Such CAR T-cells may be produced by the method of obtaining a sample of cells from the subject, e.g., from peripheral blood, umbilical cord blood and/or by apheresis, wherein said sample comprises T-cells or T-cell progenitors, and transfecting said cells with a nucleic acid encoding a chimeric T-cell receptor (CAR) which is immunospecific for the polypeptide of the invention, wherein the polypeptide is HLA-bound.
  • CAR chimeric T-cell receptor
  • Such nucleic acid will be capable of integration into the genome of the cells, and the cells may be administered in an effective amount the subject to provide a T-cell response against cells expressing a polypeptide of the invention.
  • the sample of cells from the subject may be collected.
  • cells used to produce said CAR-expressing T-cells may be autologous or non-autologous.
  • Transgenic CAR-expressing T-cells may have expression of an endogenous T-cell receptor and/or endogenous HLA inactivated.
  • the cells may be engineered to eliminate expression of endogenous alpha/beta T-cell receptor (TCR).
  • nucleic acids or vectors of the invention expressing the CAR constructs may be introduced into cells using a nucleofection apparatus.
  • the cell population for CAR-expressing T-cells may be enriched after transfection of the cells.
  • the cells expressing the CAR may be sorted from those which do not (e.g., via FACS) by use of an antigen bound by the CAR or a CAR-binding antibody.
  • the enrichment step comprises depletion of the non T-cells or depletion of cells that lack CAR expression.
  • CD56+ cells can be depleted from a culture population.
  • the population of transgenic CAR-expressing cells may be cultured ex vivo in a medium that selectively enhances proliferation of CAR-expressing T- cells. Therefore, the CAR- expressing T-cell may be expanded ex vivo.
  • a sample of CAR cells may be preserved (or maintained in culture). For example, a sample may be cryopreserved for later expansion or analysis.
  • CAR-expressing T-cells may be employed in combination with other therapeutics, for example checkpoint inhibitors including PD-L1 antagonists.
  • a cytotoxic cell that has been engineered to express any of the above antigen-binding polypeptides on its surface.
  • the cytotoxic cell is a T-cell.
  • a cytotoxic cell which is suitably a T-cell, engineered to express any of the above antigen-binding polypeptides on its surface, for use in medicine
  • the invention provides a pharmaceutical composition comprising a cytotoxic cell of the invention, which is suitably a T-cell.
  • the cytotoxic cell of the invention which is suitably a T-cell, is for use in treating or preventing cancer in a human, wherein the cells of the cancer express a corresponding sequence selected from SEQ ID NOs. 1 -10 and
  • immunogenic fragments of any one thereof are immunogenic fragments of any one thereof.
  • Methods of treating cancer according to the invention may be performed in combination with other therapies, especially checkpoint inhibitors and interferons.
  • polypeptides, nucleic acids, vectors, antigen-binding polypeptide and adoptive cell therapies can be used in combination with other components designed to enhance their immunogenicity, for example, to improve the magnitude and/or breadth of the elicited immune response, or provide other activities (e.g., activation of other aspects of the innate or adaptive immune response, or destruction of tumor cells).
  • the invention provides a composition of the invention (i.e. an immunogenic, vaccine or pharmaceutical composition) or a kit of several such compositions comprising a polypeptide, nucleic acid or vector of the invention together with a pharmaceutically acceptable carrier; and (i) one or more further immunogenic or immunostimulant polypeptides (e.g., interferons, IL-12, checkpoint blockade molecules or nucleic acids encoding such, or vectors comprising such nucleic acids), (ii) small molecules (e.g., HDAC inhibitors or other drugs that modify the epigenetic profile of cancer cells) or biologicals (delivered as polypeptides or nucleic acids encoding such, or vectors comprising such nucleic acids) that will enhance the translation and/or presentation of the polypeptide products that are the subject of this invention.
  • immunogenic or immunostimulant polypeptides e.g., interferons, IL-12, checkpoint blockade molecules or nucleic acids encoding such, or vectors comprising
  • Checkpoint inhibitors which block normal proteins on cancer cells, or the proteins on the T-cells that respond to them, may be a particularly important class of drugs to combine with CLT-antigen based therapies, since these inhibitors seek to overcome one of cancer's main defences against an immune system attack.
  • an aspect of the invention includes administering a polypeptide, nucleic acid, vector, antigen-binding polypeptide, composition, T-cell, T-cell population, or antigen presenting cell of the present invention in combination with a checkpoint inhibitor.
  • Example check point inhibitors are selected from PD-1 inhibitors, such as pembrolizumab, (Keytruda) and nivolumab (Opdivo), PD-L1 inhibitors, such as atezolizumab (Tecentriq), avelumab (Bavencio) and durvalumab (Imfinzi) and CTLA- 4 inhibitors such as ipilimumab (Yervoy).
  • Interferons are a family of proteins the body makes in very small amounts. Interferons may slow down or stop the cancer cells dividing, reduce the ability of the cancer cells to protect themselves from the immune system and/or enhance multiple aspects of the adaptive immune system. Interferons are typically administered as a subcutaneous injection in, for example the thigh or abdomen.
  • an aspect of the invention includes administering a polypeptide, nucleic acid, vector, antigen-binding polypeptide or composition of the present invention in combination with interferon e.g., interferon alpha.
  • interferon e.g., interferon alpha.
  • Different modes of the invention may also be combined, for example polypeptides, nucleic acids and vectors of the invention may be combined with an APC, a T-cell or a T-cell population of the invention (discussed infra).
  • One or more modes of the invention may also be combined with conventional anti-cancer chemotherapy and/or radiation.
  • the invention provides methods for using one or more of the polypeptides or nucleic acid of the invention to diagnose cancer, particularly melanoma e.g. cutaneous melanoma, or to diagnose human subjects suitable for treatment by polypeptides, nucleic acids, vectors, antigen-binding polypeptides, adoptive cell therapies, or compositions of the invention.
  • the invention provides a method of diagnosing that a human suffering from cancer, comprising the steps of: determining if the cells of said cancer express a polypeptide sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments or variants of any one thereof (e.g. selected from the sequences of SEQ ID NOs. 11 -32 and 51 -78); or a nucleic acid encoding said polypeptide sequence (e.g. selected from the sequences of SEQ ID NOs. 33-40 and SEQ ID NOs. 41-50), and diagnosing said human as suffering from cancer if said polypeptide or corresponding nucleic acid is overexpressed in said cancer cells.
  • a polypeptide sequence selected from SEQ ID NOs. 1 -10 and immunogenic fragments or variants of any one thereof e.g. selected from the sequences of SEQ ID NOs. 11 -32 and 51 -78
  • a nucleic acid encoding said polypeptide sequence e.g. selected from the sequences of SEQ ID NOs.
  • the invention provides a method of diagnosing that a human suffering from cancer which is cutaneous melanoma, comprising the steps of: determining if the cells of said cancer express a polypeptide sequence selected from SEQ ID NO. 2, 6, 7, 8 and 9 and immunogenic fragments or variants thereof; or a nucleic acid encoding said polypeptide sequence, and diagnosing said human as suffering from cancer which is cutaneous melanoma if said polypeptide or corresponding nucleic acid is overexpressed in said cancer cells.
  • “overexpressed” in cancer cells means that the level of expression in cancer cells is higher than in normal cells.
  • the invention provides a method of diagnosing that a human suffering from cancer which is cutaneous melanoma or uveal melanoma, comprising the steps of: determining if the cells of said cancer express a polypeptide sequence selected from SEQ ID Nos. 1 , 3, 4, 5 and 10 and immunogenic fragments or variants of any one thereof; or a nucleic acid encoding said polypeptide sequence, and diagnosing said human as suffering from cancer which is cutaneous melanoma or uveal melanoma if said polypeptide or corresponding nucleic acid is overexpressed in said cancer cells.
  • the overexpression can be determined by reference to the level of the nucleic acid or polypeptide of the invention in a control human subject known not to have the cancer. Thus overexpression indicates that the nucleic acid or polypeptide of the invention is detected at a significantly higher level (e.g., a level which is 30%, 50% , 100% or 500% higher) in the test subject than in the control subject. In case the control human subject has an undetectable level of the nucleic acid or polypeptide of the invention, then the diagnosis can be arrived at by detecting the nucleic acid or polypeptide of the invention.
  • a significantly higher level e.g., a level which is 30%, 50% , 100% or 500% higher
  • the invention also provides a method of treating a human suffering from cancer, comprising the steps of:
  • polypeptide comprising a sequence selected from:
  • an immunogenic fragment of the sequences of (a) isolated from the tumor of a human suffering from cancer, or use of a nucleic acid encoding said polypeptide, as a biomarker for the determination of whether said human would be suitable for treatment by a vaccine comprising a corresponding polypeptide, nucleic acid, vector, composition, T-cell population, T-cell, antigen presenting cell, antigen-binding polypeptide or cytotoxic cell of the invention.
  • the cancer is melanoma particularly cutaneous melanoma.
  • the invention also provides a method or use according to the invention wherein the polypeptide comprises a sequence selected from: (a) the sequence of any one of SEQ ID NOs. 1 , 3, 4, 5 and 10; and
  • polypeptide comprises or consists of a sequence selected from any one of SEQ ID NOs. 11 -14, 17-18, 19, 20-22, 30-32, 51-57, 67-74 and 76-77 and for example the nucleic acid comprises or consists of a sequence selected from any one of SEQ ID NOs. 33, 35, 36 or 40 or selected from any one of 41 , 43, 44, 45 and 50;
  • cancer is uveal melanoma.
  • polypeptide of the invention has a sequence selected from SEQ Id NOs. 1 -10 or a fragment thereof, such as an immunogenic fragment thereof (e.g. selected from the sequences of SEQ ID NOs. 11 -32 and 51-78).
  • nucleic acid of the invention has or comprises a sequence selected from any one of SEQ ID NOs.33-40 or 41 -50 or a fragment thereof, such as an immunogenic fragment thereof.
  • kits for detecting the presence of nucleic acids are well known.
  • kits comprising at least two oligonucleotides which hybridise to a
  • polynucleotide may be used within a real-time PCR (RT-PCR) reaction to allow the detection and semi-quantification of specific nucleic acids.
  • RT-PCR real-time PCR
  • kits may allow the detection of PCR products by the generation of a fluorescent signal as a result of Forster Resonance Energy Transfer (FRET) (for example TaqMan® kits), or upon binding of double stranded DNA (for example, SYBR® Green kits).
  • FRET Forster Resonance Energy Transfer
  • Some kits (for example, those containing TaqMan® probes whch span the exons of the target DNA) allow the detection and quanitfication of mRNA, for example transcripts encoding nucleic acids of the invention.
  • Assays using certain kits may be set up in a multiplex format to detect multiple nucleic acids simultaneously within a reaction. Kits for the detection of active DNA (namely DNA that carries specific epigenetic signatures indicative of expression) may also be used. Additional components that may be present within such kits
