WO2020035609A2 - Immunogenic compositions and uses thereof - Google Patents

Immunogenic compositions and uses thereof Download PDF

Info

Publication number
WO2020035609A2
WO2020035609A2 PCT/EP2019/072052 EP2019072052W WO2020035609A2 WO 2020035609 A2 WO2020035609 A2 WO 2020035609A2 EP 2019072052 W EP2019072052 W EP 2019072052W WO 2020035609 A2 WO2020035609 A2 WO 2020035609A2
Authority
WO
WIPO (PCT)
Prior art keywords
self
antigen
replicating rna
influenza virus
hydrocarbon chain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2019/072052
Other languages
English (en)
French (fr)
Other versions
WO2020035609A3 (en
Inventor
Sylvie BERTHOLET GIRARDIN
Arun Kumar
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
GlaxoSmithKline Biologicals SA
Original Assignee
GlaxoSmithKline Biologicals SA
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by GlaxoSmithKline Biologicals SA filed Critical GlaxoSmithKline Biologicals SA
Priority to EP19758926.0A priority Critical patent/EP3836963A2/en
Priority to CN201980068212.4A priority patent/CN113164584A/zh
Priority to JP2021507889A priority patent/JP2021534182A/ja
Priority to AU2019321186A priority patent/AU2019321186B2/en
Priority to CA3109165A priority patent/CA3109165A1/en
Priority to US17/268,647 priority patent/US12083174B2/en
Publication of WO2020035609A2 publication Critical patent/WO2020035609A2/en
Publication of WO2020035609A3 publication Critical patent/WO2020035609A3/en
Anticipated expiration legal-status Critical
Priority to US18/795,336 priority patent/US20250064916A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/145Orthomyxoviridae, e.g. influenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/295Polyvalent viral antigens; Mixtures of viral and bacterial antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55555Liposomes; Vesicles, e.g. nanoparticles; Spheres, e.g. nanospheres; Polymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16211Influenzavirus B, i.e. influenza B virus
    • C12N2760/16234Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • an immunogenic composition comprising: (i) a first self- replicating RNA molecule encoding a polypeptide comprising a first antigen and (ii) a second self- replicating RNA molecule encoding a polypeptide comprising a second antigen, wherein the first and second antigens are both from influenza virus but the first antigen is from a different strain of influenza virus to the second antigen.
  • composition comprising an immunogenic composition described above and a pharmaceutically acceptable carrier
  • a first immunogenic composition comprising a first self-replicating RNA molecule and a pharmaceutically acceptable carrier for use in a method of preventing influenza disease, said method comprising administration to a subject in need the first immunogenic composition followed by administration of a second immunogenic composition comprising a self-replicating RNA molecule and a pharmaceutically acceptable carrier, wherein the first and second self- replicating RNA molecules each encode a polypeptide comprising an antigen, wherein the antigen is from influenza virus but the antigen encoded by the first self-replicating RNA molecule is from a different strain of influenza virus to that encoded by the second self- replicating RNA molecule,
  • FIG. 1 Schematic representation and characterization of bi-cistronic SAM (H5-H1).
  • H5-H1 bi-cistronic SAM
  • SGP subgenomic promoter
  • HI HI HA gene from influenza A/California/07/2009 (H1N1) virus strain
  • H5 H5 HA gene from A/turkey/Turkey/01/2005 (H5N1) virus strain
  • 2A full length 2A-driven sequence
  • nsPs non-structural replicon proteins
  • FIG 4 Comparative CD4 + T-cell responses induced by multivalent SAM(HA)/LNP candidate vaccines.
  • Mice were immunized i.m. on day 0 and day 21 with PBS [ group 1 ] and combinations of SAM(H3-Biltho)+SAM(H3-Bang)+SAM(H3-Fuj) [ group 2]; SAM(H3-Beij)+SAM(H3-Bris)+SAM(H3- Tex) [group 3], SAM(Hl-Cal)+SAM(Hl-PR8)+SAM(H5-turkey)+SAM (H7-Shan) [group 4], SAM(H3- Biltho)+SAM(H3-Bang)+SAM(H3-Fuj)+SAM(H3-Beij)+SAM(H3-Bris)+SAM(H3-Tex) [group 5] and SAM(H3-Biltho)+SAM
  • FIG 7 RNA quality and confirmation of HA H3 gene expression.