  • Nucleic acids of the invention may also be detected via liquid biopsy, using a sample of blood from a patient. Such a procedure provides a non-invasive alternative to surgical biopsies. Plasma from such blood samples may be isolated and analysed for the presence of nucleic acids of the invention.
  • Polypeptides of the invention may be detected by means of antigen-specific antibodies in an ELISA type assay to detect polypeptides of the invention in homogenized preparations of patient tumor samples.
  • polypeptides of the invention may be detected by means of immunohistochemical analyses, which identify the presence of the polypeptide antigens by using light microscopy to inspect sections of patient tumor samples that have been stained by using approproiately labeled antibody preparations.
  • polypeptides of the invention may be detected by means of immunohistochemical analyses, which identify the presence of the polypeptide antigens by using light microscopy to inspect sections of patient tumor samples that have been stained by using approproiately labeled antibody preparations.
  • Polypeptides of the invention may also be detected by determining whether they are capable of stimulating T-cells raised against the said polypeptide.
  • Cells of the cancer or tumor e.g., the melanoma e.g. cutaneous melanoma may for example be obtained from a biopsy of the cancer e.g., the melanoma e.g. cutaneous melanoma.
  • a method of treatment of cancer, particularly melanoma e.g. cutaneous melanoma, in a human comprises (i) detecting the presence of a nucleic acid or polypeptide according to the invention and (ii) administering to the subject a nucleic acid, polypeptide, vector, cell, T-cell or T-cell population or composition according to the invention (and preferably administering the same nucleic acid or polypeptide or fragment thereof that has been detected).
  • a method of treatment of cancer, particularly melanoma e.g. cutaneous melanoma, in a human also comprises administering to the subject a nucleic acid, polypeptide, vector, cell, T-cell or T-cell population or composition according to the invention, in which subject the presence of a (and preferably the same) nucleic acid or polypeptide according to the invention has been detected.
  • the cancer to be diagnosed and if appropriate treated is melanoma e.g. cutaneous melanoma.
  • the cancer might be cutaneous melanoma or uveal melanoma.
  • the CLT antigen polypeptide comprises or consists of SEQ ID NO. 1.
  • Exemplary fragments comprise or consist of any one of SEQ ID NOs. 11 - 14.
  • Further exemplary fragments comprise two, three or four of SEQ ID NOs. 11 -14.
  • Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 55-57 or 73-74.
  • Further exemplary fragments comprise all of SEQ ID NOs. 11 -14, 55-57 and 73-74 (allowance being taken for possible sequence overlap so that any overlapping sequence does not need to be present more than once).
  • Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO 33 or SEQ ID NO. 41.
  • Corresponding nucleic acids e.g., DNA or RNA
  • T- cells e.g., DNA or RNA
  • T-cell populations e.g., cytocotic cells
  • antigen-binding polypeptides e.g., antigen presenting cells and exosomes as described supra
  • Said nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes
  • cytotoxic cells e.g. cutaneous melanoma or uveal melanoma.
  • the CLT antigen polypeptide comprises or consists of SEQ ID NO. 2.
  • Exemplary fragments comprise or consist of SEQ ID NO. 15 or SEQ ID NO. 16.
  • Further exemplary fragments comprise SEQ ID NO. 15 and SEQ ID NO. 16.
  • Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 58-66, 75 and 78.
  • Further exemplary fragments comprise all of SEQ ID NOs. 15-16, 58-66, 75 and 78 (allowance being taken for possible sequence overlap so that any overlapping sequence does not need to be present more than once).
  • Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 34 or SEQ ID NO. 42.
  • Corresponding nucleic acids e.g., DNA or RNA
  • T- cells e.g., DNA or RNA
  • T-cell populations e.g., cytocotic cells
  • antigen-binding polypeptides e.g., antigen presenting cells and exosomes as described supra
  • Said nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes
  • melanoma e.g. cutaneous melanoma.
  • Related methods of diagnosis are also provided.
  • the CLT antigen polypeptide comprises or consists of SEQ ID NO. 3.
  • Exemplary fragments comprise or consist of SEQ ID NO. 17 or SEQ ID NO. 18.
  • Further exemplary fragments comprise SEQ ID NO. 17 and SEQ ID NO.
  • nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 35 or SEQ ID NO. 43.
  • Corresponding nucleic acids e.g., DNA or RNA
  • T- cells T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided.
  • Said nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations
  • cytotoxic cells e.g., IL-12
  • antigen-binding polypeptides e.g., IL-12
  • exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma or uveal melanoma.
  • the CLT antigen polypeptide comprises or consists of SEQ ID NO. 4.
  • Exemplary fragments comprise or consist of SEQ ID NO. 19.
  • Further exemplary fragments comprise or consist of SEQ ID NO. 51 or SEQ ID NO. 52.
  • Further exemplary fragments comprise or consist of SEQ ID NO. 54.
  • Further exemplary fragments comprise or consist of any one of SEQ ID NOs. 70-72 and 76- 77.
  • Further exemplary fragments comprise SEQ ID NO. 19 and either SEQ ID NO. 51 or SEQ ID NO. 52.
  • Further exemplary fragments comprise SEQ ID NO. 54 and either SEQ ID NO. 51 or SEQ ID NO. 52.
  • Further exemplary fragments comprise all of SEQ ID NOs.
  • nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 35 or SEQ ID NO. 44.
  • Corresponding nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided.
  • Said nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations
  • cytotoxic cells e.g., IL-12
  • antigen-binding polypeptides e.g., IL-12
  • exosomes e.g., IL-12 presenting cells and exosomes
  • melanoma e.g. cutaneous melanoma or uveal melanoma.
  • Related methods of diagnosis are also provided.
  • the CLT antigen polypeptide comprises or consists of SEQ ID NO. 5.
  • Exemplary fragments comprise or consist of any one of SEQ ID NOs. 20- 22.
  • Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 36 or SEQ ID NO. 45.
  • Corresponding nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided.
  • Said nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations
  • cytotoxic cells e.g., IL-12
  • antigen-binding polypeptides e.g., IL-12
  • exosomes e.g., IL-12 presenting cells and exosomes
  • melanoma e.g. cutaneous melanoma or uveal melanoma.
  • Related methods of diagnosis are also provided.
  • the CLT antigen polypeptide comprises or consists of SEQ ID NO. 6.
  • Exemplary fragments comprise or consist of SEQ ID NO. 23 or SEQ ID NO. 24.
  • Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 37 or SEQ ID NO. 46.
  • Corresponding nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations, cytocotic cells, antigen-binding
  • polypeptides, antigen presenting cells and exosomes as described supra are provided.
  • Said nucleic acids e.g., DNA or RNA
  • T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma.
  • Related methods of diagnosis are also provided.
  • the CLT antigen polypeptide comprises or consists of SEQ ID NO. 7.
  • Exemplary fragments comprise or consist of SEQ ID NO. 25.
  • Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 38 or SEQ ID NO. 47.
  • Corresponding nucleic acids e.g., DNA or RNA
  • T- cells T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided.
  • Said nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations
  • cytotoxic cells e.g., IL-12
  • antigen-binding polypeptides e.g. IL-12
  • exosomes e.g., IL-12 presenting cells and exosomes
  • cancer especially melanoma e.g. cutaneous melanoma.
  • Related methods of diagnosis are also provided.
  • the CLT antigen polypeptide comprises or consists of SEQ ID NO. 8.
  • Exemplary fragments comprise or consist of SEQ ID NO. 26.
  • Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 38 or SEQ ID NO. 48.
  • Corresponding nucleic acids e.g., DNA or RNA
  • T- cells T-cell populations, cytocotic cells, antigen-binding polypeptides, antigen presenting cells and exosomes as described supra are provided.
  • Said nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations
  • cytotoxic cells e.g., IL-12
  • antigen-binding polypeptides e.g. IL-12
  • exosomes e.g., IL-12 presenting cells and exosomes
  • cancer especially melanoma e.g. cutaneous melanoma.
  • Related methods of diagnosis are also provided.
  • the CLT antigen polypeptide comprises or consists of SEQ ID NO. 9.
  • Exemplary fragments comprise or consist of any one of SEQ ID NOs. 27- 29.
  • Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 39 or SEQ ID NO. 49.
  • Corresponding nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations, cytotoxic cells, antigen-binding
  • polypeptides, antigen presenting cells and exosomes as described supra are provided.
  • Said nucleic acids e.g., DNA or RNA
  • T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma.
  • Related methods of diagnosis are also provided.
  • the CLT antigen polypeptide comprises or consists of SEQ ID NO. 10.
  • Exemplary fragments comprise or consist of any one of SEQ ID NOs. 30-32.
  • Exemplary nucleic acids encoding said polypeptide sequence comprise or consists of SEQ ID NO. 40 or SEQ ID NO. 50.
  • Corresponding nucleic acids e.g., DNA or RNA
  • T-cells T-cell populations
  • cytocotic cells antigen-binding
  • polypeptides, antigen presenting cells and exosomes as described supra are provided.
  • Said nucleic acids e.g., DNA or RNA
  • T-cells, T-cell populations, cytotoxic cells, antigen-binding polypeptides, antigen presenting cells and exosomes may be used in the treatment of cancer especially melanoma e.g. cutaneous melanoma or uveal melanoma.
  • melanoma e.g. cutaneous melanoma or uveal melanoma.
  • Related methods of diagnosis are also provided.
  • the objective was to identify cancer-specific transcripts that entirely or partially consist of LTR elements.
  • RNA-sequencing reads from 768 patient samples obtained from The Cancer Genome Atlas (TCGA) consortium and representing a wide variety of cancer types (24 gender-balanced samples from each of 32 cancer types (31 primary and 1 metastatic melanoma); Table S1 ), were used for genome- guided assembly.
  • TCGA Cancer Genome Atlas
  • FIMMs hidden Markov models representing known Human repeat families (Dfam 2.0 library v150923) were used to annotate GRCh38 using RepeatMasker Open-3.0 (Smit, A., R. Hubley, and P. Green,
  • HMM-based scanning increases the accuracy of annotation in comparison with BLAST-based methods (Hubley et al. , 2016, Nuc.
  • TPM Transcripts per million
  • Transcripts were considered expressed specifically in cancer if detected at more than 1 TPM in any sample and as cancer- specific if the following criteria were fulfilled: i, expressed in >6 of the 24 samples of each cancer type; ii, expressed at ⁇ 10 TPM in >90% of all healthy tissue samples; iii, expressed in the cancer type of interest >3* the median expression in any control tissue type; and iv, expressed in the cancer type of interest >3* the 90th percentile of the respective healthy tissue, where available. In addition to these expression thresholds, transcript selection was based on manual inspection, excluding
  • transcripts corresponding to both strands were considered.
  • the list of cancer-specific transcripts was then intersected with the list of transcripts containing complete or partial LTR elements to produce a list of 5,923 transcripts that fulfilled both criteria (referred to as CLTs for Cancer-specific LTR element-spanning Transcripts).
  • cutaneous melanoma and uveal melanoma samples in TGCA according to the above methodology.
  • Four of these cutaneous melanoma specific CLTs are identified herein as having SEQ ID NO. 34, 37, 38 and 39.
  • Four of these cutaneous melanoma and uveal melanoma specific CLTs are identified herein as having SEQ ID NOs. 33, 35, 36 and 40.
  • Immunopeptidomic analysis is a powerful technology that allows the direct detection of specific peptides associated with HLA molecules in cells or tissues.