  • SAM vectors encoding the H3 antigen were analyzed on a denaturing agarose gel.
  • SAM vectors encoding H3 antigens were transiently infected into BHK cells and cell lysates were subjected to SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) and finally blotted to nitrocellulose membranes. H3 expression was visualized by Western blotting using H3-specific polyclonal antibodies.
  • Vaccines were made comprising cocktails of two or more SAM vectors expressing full- length HAs from H3N2, H1N1, H5N1 and H7N9 subtypes either in monocistronic or bicistronic form and were encapsulated in lipid-nano particles (LNPs).
  • LNPs lipid-nano particles
  • an influenza virus antigen may be transcribed to provide further transcripts with the same sense as the delivered RNA which are translated to provide in situ expression of the antigen.
  • the overall result of this sequence of transcriptions is a huge amplification in the number of the introduced replicon RNAs and so the encoded antigen becomes a major polypeptide product of the cells.
  • One suitable system for achieving self-replication in this manner is to use an alphavirus-based replicon.
  • These replicons are +-stranded (positive sense-stranded) RNAs which lead to translation of a replicase (or replicase-transcriptase) after delivery to a cell.
  • the replicase is translated as a polyprotein which auto-cleaves to provide a replication complex which creates genomic-strand copies of the +-strand delivered RNA.
  • These negative (-)-stranded transcripts can themselves be transcribed to give further copies of the +-stranded parent RNA and also to give a subgenomic transcript which encodes the antigen. Translation of the subgenomic transcript thus leads to in situ expression of the antigen by the infected cell.
  • Suitable alphavirus replicons can use a replicase from a Sindbis virus, a Semliki forest virus, an eastern equine encephalitis virus, a Venezuelan equine encephalitis virus, etc.
  • Mutant or wild-type virus sequences can be used e.g. the attenuated TC83 mutant of VEEV has been used in replicons, see the following reference: WO2005/113782, the context of which is incorporated by reference.
  • RNA molecule useful with the invention may have two open reading frames.
  • the first (5') open reading frame encodes a replicase; the second (3') open reading frame encodes a polypeptide comprising an antigen from influenza virus.
  • the RNA may have additional (e.g. downstream) open reading frames e.g. to encode further antigens or to encode accessory polypeptides.
  • the self-replicating RNA can conveniently be prepared by in vitro transcription (IVT).
  • IVT can use a (cDNA) template created and propagated in plasmid form in bacteria, or created synthetically (for example by gene synthesis and/or polymerase chain-reaction (PCR) engineering methods).
  • a DNA-dependent RNA polymerase such as the bacteriophage T7, T3 or SP6 RNA polymerases
  • Appropriate capping and poly-A addition reactions can be used as required (although the replicon's poly-A is usually encoded within the DNA template).
  • the self-replicating RNA molecules described herein may be engineered to express multiple nucleotide sequences, from two or more open reading frames, thereby allowing co-expression of proteins, such as one, two or more influenza virus antigens, together with cytokines or other immunomodulators, which can enhance the generation of an immune response.
  • proteins such as one, two or more influenza virus antigens, together with cytokines or other immunomodulators, which can enhance the generation of an immune response.
  • the influenza virus antigen e.g. an HA antigen
  • T helper cell differentiation can be analyzed by measuring proliferation or production of TH1 (IL-2 and IFN-g) and /or TH2 (IL-4 and IL-5) cytokines by ELISA or directly in CD4+ T cells by cytoplasmic cytokine staining and flow cytometry.
  • TH1 IL-2 and IFN-g
  • TH2 IL-4 and IL-5
  • the self-replicating RNA molecules may comprise an RNA sequence encoded by the DNA sequence of SEQ ID NO: 2 or a DNA sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 2.
  • the self-replicating RNA molecules comprise an RNA sequence encoded by a DNA sequence at least 90% identical to SEQ ID NO: 2.
  • Influenza A viruses evolve and undergo antigenic variability continuously.