  • the technique consists of affinity purification of HLA molecules from biological samples, and then elution of bound peptides from the HLA molecules and evaluation of the peptides by nano-ultra performance liquid chromatography mass spectrometry (nUPLC-MS 2 ) (Freudenmann et al. , 2018, Immunology 154(3):331 -345).
  • nUPLC-MS 2 nano-ultra performance liquid chromatography mass spectrometry
  • MS mass spectrometry
  • the peptide sequences from all possible ORFs encoded by each CLT were concatenated into a single peptide file for each CLT, or not, and these concatenated files (analysis A) or single peptide files (analysis B) were used to interrogate the raw spectra in the PXD004894 dataset, alongside all polypeptides found in the human proteome (UniProt (analysis A) or UniProt and masDB (analysis B)), by using the PeaksTM software (analysis A) or the Mascot software (analysis B).
  • analysis A the results of these studies identified 14 peptides that were associated with the HLA Class I molecules immunoprecipitated from tumor samples from the 25 patients examined by Bassani-Sternberg et al. , which can be attributed to 8 ORFs that were not found in the reported proteome (see Table 1 ).
  • analysis B the results of these studies identified 14 peptides that were associated with the HLA Class I molecules or HLA Class II molecules immunoprecipitated from tumor samples from the 25 patients examined by Bassani-Sternberg et al., which can be attributed to 7 ORFs that were not found in the reported proteome (see Table 2).
  • Tables 1 and 2 were assessed to determine the predicted strength of binding to HLA Class I supertypes. Specifically, all HLA Class l-associated peptides referenced in Table 3 that were 9 amino acids or longer were interrogated by using the NetMHC 4.0 prediction software (http://www.cbs.dtu.dk/services/NetMHC/) to predict their binding to HLA Class I type A and B supertypes. The results of these prediction studies showed that all 1 1 peptides (or 9-mers derived from them) were predicted to bind to at least one of the supertypes tested (see Table 3). Amongst these, many of sequences were predicted to bind with high confidence (low %rank scores) to specific types within the HLA Class I supertypes examined.
  • CLT antigens polypeptides (SEQ ID NOs. 1 -10; referred to as CLT antigens) in tumor tissue. These are then processed by the immune surveillance apparatus of the cells, and loaded onto FILA Class I or HLA Class II molecules, enabling the cell to be targeted for cytolysis by T- cells that recognize the resulting peptide/HLA Class I or peptide/HLA Class II complexes.
  • CLT antigens and fragments of them are expected to be useful in a variety of therapeutic modalities for the treatment of melanoma in patients whose tumors express these antigens.
  • Table 1 List of peptides identified by immunopeptidomic analyses (analysis A) of SKCM tumor samples, along with CLT antigen name and cross reference to SEQ ID NOs.
  • PeaksTM program Area from mass spectrum selected Area values are shown for peptides for which more than one spectrum was obtained.
  • Table 2 List of peptides identified by immunopeptidomic analyses (analysis B) of SKCM tumor samples, along with CLT antigen name and cross reference to SEQ ID NOs.
  • Table 3 Predicted NetMHC 4.0 binding of Mass Spectrometry-identified peptides (length > 9 residues) to 12 HLA Class I Supertype Alleles (HLA-A0101 , HLA-A0201 , HLA-A0301 , HLA- A2402, HLA-A2601 , HLA-B0702, HLA-B0801 , HLA-B1501 , HLA-B2705, HLA-B3901 , HLA- B4001 , HLA-B5801), along with CLT antigen name and cross reference to SEQ ID NOs.
  • Example 2 In addition to the analyses described in Example 2, the inventors have also identified peptides derived from the predicted ORFs through new immunopeptidomic studies. This additional work, described below, further demonstrates that these CLTs are translated into CLT Antigen polypeptides in tumor tissue.
  • the inventors procured frozen tumor tissue from 10 patients diagnosed with melanoma. Samples between 0.05-1 g were homogenized, the lysate was centrifugate at high speed and the cleared lysate was mixed with protein A (ProA) beads covalently linked to an anti-human HLA class I monoclonal antibody
  • the purified, eluted peptides were subjected to nUPLC-MS, and specific peptides of defined charge-to-mass ratio (m/z) were selected within the mass spectrometer, isolated, fragmented, and subjected to MS/MS to reveal the m/z of the resulting fragment ions (Ternette et al., 2018), producing an MS/MS dataset corresponding to the
  • Table 4 shows the properties of the peptides found in the CLT antigens.
  • Figures 33-42 show representative MS/MS spectra from each of the peptides shown in Table 4.
  • the top panel of each of these figures shows the MS/MS peptide fragment profile, with standard MS/MS annotations (b: N-terminal fragment ion; y: C-terminal fragment ion; -H2O: water loss; -NH3: loss of ammonia; [2+]: doubly charged peptide ion; pre:
  • the inventors processed 37 normal tissue samples (10 normal skin, 9 normal lung and 18 normal breast tissue) and prepared for immunopeptidomic analysis. The inventors interrogated the spectra of the FILA-Class I dataset from these normal tissue samples, searching for all possible peptide sequences derived from the polypeptide sequences of CLT antigens no.1 , 2, 3 and 4. No peptides derived from CLT antigens no. 1 , 2, 3 and 4 were detected in the set of normal tissue samples (Table 6) providing additional confirmation that the CLTs have cancer-specific expression.
  • Table 4 List of peptides identified by additional immunopeptidomic analyses of melanoma tumor samples, along with CLT antigen name and cross reference to SEQ ID NOs.
  • PeaksTM program Area from mass spectrum selected Area values are shown for peptides for which more than one spectrum was obtained.
  • Table 5 Predicted NetMHC 4.0 binding of Mass Spectrometry-identified peptides (length > 9 residues) to 12 HLA Class I Supertype Alleles (HLA-A0101 , HLA-A0201 , HLA-A0301 , HLA- A2402, HLA-A2601 , HLA-B0702, HLA-B0801 , HLA-B1501 , HLA-B2705, HLA-B3901 , HLA- B4001 , HLA-B5801), along with CLT antigen name and cross reference to SEQ ID NOs.
  • T-cell receptor TCR
  • TCRseq to tumor tissues in the same patient can also be used to demonstrate if TCRs/T-cells detected in the ex vivo, peptide-stimulated cultures are also present within the tumor- infiltrating lymphocytes found in cancer tissues in situ.
  • MANAFEST has proven to be a powerful technology for identifying MANA epitopes that are recognized by patient T-cells, permitting identification of functionally relevant MANA peptides among the multitude of mutant peptides found by whole-exome sequencing of normal and tumor tissues from cancer patients (Le et al. , Science 2017; Forde et al. , NEJM 2018; Danilova et al., Cancer Immunol. Res. 2018; Smith et al., J Immunother Cancer 2019).
  • Step 1 Peptides predicted to contain epitopes that efficiently bind selected HLA Class I alleles were identified in CLT Antigens.
  • Step 2 PBMCs from suitable melanoma patients were matched by HLA Class I type to the peptide library selected in step 1.
  • Step 3 PBMCs from these patients were separated into T-cell and non T-cell fractions.
  • Non T-cells were added back to the patient’s T-cells, and then divided into 20-50 wells (containing 250,000 T- cells per culture) and propagated with various T-cell growth factors and individual CLT Antigen-derived synthetic peptides (selected in step 1/2) for 10 days.
  • Step 4 TCRseq (sequencing of the TCR- /b CDR3 sequences) was performed on all wells, and TCR-nb CDR3 sequences that were amplified in the presence of individual CLT Antigen-derived peptides (but not amplified in the presence of control peptides or in the absence of peptide stimulation) were identified.
  • TCRseq may also be performed on tumor samples to determine whether the T-cells bearing the CLT-Antigen amplified TCRs homed to patient tumors, providing additional evidence that T-cells bearing these TCRs recognize CLT Antigen-derived peptides within a patient’s tumor.
  • HERVFEST assays were performed with peptides derived from CLT Antigens 1 -4 (SEQ ID NOs 1-4).
  • the panel of peptides (see step 1 above) used for these studies was based on NetMHC predictions of CLT Antigen-derived peptides that were predicted to strongly bind the 8 HLA Class I types commonly found in patient tumor samples available for our analyses.
  • CLT Antigen-derived peptides that amplified one or more TCRs in these HERVFEST assays are provided in Table 7.
  • Table 7 also indicates the HLA Class I type(s) of the CLT antigen peptides that were tested with each patient’s PBMC-derived cultures.
  • the HLA Class I type of the patients whose PBMCs were tested in these studies and amplified one or more TCRs in the assays, are shown in Table 8.
  • Figure 51 panel A shows published data demonstrating TCR amplification with NSCLC patient-specific MANA peptides (Forde et al. , NEJM 2018).
  • the vertical axis shows the prevalence of each indicated TCR-nb CDR3 sequence for wells of cells cultivated in the presence of the MANA or control peptides listed on the horizontal axis.
  • the amplification in the well containing MANA7 indicates the patient’s T-cell repertoire include T-cells that are reactive to this peptide.
  • Panels B and C of Figure 51 show representative TCR amplification data from PBMCs from 2 melanoma patients that were incubated in the presence of the indicated CLT Antigen peptides and control peptides.
  • Panel B shows the frequency of TCRs detected in the LMSSFSTLASL-stimulated well of PBMCs from melanoma patient 222B in all wells stimulated with the panel 15 HLA Class I A*02 peptides from CLT Antigens 1 , 2 & 4.
  • LMSSFSTLASL SEQ ID NO. 61
  • Panel C shows the frequency of TCRs detected in the
  • MVACRIKTFR SEQ ID NO. 64 is an A * 03 binding peptide derived from CLT Antigen 2.
  • FIG 52 shows a summary of all CLT Antigen peptides for CLT Antigens 1 -4 which amplified one or more TCRs in studies completed with these patients.
  • Each panel displays the amino acid sequences of CLT Antigens 1 -4 overlaid with peptides detected by immunopeptidomic analyses (denoted by dashed_un_derljne_d or bold text; see Examples 2 & 2.1 ).
  • the FIERVFEST-detected peptides are displayed with the number of the melanoma patient in which they were detected (Table 8) and the targeted FILA Class I type.
  • Table 7 CLT Antigen-derived peptides that amplified one or more TCRs in HERVFEST assays
  • Table 8 Characteristics of the melanoma patient PBMCs used in HERVFEST assays
  • An ELISPOT assay may be used to show that CLT antigen-specific CD8 T- cells are present in the normal T-cell repertoire of healthy individuals, and thus have not been deleted by central tolerance due to the expression of cancer-specific CLT antigens in naive and thymic tissues in these patients.
  • This type of ELISPOT assay comprises multiple steps. Step 1 : CD8 T-cells and CD14 monocytes can be isolated from the peripheral blood of normal blood donors, these cells are HLA typed to match the specific CLT antigens being tested. CD8 T-cells can be further sub-divided into naive and memory sub-types using magnetically labelled antibodies to the memory marker CD45RO.
  • Step 2 CD14 monocytes are pulsed with individual or pooled CLT antigen peptides for three hours prior to being co-cultured with CD8 T- cells for 14 days.
  • Step 3 Expanded CD8 T-cells are isolated from these cultures and re-stimulated overnight with fresh monocytes pulsed with peptides.
  • These peptides may include; individual CLT antigen peptides, irrelevant control peptides or peptides known to elicit a robust response to infectious (e.g., CMV, EBV, Flu, HCV) or self (e.g. Mart-1 ) antigens.
  • Re-stimulation is performed on anti-lnterferon gamma (IFNy) antibody-coated plates.
  • IFNy anti-lnterferon gamma
  • the antibody captures any IFNy secreted by the peptide- stimulated T-cells. Following overnight activation, the cells are washed from the plate and IFNy captured on the plate is detected with further anti- IFNy antibodies and standard colorimetric dyes. Where IFNy -producing cells were originally on the plate, dark spots are left behind. Data derived from such assays includes spot count, median spot size and median spot intensity. These are measures of frequency of T- cells producing IFNy and amount of IFNy per cell. Additionally, a measure of the magnitude of the response to the CLT antigen can be derived from the stimulation index (SI) which is the specific response, measured in spot count or median spot size, divided by the background response to monocytes with no specific peptide.
  • SI stimulation index
  • a metric of stimulation strength is derived by multiplying the stimulation index for spot number by the stimulation index for spot intensity.
  • comparisons of the responses to CLT antigens and control antigens can be used to demonstrate that naive subjects contain a robust repertoire of CLT antigen-reactive T-cells that can be expanded by vaccination with CLT antigen-based immunogenic formulations.
  • Table 9 provides a list of CLT Antigen-derived peptides that induced significant CD8 T-cell responses from HLA-matched normal blood donors. The results are shown in
  • Figure 53 shows significant CD8 T-cell responses from a normal blood donor to HLA-A*0201 -restricted peptides from CLT Antigen 1 (CLT001 in the figure).
  • the example shown in Figure 54 demonstrates CD8 responses from a normal donor to a peptide derived from CLT Antigen 2 (CLT002 in the figure) also restricted by HLA-A*0201.
  • Figure 55 shows significant CD8 T-cell responses from a normal blood donor to an HLA-A*0201 -restricted peptide from CLT Antigen 4 (CLT004 in the Figure).
  • Figure 56 shows a lack of response to HLA-B*0702 restricted peptides from CLT Antigens 1 and 4 (CLT001 and CLT004 in the figure) in memory CD45RO-positive CD8 T-cells (panels A and C).
  • CD45RO-positive CD8 T-cells panels A and C.
  • Naive CD45RO-negative CD8 T-cells from the same donor respond significantly to peptides from both CLT001 and CLT004 ( Figure 56, panels B and D).
  • CD8 T-cells isolated from healthy donor or patient blood are expanded using various cultivation methods, for example anti-CD3 and anti- CD28 coated microscopic beads plus lnterleukin-2. Expanded cells can then be stained for specific CLT antigen-reactivity of their T-cell receptors using CLT peptide pentamers, which consist of pentamers of HLA Class I molecules bound to the relevant CLT Antigen peptide in the peptide-binding groove of the HLA molecule. Binding is measured by detection with phycoerythrin or allophycocyanin-conjugated antibody fragments specific for the coiled-coil multimerisation domain of the pentamer structure.
  • CLT peptide pentamers consist of pentamers of HLA Class I molecules bound to the relevant CLT Antigen peptide in the peptide-binding groove of the HLA molecule. Binding is measured by detection with phycoerythrin or allophycocyanin-conjugated antibody fragments specific for
  • Pentamer stained cells may also be sorted and purified using a fluorescence activated cell sorter (FACS). Sorted cells may then be further tested for their ability to kill target cells in in vitro killing assays. These assays comprise a CD8 T-cell population, and a fluorescently labelled target cell population. In this case, the CD8 population is either CLT antigen-specific or CD8 T-cells pentamer-sorted and specific for a positive-control antigen known to induce a strong killing response such as Mart-1.
  • FACS fluorescence activated cell sorter
  • the target cells for these studies may include peptide-pulsed T2 cells which express HLA-A*02, peptide-pulsed C1 R cells transfected with HLA-A*02,03 or B*07 or melanoma cells lines previously shown to express the CLTs/CLT antigens, or patient tumor cells.
  • Peptides used to pulse the T2 or C1 R cells include CLT antigen peptides or positive control peptides.
  • Target cells may be fluorescently labelled with carboxyfluorescein succinimidyl ester (CFSE, a cell proliferation dye) and death is indicated by take up of 7AAD.
  • CFSE carboxyfluorescein succinimidyl ester
  • CLT antigen-specific CD8 T-cells can be used to enumerate the cytotoxic activity of CLT- antigen-specific T-cells in ex vivo cultures of melanoma patient or healthy donor T- cells.
  • Figure 57 shows HLA pentamer staining of healthy donor CD8 T-cells with peptides-derived from CLT Antigens 1 , 2 and 4 (CLT001 , CLT002 and CLT004 in the figure).
  • Figure 58 shows expanded CLT004 pentamer sorted cells killing CLT004- pulsed C1 R-B7 target cells. Significant killing of peptide-pulsed C1 R-B7 cells is apparent at 3:1 and 1 :1 effector to target cells ratios.
  • mice can be inoculated with replication-defective adenovirus vectors expressing one or more CLT antigens, and T-cells obtained from these mice can be tested for the presence of CLT antigen- specific T-cells using IFNy ELISPOT assays (Mennuni et al. , Int.J. Cancer, 2005).
  • mice are inoculated with CLT antigen-expressing recombinant adenoviruses, and at a suitable timepoint they are humanely euthanized, and preparations of spleen cells are loaded into wells of a multiwell dish derivatized with monoclonal antibodies to murine IFNy, in the presence (or absence) of overlapping peptides corresponding to the CLT antigen. Following a suitable time, the immobilized IFNy is stained with a different monoclonal antibody, permiting innumeration of the
  • Example 7 Assays to validate CLT expression in melanoma cells
  • Quantiative real-time polymerase chain reaction is a widespread technique to determine the amount of a particular transcript present in RNA extracted from a given biological sample.
  • Specific nucleic acid primer sequences are designed against the transcript of interest, and the region between the primers is subeqeuntly amplified through a series of thermocyle reactions and fluorescently quantified through the use of intercalating dyes (SYBR Green).
  • SYBR Green intercalating dyes
  • melanoma cell lines COLO 829 (ATCC reference CRL-1974), MeWo (ATCC reference HTB-65), SH-4 (ATCC reference CRL-7724) and control cell lines HepG2 (hepatocellular carcinoma, ATCC reference HB-8065), Jurkat (T-cell leukemia,
  • qRT-PCR analysis WITH SYBR Green detection following standard techniques was performed with primers designed against two regions of each CLT, and reference genes. Relative quantification (RQ) was calculated as:
  • RQ 2[Ct(REFERENCE)-Ct(TARGET)].
  • Panel A shows results from a qRT-PCR assay with two primer sets (1 +2 and 3+4) targeting different regions of the CLT encoding CLT Antigen 1 (SEQ ID 33) on RNA extracted from three melanoma cell lines and four non-melanoma cell lines.
  • Panel B shows results from qRT-PCR assay with two primer sets (5+6 and 7+8) targeting different regions of the CLT encoding CLT Antigen 2 (SEQ ID 34) on RNA extracted from three melanoma cell lines and four non-melanoma cell lines.
  • Panel C shows results from qRT-PCR assay with two primer sets (9+10 AND 11 +12) targeting different regions of the CLT encoding CLT Antigens 3/4 (SEQ ID 35) on RNA extracted from three melanoma cell lines and four non-melanoma cell lines. These results confirmed the specific expression of CLTs in RNA extracted from melanoma cell lines, compared to non-melanoma cells. The CLTs were detected in each of the melanoma cell lines tested. b) RNAScope validation of CLT expression in melanoma cells in situ
  • ISH In situ hybridisation
  • RNAScope probes were designed against the CLTs and assayed on sections of 12 formalin-fixed, paraffin-embedded cutaneous melanoma tumour cores. Scoring of the expression signal was performed on representative images from each core as follows:
  • the invention embraces all combinations of preferred and more preferred groups and suitable and more suitable groups and embodiments of groups recited above.
  • SEQ ID NO. 1 Polypeptide sequence of CLT Antigen 1
  • SEQ ID NO. 2 Polypeptide sequence of CLT Antigen 2
  • SEQ ID NO. 3 Polypeptide sequence of CLT Antigen 3
  • SEQ ID NO. 4 Polypeptide sequence of CLT Antigen 4
  • SEQ ID NO. 5 Polypeptide sequence of CLT Antigen 5
  • SEQ ID NO. 6 Polypeptide sequence of CLT Antigen 6
  • SEQ ID NO. 7 Polypeptide sequence of CLT Antigen 7
  • SEQ ID NO. 8 Polypeptide sequence of CLT Antigen 8
  • SEQ ID NO. 9 Polypeptide sequence of CLT Antigen 9) MGSSRVGERMMEEESRTGQKVNPGNTGKLFVGVGISRIAKVKYGECGQGFSDKS
  • SEQ ID NO. 10 Polypeptide sequence of CLT Antigen 10
  • SEQ ID NO. 11 (peptide sequence derived from CLT Antigen 1 )
  • SEQ ID NO. 12 (peptide sequence derived from CLT Antigen 1 )
  • SEQ ID NO. 13 (peptide sequence derived from CLT Antigen 1 )
  • SEQ ID NO 14 (peptide sequence derived from CLT Antigen 1 )
  • SEQ ID NO. 15 (peptide sequence derived from CLT Antigen 2)
  • SEQ ID NO. 16 (peptide sequence derived from CLT Antigen 2)
  • SEQ ID NO. 17 (peptide sequence derived from CLT Antigen 3)
  • SEQ ID NO. 18 (peptide sequence derived from CLT Antigen 3)
  • SEQ ID NO. 19 (peptide sequence derived from CLT Antigen 4)
  • KTKGSLSVFR SEQ ID NO. 20 (peptide sequence derived from CLT Antigen 5) RVADIPIKP W
  • SEQ ID NO. 22 (peptide sequence derived from CLT Antigen 5) RVADIPIKP
  • SEQ ID NO. 23 (peptide sequence derived from CLT Antigen 6) RSRDNFAVW
  • SEQ ID NO. 24 (peptide sequence derived from CLT Antigen 6) RSRDNFA
  • SEQ ID NO. 25 (peptide sequence derived from CLT Antigen 7) SPGISLVF
  • SEQ ID NO. 26 (peptide sequence derived from CLT Antigen 8) SSDSTILVL
  • SEQ ID NO. 27 (peptide sequence derived from CLT Antigen 9) AGRMSKSLVIK
  • SEQ ID NO. 29 (peptide sequence derived from CLT Antigen 9) AGSQSSSFTRGHTGETPQ
  • SEQ ID NO. 30 (peptide sequence derived from CLT Antigen 10) RSNLSIFL
  • SEQ ID NO. 33 (cDNA sequence of CLT encoding CLT Antigen 1 )
  • GTAAT GTAAG AAAC G C CTTTT GCCTCCTGC CAT AATT CT G AG GC CT C AC AG C C A
  • SEQ ID NO. 34 (cDNA sequence of CLT encoding CLT Antigen 2)
  • SEQ ID NO. 35 (cDNA sequence of CLT encoding CLT Antigens 3 and 4)
  • SEQ ID NO 36 (cDNA sequence of CLT encoding CLT Antigen 5)
  • SEQ ID NO 37 (cDNA sequence of CLT encoding CLT Antigen 6) CTTG G ACTT C C C AG C CTC C AG AACT GT G AG AAAT AAATTTTT GTT GTTT AAT C C A
  • SEQ ID NO 38 (cDNA sequence of CLT encoding CLT Antigens 7 and 8)
  • SEQ ID NO 39 (cDNA sequence of CLT encoding CLT Antigen 9)
  • SEQ ID NO 40 (cDNA sequence of CLT encoding CLT Antigen 10)
  • SEQ ID NO. 41 (cDNA sequence encoding CLT Antigen 1 )
  • SEQ ID NO. 42 (cDNA sequence encoding CLT Antigen 2)
  • SEQ ID NO. 44 (cDNA sequence encoding CLT Antigen 4)
  • SEQ ID NO. 45 (cDNA sequence encoding CLT Antigen 5)
  • SEQ ID NO 46 (cDNA sequence encoding CLT Antigen 6)
  • SEQ ID NO 47 (cDNA sequence encoding CLT Antigen 7)
  • SEQ ID NO 48 (cDNA sequence encoding CLT Antigen 8)
  • SEQ ID NO 50 (cDNA sequence encoding CLT Antigen 10)
  • SEQ ID NO. 51 (peptide sequence derived from CLT Antigen 4)
  • SEQ ID NO. 52 (peptide sequence derived from CLT Antigen 4)
  • SEQ ID NO. 53 (peptide sequence derived from CLT Antigen 3)
  • SEQ ID NO. 54 (peptide sequence derived from CLT Antigen 4)
  • SEQ ID NO.55 (peptide sequence derived from CLT Antigen 1 )
  • VPANTYNALK SEQ ID NO.56 (peptide sequence derived from CLT Antigen 1 ) RLGGCQAWWR
  • SEQ ID NO.57 (peptide sequence derived from CLT Antigen 1 ) ANTYNALKSR
  • SEQ ID NO.58 (peptide sequence derived from CLT Antigen 2) LVTDMVACRI
  • SEQ ID NO.59 (peptide sequence derived from CLT Antigen 2) LILDFQPLQL
  • SEQ ID NO.60 (peptide sequence derived from CLT Antigen 2) MSSFSTLASL
  • SEQ ID NO.61 (peptide sequence derived from CLT Antigen 2) LMSSFSTLASL
  • SEQ ID NO.62 (peptide sequence derived from CLT Antigen 2) LMSSFSTLA
  • SEQ ID NO.63 (peptide sequence derived from CLT Antigen 2) QLMSSFSTLA
  • SEQ ID NO.64 (peptide sequence derived from CLT Antigen 2) MVACRIKTFR
  • SEQ ID NO.65 (peptide sequence derived from CLT Antigen 2) VTDMVACRIK
  • SEQ ID NO.68 (peptide sequence derived from CLT Antigen 3) VLLMRPLRIK
  • SEQ ID NO.69 (peptide sequence derived from CLT Antigen 3) MRPLRIKGVF
  • SEQ ID NO.70 (peptide sequence derived from CLT Antigen 4) FLFLELWL
  • SEQ ID NO.71 (peptide sequence derived from CLT Antigen 4) SVFRELHPA
  • SEQ ID NO.72 (peptide sequence derived from CLT Antigen 4) SPPSSTAPL
  • SEQ ID NO.74 (peptide sequence derived from CLT Antigen 1 ) VPANTYNAL
  • SEQ ID NO.76 (peptide sequence derived from CLT Antigen 4) FLELWLPEPML
  • SEQ ID NO.77 (peptide sequence derived from CLT Antigen 4) APLLGSEPL
  • SEQ ID NO. 78 (peptide sequence derived from CLT Antigen 2) SLILDFQPL