  • a lack of effective proofreading by the viral RNA polymerase leads to a high rate of transcription errors that can result in amino-acid substitutions in surface glycoproteins, such as HA and NA proteins. This is termed "antigenic drift”.
  • the segmented viral genome allows for a second type of antigenic variation. If two influenza viruses simultaneously infect a host cell, genetic reassortment, called “antigenic shift" may generate a novel virus with new surface or internal proteins.
  • pandemic strains associated with a pandemic outbreak or with the potential to be associated with a pandemic will be known to those skilled in the art and are identified by the WHO according to internationally recognised criteria (see “Pandemic influenza preparedness and response" A WHO Guidance document, 2009, IBSN 9789241547680).
  • Polypeptides according to the invention may comprise, in addition to the antigen from influenza virus, one or more heterologous amino acid sequences (e.g. another antigen sequence, another signal sequence, a detectable tag, or the like).
  • the polypeptide herein may be a fusion protein.
  • Nucleic acid may be prepared in many ways, e.g. by chemical synthesis in whole or in part, by digesting longer nucleic acids using nucleases (e.g. restriction enzymes), by joining shorter nucleic acids or nucleotides (e.g. using ligases or polymerases), from genomic or cDNA libraries etc.
  • nucleases e.g. restriction enzymes
  • ligases or polymerases e.g. using ligases or polymerases
  • cDNA templates encoding a polypeptide comprising an antigen from influenza virus may be prepared.
  • Such cDNA templates may be created and propagated in plasmid form in bacteria or created synthetically (for example by gene synthesis and/or polymerase chain-reaction (PCR) engineering methods).
  • nucleic acid in general means a polymeric form of nucleotides of any length, which contain deoxyribonucleotides, ribonucleotides, and/or their analogs. It includes DNA, RNA, DNA/RNA hybrids. It also includes DNA or RNA analogs, such as those containing modified backbones (e.g. peptide nucleic acids (PNAs) or phosphorothioates) or modified bases.
  • PNAs peptide nucleic acids
  • the nucleic acid of the disclosure includes mRNA, self-replicating RNA, DNA, cDNA, recombinant nucleic acids, branched nucleic acids, plasmids, vectors, etc. Where the nucleic acid takes the form of RNA, it may or may not have a 5' cap.
  • the nucleic acids herein comprise a sequence which encodes a polypeptide comprising an antigen from influenza virus.
  • the nucleic acids of the invention will be in recombinant form, i.e. a form which does not occur in nature.
  • the nucleic acid may comprise one or more heterologous nucleic acid sequences (e.g. a sequence encoding another antigen and/or a control sequence such as a promoter or an internal ribosome entry site) in addition to the sequence encoding an antigen from influenza virus.
  • the nucleic acid may be part of a vector i.e. part of a nucleic acid construct designed for transduction/transfection of one or more cell types.
  • Vectors may be, for example, "expression vectors" which are designed for expression of a nucleotide sequence in a host cell, or "viral vectors" which are designed to result in the production of a recombinant virus or viruslike particle.
  • the 5' end of the RNA may be capped with a modified ribonucleotide with the structure m7G (5') ppp (5') N (cap 0 structure) or a derivative thereof, which can be incorporated during RNA synthesis or can be enzymatically engineered after RNA transcription (e.g., by using Vaccinia Virus Capping Enzyme (VCE) consisting of mRNA triphosphatase, guanylyl- transferase and guanine-7-methytransferase, which catalyzes the construction of N7-monomethylated cap 0 structures).
  • VCE Vaccinia Virus Capping Enzyme
  • Cap 0 structure plays an important role in maintaining the stability and translational efficacy of the RNA molecule.
  • the 5' cap of the RNA molecule may be further modified by a 2 '-O-Methyltransferase which results in the generation of a cap 1 structure (m7Gppp [m2 '-O] N), which may further increases translation efficacy.
  • nucleic acids may comprise one or more nucleotide analogs or modified nucleotides.
  • nucleotide analog or “modified nucleotide” refers to a nucleotide that contains one or more chemical modifications (e.g., substitutions) in or on the nitrogenous base of the nucleoside (e.g. cytosine (C), thymine (T) or uracil (U)), adenine (A) or guanine (G)).
  • a nucleotide analog can contain further chemical modifications in or on the sugar moiety of the nucleoside (e.g., ribose, deoxyribose, modified ribose, modified deoxyribose, six-membered sugar analog, or open-chain sugar analog), or the phosphate.
  • the preparation of nucleotides and modified nucleotides and nucleosides are well- known in the art, see the following references: US Patent Numbers 4373071, 4458066, 4500707, 4668777, 4973679, 5047524, 5132418, 5153319, 5262530, 5700642. Many modified nucleosides and modified nucleotides are commercially available.
  • Immunogenic compositions according the invention comprise self-replicating RNA molecules that encode polypeptides comprising an antigen from influenza virus.
  • Such compositions may be a vaccine, in particular an RNA based vaccine.
  • Immunogenic compositions according to the invention comprise a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen and a second self-replicating RNA molecule encoding a polypeptide comprising a second antigen.
  • the immunogenic composition according to the invention comprises or contains further self-replicating molecules, such as 3, 4, 5, 6, 7, 8, 9 or 10 self-replicating RNA molecules.
  • the immunogenic composition may comprise a third self-replicating RNA molecule encoding a polypeptide comprising a third antigen from influenza virus and optionally a fourth self-replicating RNA molecule encoding a polypeptide comprising a fourth antigen from influenza virus.
  • further self-replicating RNA molecules may be present in the immunogenic composition of the invention, for example:
  • RNA molecule encoding a polypeptide comprising a 7th antigen from influenza virus and optionally
  • RNA molecule encoding a polypeptide comprising a 9th antigen from influenza virus and optionally
  • a 10th self-replicating RNA molecule encoding a polypeptide comprising a 10th antigen from influenza virus.
  • the first, second, third and/or optional subsequent antigens from influenza virus are all from different strains of influenza virus.
  • the antigen in each self-replicating RNA molecule may be from a different subtype of influenza virus as compared to the remaining antigen/s (e.g. for HA; HI, H2, H3, H5, H7, H9 etc).
  • the immunogenic compositions with 2, 3, 4, 5, 6, 7, 8, 9 or 10 self-replicating molecules contain only these self-replicating RNA molecules.
  • the immunogenic composition comprises or contains up to 10 self-replicating RNA molecules, such as from 2 to 10 self-replicating RNA molecules, from 2 to 8 self-replicating RNA molecules, from 3 to 7 self-replicating molecules, from 3 to 6 self-replicating RNA molecules or from 4 to 6 self-replicating RNA molecules, wherein each self-replicating RNA molecule encodes a polypeptide comprising an antigen from influenza virus and wherein each antigen is from a different strain of influenza virus.
  • the immunogenic composition according to the invention contains from 3 to 10 self-replicating RNA molecules.
  • the first antigen and/or second antigen and/or optional subsequent antigens in the immunogenic compositions of the invention is hemagglutin (HA).
  • HA antigen may be derived from an influenza virus of a past or present seasonal or pandemic strain.
  • HA may be selected from seasonal strains of type HI or H3, or pandemic strains of type HI, H2, H5, H6, H7, H9 or H10, such as H5 or H7.
  • hemagglutinin is the only antigen from influenza virus in the immunogenic composition.
  • the immunogenic composition comprises a first and/or second antigen that is HA from influenza virus HI. In other embodiments, the immunogenic composition comprises a first and/or second antigen that is HA from influenza virus H3. In a further embodiment, the first antigen is from influenza virus HI and the second antigen is from influenza virus H3. In particular, the HI influenza virus strain may be from A/H1N1 and the H3 influenza virus strain may be an A/H3N2 strain.
  • the first and second antigens may be HA derived from the following hemagglutinin strain types respectively: Hl+Hl, H3+H3, H1+H3, H5+H7, H5+H5 or H7+H7.
  • an immunogenic composition of the invention comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen and (ii) a second self- replicating RNA molecule encoding a polypeptide comprising a second antigen, wherein:
  • the first and second antigens are both from influenza virus but the first antigen is from a different strain of influenza virus to the second antigen
  • the first and second antigens are hemagglutinin or an immunogenic fragment or variant thereof
  • an immunogenic composition of the invention comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen and (ii) a second self- replicating RNA molecule encoding a polypeptide comprising a second antigen, wherein:
  • the first and second antigen is hemagglutinin or an immunogenic fragment or variant thereof and
  • the first and second antigens are from influenza viruses with a different hemagglutinin subtype.