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Biomedical Technology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Medicinal Chemistry (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • General Engineering & Computer Science (AREA)
  • General Chemical & Material Sciences (AREA)
  • Biophysics (AREA)
  • Cell Biology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Hematology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Toxicology (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/GB2019/052980 2018-10-19 2019-10-18 Novel cancer antigens and methods Ceased WO2020079448A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
EP19790765.2A EP3866827A1 (en) 2018-10-19 2019-10-18 Novel cancer antigens and methods
BR112021006941-0A BR112021006941A2 (pt) 2018-10-19 2019-10-18 Antígenos de câncer inovadores e métodos
CA3112427A CA3112427A1 (en) 2018-10-19 2019-10-18 Novel cancer antigens and methods
CN201980068630.3A CN112867501B (zh) 2018-10-19 2019-10-18 新的癌抗原和方法
EA202191081A EA202191081A1 (ru) 2018-10-19 2019-10-18 Новые раковые антигены и сопутствующие способы
JP2021546487A JP7712207B2 (ja) 2018-10-19 2019-10-18 新規な癌抗原及び方法
KR1020217010920A KR20210080372A (ko) 2018-10-19 2019-10-18 신규의 암 항원 및 방법
CN202411985215.3A CN119978090A (zh) 2018-10-19 2019-10-18 新的癌抗原和方法
MX2021004453A MX2021004453A (es) 2018-10-19 2019-10-18 Nuevos antigenos y metodos contra el cancer.
AU2019360427A AU2019360427A1 (en) 2018-10-19 2019-10-18 Novel cancer antigens and methods
IL282308A IL282308A (en) 2018-10-19 2021-04-13 Novel cancer antigens and methods
US17/232,597 US12263216B2 (en) 2018-10-19 2021-04-16 Cancer antigens and methods
JP2022173369A JP7762132B2 (ja) 2018-10-19 2022-10-28 新規な癌抗原及び方法
JP2024212437A JP2025041678A (ja) 2018-10-19 2024-12-05 新規な癌抗原及び方法
US19/062,913 US20250360206A1 (en) 2018-10-19 2025-02-25 Cancer antigens and methods

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP18201634 2018-10-19
EP18201634.5 2018-10-19

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US17/232,597 Continuation US12263216B2 (en) 2018-10-19 2021-04-16 Cancer antigens and methods

Publications (2)

Publication Number Publication Date
WO2020079448A1 true WO2020079448A1 (en) 2020-04-23
WO2020079448A9 WO2020079448A9 (en) 2020-05-22

Family

ID=64183836

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/GB2019/052980 Ceased WO2020079448A1 (en) 2018-10-19 2019-10-18 Novel cancer antigens and methods

Country Status (12)

Country Link
US (2) US12263216B2 (cg-RX-API-DMAC7.html)
EP (1) EP3866827A1 (cg-RX-API-DMAC7.html)
JP (3) JP7712207B2 (cg-RX-API-DMAC7.html)
KR (1) KR20210080372A (cg-RX-API-DMAC7.html)
CN (2) CN112867501B (cg-RX-API-DMAC7.html)
AU (1) AU2019360427A1 (cg-RX-API-DMAC7.html)
BR (1) BR112021006941A2 (cg-RX-API-DMAC7.html)
CA (1) CA3112427A1 (cg-RX-API-DMAC7.html)
EA (1) EA202191081A1 (cg-RX-API-DMAC7.html)
IL (1) IL282308A (cg-RX-API-DMAC7.html)
MX (1) MX2021004453A (cg-RX-API-DMAC7.html)
WO (1) WO2020079448A1 (cg-RX-API-DMAC7.html)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021209775A1 (en) * 2020-04-17 2021-10-21 The Francis Crick Institute Limited Antigen pool
WO2021212123A1 (en) * 2020-04-17 2021-10-21 The Francis Crick Institute Limited Fusion proteins of ctl antigens for treating melanoma
US12263216B2 (en) 2018-10-19 2025-04-01 The Francis Crick Institute Limited Cancer antigens and methods

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
MX2021015765A (es) * 2019-06-28 2022-01-27 The Francis Crick Institute Ltd Nuevos antigenos y metodos contra el cancer.

Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997024447A1 (en) 1996-01-02 1997-07-10 Chiron Corporation Immunostimulation mediated by gene-modified dendritic cells
WO2000006598A1 (en) 1998-07-29 2000-02-10 Ludwig Institute For Cancer Research Endogenous retrovirus tumor associated nucleic acids and antigens
WO2005099750A1 (en) 2004-04-16 2005-10-27 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Vaccination against malignant melanoma using bcg and/or vaccinia
WO2006103562A2 (en) 2005-03-30 2006-10-05 Centre National De La Recherche Scientifique (Cnrs) Endogenous retrovirus and proteins encoded by env gene as a target for cancer treatment
WO2006119527A2 (en) 2005-05-11 2006-11-16 Avir Green Hills Biotechnology Research Development Trade Ag Melanoma-associated endogenous retrovirus (merv) derived peptide sequences and their therapeutic/ diagnostic use
WO2007109583A2 (en) 2006-03-17 2007-09-27 The Government Of The United States Of America As Represented By The Secretary, Department Of Health And Human Services Compositions and methods for prevention or treatment of neoplastic disease in a mammalian subject
WO2007137279A2 (en) 2006-05-22 2007-11-29 Board Of Regents, The University Of Texas System Herv-k antigens, antibodies, and methods