  • an immunogenic composition of the invention comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen and (ii) a second self- replicating RNA molecule encoding a polypeptide comprising a second antigen, wherein:
  • the first and second antigens are both from influenza virus but the first antigen is from a different strain of influenza virus to the second antigen
  • the first and second antigen is hemagglutinin or an immunogenic fragment or variant thereof and
  • the first antigen is from a seasonal influenza virus (e.g. a H1N1, H3N2, B/Victoria or B/Yamagata strain) and the second antigen is from a pandemic influenza virus strain.
  • a seasonal influenza virus e.g. a H1N1, H3N2, B/Victoria or B/Yamagata strain
  • the second antigen is from a pandemic influenza virus strain.
  • an immunogenic composition of the invention comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen (ii) a second self- replicating RNA molecule encoding a polypeptide comprising a second antigen, and (iii) a third self- replicating RNA molecule encoding a polypeptide comprising a third antigen, wherein:
  • the first, second and third antigens are both from influenza virus but the first, second and third antigens are all from different strains of influenza virus, - the first, second and third antigens are hemagglutinin or an immunogenic fragment or variant thereof and
  • the first, second and third antigens are both from influenza virus but the first, second and third antigens are all from different strains of influenza virus,
  • the first, second and third antigens are hemagglutinin or an immunogenic fragment or variant thereof and
  • the first and second antigens are from past or present seasonal influenza viruses and the third antigen is from a pandemic influenza virus.
  • the immunogenic composition may comprise multiple self-replicating RNA molecules, where each self-replicating RNA molecule encodes a polypeptide comprising an HA antigen from influenza virus H3.
  • the composition may comprise 2, 3, 4, 5, 6, 7, 8, 9 or 10 self- replicating RNA molecules encoding a polypeptide comprising an HA antigen from influenza virus H3.
  • the HA antigens are selected from strains of the influenza H3N2 subtype.
  • HA antigens are selected from potential pandemic and seasonal strains of the influenza H3N2 subtypes. These strains of the H3N2 subtype may be selected on the basis of the following criteria: 1) major glycosylation sites, 2) important seasonal and pandemic vaccine strains, and 3) cell adapted strains only.
  • the immunogenic composition comprises three self-replicating RNA molecules, wherein: (i) a first self-replicating RNA molecule encodes a polypeptide comprising a first antigen from A/Bilthoven/16398/1968 (EPI362379), (ii) a second self-replicating RNA molecule encodes a polypeptide comprising a second antigen from A/Bangkok/1/79 (EPI367158), (iii) a third self-replicating RNA molecule encodes a polypeptide comprising a third antigen from A/Fujian/411/2002 (EPI362915).
  • the immunogenic composition comprises three self-replicating RNA molecules, wherein: (i) a first self-replicating RNA molecule encodes a polypeptide comprising a first antigen from A/Beijing/32/92 (EPI365898), (ii) a second self-replicating RNA molecule encodes a polypeptide comprising a second antigen from A/Brisbane/10/2007 (EPI362338), and (iii) a third self- replicating RNA molecule encodes a polypeptide comprising a third antigen from A/Texas/50/2012 (EPI398417).
  • the immunogenic composition comprises six self-replicating RNA molecules, wherein: (i) a first self-replicating RNA molecule encodes a polypeptide comprising a first antigen from A/Bilthoven/16398/1968 (EPI362379), (ii) a second self-replicating RNA molecule encodes a polypeptide comprising a second antigen from A/Bangkok/1/79 (EPI367158), (iii) a third self-replicating RNA molecule encodes a polypeptide comprising a third antigen from A/Beijing/32/92 (EPI365898), (iv) a fourth self-replicating RNA molecule encodes a polypeptide comprising a fourth antigen from A/Fujian/411/2002 (EPI362915), (v) a fifth self-replicating RNA molecule encodes a polypeptide comprising a fifth antigen from A/Brisbane/10/
  • the immunogenic composition of all of these embodiments may also include one or more further self-replicating RNA molecules, where one or more further self-replicating RNA molecules encode a polypeptide comprising an HA antigen from influenza virus HI, H5 and/or H7.