Family Cites Families (32)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7504490B1 (en) 1998-10-16 2009-03-17 Oscient Pharmaceuticals Corporation Nucleic acid and amino acid sequences relating to Apergillus fumigatus for diagnostics and therapeutics
WO2001064835A2 (en) 2000-02-28 2001-09-07 Hyseq, Inc. Novel nucleic acids and polypeptides
US6436703B1 (en) 2000-03-31 2002-08-20 Hyseq, Inc. Nucleic acids and polypeptides
AU2001249922A1 (en) 2000-04-06 2001-10-23 Pharmacia And Upjohn Company G protein-coupled receptors
US20020082206A1 (en) 2000-05-30 2002-06-27 Leach Martin D. Novel polynucleotides from atherogenic cells and polypeptides encoded thereby
US20040142325A1 (en) 2001-09-14 2004-07-22 Liat Mintz Methods and systems for annotating biomolecular sequences
US7193069B2 (en) 2002-03-22 2007-03-20 Research Association For Biotechnology Full-length cDNA
JP2003304877A (ja) 2002-04-15 2003-10-28 Keio Gijuku ヒト色素細胞特異分子
AU2003298606A1 (en) 2002-10-25 2004-05-13 Five Prime Therapeutics, Inc. Human polypeptides encoded by polynucleotides and methods of their use
WO2006105642A1 (en) 2005-04-05 2006-10-12 British Columbia Cancer Agency Biomarkers for the detection of lung cancer and uses thereof
US20070072175A1 (en) 2005-05-13 2007-03-29 Biogen Idec Ma Inc. Nucleotide array containing polynucleotide probes complementary to, or fragments of, cynomolgus monkey genes and the use thereof
EP1963534A2 (en) 2005-12-19 2008-09-03 Genizon Biosciences Inc. Genemap of the human gene associated with crohn's disease
US20090297530A1 (en) 2006-05-22 2009-12-03 Feng Wang-Johanning Herv-k antigens, antibodies, and methods
EP2052088A2 (en) 2006-08-02 2009-04-29 Genizon Biosciences Genemap of the human genes associated with psoriasis
WO2008118258A2 (en) 2007-02-06 2008-10-02 Genizon Biosciences Inc. Genemap of the human genes associated with adhd
US8541553B2 (en) 2007-05-24 2013-09-24 Baxter Healthcare Sa Antibodies specific for the melanoma-associated endogenous retrovirus (MERV) envelope glycoprotein
WO2009026116A2 (en) 2007-08-16 2009-02-26 Genizon Biosciences, Inc. Genemap of the human genes associated with longevity
WO2009039244A2 (en) 2007-09-18 2009-03-26 Genizon Biosciences Inc. Genemap of the human genes associated with crohn's disease
US8323659B2 (en) 2008-09-18 2012-12-04 Keio University Method for diagnosing and/or treating tumor
WO2013040142A2 (en) 2011-09-16 2013-03-21 Iogenetics, Llc Bioinformatic processes for determination of peptide binding
NZ622148A (en) 2011-08-30 2016-06-24 Nat Defense Medical Ct Gene biomarkers for prediction of susceptibility of ovarian neoplasms and/or prognosis or malignancy of ovarian cancers
FR2984362B1 (fr) 2011-12-20 2017-11-24 Biomerieux Sa Procede pour le diagnostic ou le pronostic in vitro du cancer du poumon
WO2014004385A2 (en) 2012-06-25 2014-01-03 Board Of Regents, The University Of Texas System Anti-cancer vaccines
ES2807791T3 (es) 2014-12-08 2021-02-24 Univ Michigan Regents ARN no codificantes y usos de los mismos
GB201521894D0 (en) 2015-12-11 2016-01-27 Immatics Biotechnologies Gmbh Novel peptides and combination of peptides for use in immunotherapy against various cancers
CR20180551A (es) 2016-04-21 2019-02-12 Immatics Biotechnologies Gmbh Inmunoterapia contra el melanoma y otros tipos de cáncer
US20190351040A1 (en) 2017-02-01 2019-11-21 Modernatx, Inc. Rna cancer vaccines
BR112021006941A2 (pt) 2018-10-19 2021-08-31 The Francis Crick Institute Limited Antígenos de câncer inovadores e métodos
EP3990007A2 (en) 2019-06-28 2022-05-04 The Francis Crick Institute Limited Novel cancer antigens and methods
MX2021015765A (es) 2019-06-28 2022-01-27 The Francis Crick Institute Ltd Nuevos antigenos y metodos contra el cancer.
EP3994156A1 (en) 2019-07-05 2022-05-11 The Francis Crick Institute Limited Novel cancer antigens and methods
AU2020309202A1 (en) 2019-07-05 2021-12-09 Enara Bio Limited Novel cancer antigens and methods

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997024447A1 (en) 1996-01-02 1997-07-10 Chiron Corporation Immunostimulation mediated by gene-modified dendritic cells
WO2000006598A1 (en) 1998-07-29 2000-02-10 Ludwig Institute For Cancer Research Endogenous retrovirus tumor associated nucleic acids and antigens
WO2005099750A1 (en) 2004-04-16 2005-10-27 Georg-August-Universität Göttingen Stiftung Öffentlichen Rechts Vaccination against malignant melanoma using bcg and/or vaccinia
WO2006103562A2 (en) 2005-03-30 2006-10-05 Centre National De La Recherche Scientifique (Cnrs) Endogenous retrovirus and proteins encoded by env gene as a target for cancer treatment
WO2006119527A2 (en) 2005-05-11 2006-11-16 Avir Green Hills Biotechnology Research Development Trade Ag Melanoma-associated endogenous retrovirus (merv) derived peptide sequences and their therapeutic/ diagnostic use
WO2007109583A2 (en) 2006-03-17 2007-09-27 The Government Of The United States Of America As Represented By The Secretary, Department Of Health And Human Services Compositions and methods for prevention or treatment of neoplastic disease in a mammalian subject
WO2007137279A2 (en) 2006-05-22 2007-11-29 Board Of Regents, The University Of Texas System Herv-k antigens, antibodies, and methods

Non-Patent Citations (85)