  • the self-replicating RNA molecules may encode polypeptides comprising an HA antigen from two different influenza HI viruses.
  • the self-replicating RNA molecules may encode a polypeptide comprising an HA antigen from influenena subtype H5.
  • the self-replicating RNA molecules may also encode a polypeptide comprising an HA antigen from influenena subtype H7.
  • the immunogenic composition comprises ten self-replicating RNA molecules, wherein: (i) a first self-replicating RNA molecule encodes a polypeptide comprising a first antigen from A/Bilthoven/16398/1968 (EPI362379), (ii) a second self-replicating RNA molecule encodes a polypeptide comprising a second antigen from A/Bangkok/1/79 (EPI367158), (iii) a third self-replicating RNA molecule encodes a polypeptide comprising a third antigen from A/Beijing/32/92 (EPI365898), (iv) a fourth self-replicating RNA molecule encodes a polypeptide comprising a fourth antigen from A/Fujian/411/2002 (EPI362915), (v) a fifth self-replicating RNA molecule encodes a polypeptide comprising a fifth antigen from A/Brisbane/10/
  • the immunogenic composition may comprise a viral or a non-viral delivery system.
  • the delivery system (also referred to herein as a delivery vehicle) may have adjuvant effects which enhance the immunogenicity of the encoded antigen from influenza virus.
  • the self- replicating RNA molecules may be encapsulated in liposomes, non-toxic biodegradable polymeric microparticles or viral replicon particles (VRPs), or complexed with particles of a cationic oil-in-water emulsion.
  • the nucleic acid-based vaccine comprises a cationic nano-emulsion (CNE) delivery system or a lipid nanoparticle (LNP) delivery system.
  • CNE cationic nano-emulsion
  • LNP lipid nanoparticle
  • the nucleic acid-based vaccine comprises a non-viral delivery system, i.e., the nucleic acid-based vaccine is substantially free of viral capsid.
  • the nucleic acid-based vaccine may comprise viral replicon particles.
  • the nucleic acid-based vaccine may comprise a naked nucleic acid, such as naked RNA (e.g. mRNA), but delivery via CNEs or LNPs is preferred.
  • the nucleic acid-based vaccine comprises a cationic nano-emulsion (CNE) delivery system.
  • CNE delivery systems and methods for their preparation are described in the following reference: W02012/006380.
  • the nucleic acid molecule e.g. RNA
  • Cationic oil-in-water emulsions can be used to deliver negatively charged molecules, such as an RNA molecule to cells.
  • the emulsion particles comprise an oil core and a cationic lipid.
  • the cationic lipid can interact with the negatively charged molecule thereby anchoring the molecule to the emulsion particles. Further details of useful CNEs can be found in the following references: W02012/006380; W02013/006834; and W02013/006837 (the contents of each of which are incorporated herein in their entirety).
  • the self-replicating RNA molecules encoding a polypeptide comprising an antigen from influenza virus are complexed with a particle of a cationic oil-in-water emulsion.
  • the particles typically comprise an oil core (e.g. a plant oil or squalene) that is in liquid phase at 25°C, a cationic lipid (e.g. phospholipid) and, optionally, a surfactant (e.g. sorbitan trioleate, polysorbate 80); polyethylene glycol can also be included.
  • the CNE comprises squalene and a cationic lipid, such as 1,2- dioleoyloxy-3-(trimethylammonio)propane (DOTAP).
  • DOTAP 1,2- dioleoyloxy-3-(trimethylammonio)propane
  • the delivery system is a non-viral delivery system, such as CNE. This may be particularly effective in eliciting humoral and cellular immune responses. Advantages also include the absence of a limiting anti-vector immune response and a lack of risk of genomic integration.
  • self-replicating RNA molecules according to the invention may be complexed with a submicron cationic oil-in-water emulsion.
  • the cationic oil-in water emulsion is characterized by an average particle size of from about 80 nm to 180 nm in diameter (or alternatively from about 80 to about 150 nm; from about 80 to 130 nm; or from about 100 nm).