* Cited by examiner, † Cited by third party
Title
"Adenovirus Vectors for Gene Therapy", VACCINATION AND CANCER GENE THERAPY, vol. 13, pages 421 - 433
"Current Protocols in Molecular Biology", 1995
"The Genotype-Tissue Expression Consortium", SCIENCE, vol. 348, 2015, pages 648 - 60
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL ET AL., NUC. ACIDS RES., vol. 25, 1977, pages 3389 - 3402
ANAGNOSTOU ET AL., CANCER DISCOVERY, 2017
ANDERSSON ET AL., INT. J. ONCOL, vol. 12, 1998, pages 309 - 313
ATTIG ET AL., FRONT. IN MICROBIOL., vol. 8, 2017, pages 2489
BABAIANMAGER, MOB. DNA, 2016
BANCHEREAUSTEINMAN, NATURE, vol. 392, 1998, pages 245 - 251
BASSANI-STERNBERG ET AL., NATURE COMMUN., vol. 7, 2016, pages 13404
BATZER ET AL., NUCLEIC ACID RES., vol. 19, 1991, pages 5081
BRITO ET AL., MOLECULAR THERAPY, vol. 22, 2014, pages 2118 - 2129
CRUSOE ET AL., F1000RES., vol. 4, 2015, pages 900
DANILOVA ET AL., CANCER IMMUNOL. RES., 2018
DATABASE Geneseq [online] 14 July 2016 (2016-07-14), "Human derived non-coding RNA CAT2186.2, SEQ:1274.", XP002789013, retrieved from EBI accession no. GSN:BCQ57982 Database accession no. BCQ57982 *
DATABASE UniProt [online] 13 July 2010 (2010-07-13), "SubName: Full=Acetyltransferase {ECO:0000313|EMBL:EFE74977.2};", XP002789014, retrieved from EBI accession no. UNIPROT:D6AHI5 Database accession no. D6AHI5 *
DEVEREAUX ET AL., NUC. ACIDS RES., vol. 12, 1984, pages 387 - 395
DUBROVSKY ET AL., ONCOIMMUNOLOGY, 2016
ELENA CHERKASOVA ET AL: "Endogenous Retroviruses as Targets for Antitumor Immunity in Renal Cell Cancer and Other Tumors", FRONTIERS IN ONCOLOGY, vol. 3, 17 September 2013 (2013-09-17), XP055412545, DOI: 10.3389/fonc.2013.00243 *
FENGDOOLITTLE, J. MOL. EVOL., vol. 35, 1987, pages 351 - 360
FORDE ET AL., NEJM, 2018
FREUDENMANN ET AL., IMMUNOLOGY, vol. 154, no. 3, 2018, pages 331 - 345
GEALL ET AL., PNAS, vol. 109, 2012, pages 14604 - 14609
GORNATI ET AL., FRONT. IMM, vol. 9, 2018, pages 1484
GRUNDSTROM ET AL., NUCL. ACIDS RES., vol. 13, 1985, pages 3305 - 3316
H ACHA-ORBEA ET AL: "Superantigens of Mouse Mammary Tumor Virus", ANNUAL REVIEW OF IMMUNOLOGY, vol. 13, no. 1, 1 April 1995 (1995-04-01), pages 459 - 486, XP055554221, ISSN: 0732-0582, DOI: 10.1146/annurev.iy.13.040195.002331 *
HENIKOFFHENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915
HIGGINSSHARP, CABIOS, vol. 5, 1989, pages 151 - 153
HUBLEY ET AL., NUC. ACID. RES., vol. 44, 2016, pages 81 - 89
HUMER J ET AL., CANC. RES., vol. 66, 2006, pages 1658 - 63
HURSTMAGIORKINIS, J. GEN. VIROL, vol. 96, 2015, pages 1207 - 1218
IYER ET AL., NAT. GENET., vol. 47, 2015, pages 199 - 208
JCI INSIGHT., vol. 3, no. 19, 4 October 2018 (2018-10-04), pages 122467
KAHLES ET AL., CANCER CELL, vol. 34, no. 2, 2018, pages 211 - 224, Retrieved from the Internet <URL:http://doi.org/10.1016/j.ccell.2018.07.001>
KARLINALTSCHUL, PROC. NAT'L. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787
KASSIOTISSTOYE, NAT. REV. IMMUNOL., vol. 16, 2016, pages 207 - 219
KATOH IYOKO ET AL: "Association of endogenous retroviruses and long terminal repeats with human disorders.", FRONTIERS IN ONCOLOGY 11 SEP 2013, vol. 3, 11 September 2013 (2013-09-11), pages 234, XP055554218, ISSN: 2234-943X *
KERSHAW ET AL., CANCER RES., vol. 61, 2001, pages 7920 - 7924
KOHLERMILSTEIN, NATURE, vol. 256, no. 5517, 1975, pages 495 - 497
KRANZ ET AL., NATURE, vol. 534, 2006, pages 396 - 401
LAUSS ET AL., NATURE COMMUNICATIONS, vol. 8, no. 1, 2017, pages 1738
LE ET AL., SCIENCE, 2017
LIEPE ET AL., SCIENCE, vol. 354, no. 6310, 2016, pages 354 - 358
LOCK ET AL., PNAS, vol. 111, 2014, pages 3534 - 3543
MAHVI, IMMUNOLOGY AND CELL BIOLOGY, vol. 75, 1997, pages 456 - 460
MANGENEY ET AL., J. GEN. VIROL., vol. 82, 2001, pages 2515 - 2518
MARCEL M., EMBNET J., vol. 17, 2011, pages 3
MELIEFVAN DER BURG, NAT REV CANCER, vol. 8, 2008, pages 351 - 60
MENNUNI ET AL., INT.J.CANCER, 2005
METHODS MOL BIOL., vol. 834, 2012, pages 93 - 109
NAMBIAR ET AL., SCIENCE, vol. 223, 1984, pages 1299 - 1301
NEEDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443
NELSON ET AL., MOL PATHOL., vol. 53, no. 3, June 2000 (2000-06-01), pages 111 - 7
NESVIZHSKII ET AL., NAT. METHODS, vol. 11, 2014, pages 1114 - 1125
OHTSUKA ET AL., J. BIOL. CHEM., 1985, pages 2605 - 2608
PATRO, R. ET AL., NAT. METHODS, vol. 14, 2017, pages 417 - 419
PEARSONLIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444
RIBAS, A.WOLCHOK, J. D., SCIENCE, vol. 359, 2018, pages 1350 - 1355
ROLLAND, CRIT. REV. THERAP. DRUG CARRIER SYSTEMS, vol. 15, 1998, pages 143 - 198
ROSSOLINI ET AL., MOL. CELL. PROBES, vol. 8, 1994, pages 91 - 98
RUPRECHT, CELL MOL LIFE SCI, vol. 65, 2008, pages 3366 - 3382
SACHA, J.IMMUNOL, vol. 189, 2012, pages 1467 - 1479
SAKAMARKHORANA, NUCL. ACIDS RES., vol. 14, 1988, pages 6361 - 6372
SCHIAVETTI FRANCESCA ET AL: "A human endogenous retroviral sequence encoding an antigen recognized on melanoma by cytolytic T lymphocytes", CANCER RESEARCH, AACR ANNUAL MEETING 2017; APRIL 1-5, 2017; WASHINGTON, DC, US, vol. 62, no. 19, 1 October 2002 (2002-10-01), pages 5510 - 5516, XP002304883, ISSN: 0008-5472 *
SCHLAKE ET AL., RNA BIOLOGY, vol. 9, pages 1319 - 1330
SLANSKY ET AL., IMMUNITY, vol. 13, 2000, pages 529 - 538
SMART ET AL., NATURE BIOTECHNOLOGY, 2018, Retrieved from the Internet <URL:http://doi.org/10.1038/nbt.4239>
SMITH ET AL., J IMMUNOTHER CANCER, 2019
SMITHWATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482
TIEPPSGIGOUX, M.WOLCHOK, J., JEM, vol. 215, 2018, pages 2325
TIMMERMANLEVY, ANN. REV. MED., vol. 50, 1999, pages 507 - 529
TRAPNELL ET AL., NAT. BIOTECH., vol. 28, 2010, pages 511 - 515
TRINITY, GRABHERR, M.G. ET AL., NAT. BIOTECHNOL., vol. 29, 2011, pages 644 - 52
ULMER ET AL., SCIENCE, vol. 259, 1993, pages 1691 - 1692
ULMER ET AL., VACCINE, vol. 30, 2012, pages 4414 - 4418
VERMAECKSTEIN, ANNU. REV. BIOCHEM., vol. 67, 1998, pages 99 - 134
WANG ET AL., J MOL DIAGN., vol. 14, no. 1, 2012, pages 22 - 29
WANG-JOHANNING, CANCER, vol. 98, 2003, pages 187 - 197
WELLS ET AL., GENE, vol. 34, 1985, pages 315 - 323
WENDELLJUNE, CELL, vol. 168, 2017, pages 724 - 740
WHEELER ET AL., BIOINFORM., vol. 29, 2013, pages 2487 - 2489
WOLD ET AL., CURRENT GENE THERAPY, 2013
WU ET AL., BIOINF., vol. 21, 2005, pages 1859 - 1875
ZITVOGEL ET AL., NATURE MED., vol. 4, 1998, pages 594 - 600

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12263216B2 (en) 2018-10-19 2025-04-01 The Francis Crick Institute Limited Cancer antigens and methods
WO2021209775A1 (en) * 2020-04-17 2021-10-21 The Francis Crick Institute Limited Antigen pool
WO2021212123A1 (en) * 2020-04-17 2021-10-21 The Francis Crick Institute Limited Fusion proteins of ctl antigens for treating melanoma

Also Published As

Publication number Publication date
BR112021006941A2 (pt) 2021-08-31
US20250360206A1 (en) 2025-11-27
WO2020079448A9 (en) 2020-05-22
JP7712207B2 (ja) 2025-07-23
IL282308A (en) 2021-05-31
CN119978090A (zh) 2025-05-13
CN112867501B (zh) 2025-01-07
EP3866827A1 (en) 2021-08-25
JP2025041678A (ja) 2025-03-26
US20210353729A1 (en) 2021-11-18
JP2023017853A (ja) 2023-02-07
KR20210080372A (ko) 2021-06-30
JP2022514116A (ja) 2022-02-09
AU2019360427A1 (en) 2021-03-18
CA3112427A1 (en) 2020-04-23
MX2021004453A (es) 2021-09-10
CN112867501A (zh) 2021-05-28
EA202191081A1 (ru) 2021-07-09
JP7762132B2 (ja) 2025-10-29
US12263216B2 (en) 2025-04-01

Similar Documents

Publication Publication Date Title
US12263216B2 (en) Cancer antigens and methods
US20220218807A1 (en) Novel cancer antigens and methods
US20220213159A1 (en) Novel cancer antigens and methods
US20220211760A1 (en) Novel cancer antigens and methods
US20220220175A1 (en) Novel cancer antigens and methods
US20240156932A1 (en) Novel cancer antigens and methods
EA053293B1 (ru) Новые раковые антигены и сопутствующие способы
EA052067B1 (ru) Новые раковые антигены и сопутствующие способы
EA052615B1 (ru) Новые раковые антигены и сопутствующие способы

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19790765

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3112427

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019360427

Country of ref document: AU

Date of ref document: 20191018

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2021546487

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112021006941

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2019790765

Country of ref document: EP

Effective date: 20210519

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112021006941

Country of ref document: BR

Free format text: COM BASE NA PORTARIA 405 DE 21/12/2020, SOLICITA-SE QUE SEJA APRESENTADO, EM ATE 60 (SESSENTA) DIAS, NOVO CONTEUDO DE LISTAGEM DE SEQUENCIA POIS O CONTEUDO APRESENTADO NA PETICAO NO 870210033126 DE 12/04/2021, POSSUI INFORMACOES DIVERGENTES AO PEDIDO EM QUESTAO.(DIVERGENCIA NO NOME DO DEPOSITANTE)

ENP Entry into the national phase

Ref document number: 112021006941

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20210412

WWG Wipo information: grant in national office

Ref document number: 201980068630.3

Country of ref document: CN

WWW Wipo information: withdrawn in national office

Ref document number: 773295

Country of ref document: NZ

WWW Wipo information: withdrawn in national office

Ref document number: 282308

Country of ref document: IL