  • the concentration of DOTAP in said emulsion, before RNA complexation is at least about 2.5 mM, or from about 2.5 mM to about 8 mM. In a particular embodiment, the concentration of DOTAP in said emulsion is about 4 mg/ml (5.73 mM).
  • the oil can be squalene or squalane.
  • self-relicating RNA molecules are complexed to a cationic oil-in-water emulsion comprising DOTAP, squalene, sorbitan trioleate and polysorbate 80 in citrate buffer.
  • the first and second antigens are both from influenza virus but the first antigen is from a different strain of influenza virus to the second antigen
  • the first and second antigens are hemagglutinin or an immunogenic fragment or variant thereof
  • the first and second antigens are hemagglutinin or an immunogenic fragment or variant thereof
  • RNA molecules are formulated in a cationic nanoemulsion (CNE).
  • CNE cationic nanoemulsion
  • an immunogenic composition of the invention comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen and (ii) a second self- replicating RNA molecule encoding a polypeptide comprising a second antigen, wherein:
  • the first and second antigens are both from influenza virus but the first antigen is from a different strain of influenza virus to the second antigen
  • RNA molecules are formulated in lipid nanoparticles (LNP) or a cationic nanoemulsion (CNE) and
  • an immunogenic composition of the invention comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen (ii) a second self- replicating RNA molecule encoding a polypeptide comprising a second antigen, and (iii) a third self- replicating RNA molecule encoding a polypeptide comprising a third antigen, wherein:
  • the first, second and third antigens are hemagglutinin or an immunogenic fragment or variant thereof and
  • the first, second and third antigens are hemagglutinin or an immunogenic fragment or variant thereof
  • each self- replicating RNA molecule encodes a RNA-dependent RNA polymerase which can transcribe RNA from the self-replicating RNA molecule.
  • a method of preparing an immunogenic composition according to the invention wherein the self-replicating RNA molecules are complexed to a cationic oil-in-water emulsion comprising: (i) providing an oil-in-water emulsion as described herein; (ii) providing an aqueous solution comprising the self-replicating RNA molecules; and (iii) combining the aqueous solution of (ii) and the oil-in-water emulsion of (i), thereby preparing the immunogenic composition.
  • the aqueous solution comprising the RNA molecule may be a buffer.
  • the buffer may comprise one or more salt, buffer, saccharide, or polymer.
  • the buffer comprises 560 mM sucrose, 20 mM NaCI, and 10 mM citrate, which can be mixed with a cationic oil in water emulsion described herein to produce a final aqueous phase that comprises 280 mM sucrose, 10 mM NaCI and 10 mM citrate.
  • lipid nanoparticle LNP
  • the method comprising: (i) providing at least one lipid which forms nanoparticles; (ii) providing an aqueous solution comprising the self-replicating RNA molecules; and (iii) combining the aqueous solution of (ii) and the at least one lipid of (i), thereby preparing the composition.
  • LNP delivery systems and non-toxic biodegradable polymeric microparticles, and methods for their preparation are described in the following references: W02012/006376 (LNP and microparticle delivery systems); Geall et al. (2012) PNAS USA. Sep 4; 109(36): 14604-9 (LNP delivery system); and W02012/006359 (microparticle delivery systems).
  • LNPs are non- virion liposome particles in which a nucleic acid molecule (e.g. RNA) can be encapsulated.
  • the particles can include some external RNA (e.g. on the surface of the particles), but at least half of the RNA (and ideally all of it) is encapsulated.
  • Liposomal particles can, for example, be formed of a mixture of zwitterionic, cationic and anionic lipids which can be saturated or unsaturated, for example; DSPC (zwitterionic, saturated), DlinDMA (cationic, unsaturated), and/or DMG (anionic, saturated).
  • the LNP comprises neutral lipids, cationic lipids, cholesterol and polyethylene glycol (PEG) and forms nanoparticles that encompass the self-amplifying RNA.
  • Preferred LNPs for use with the invention include an amphiphilic lipid (helper lipid(s)) which can form liposomes, optionally in combination with at least one cationic lipid (such as DOTAP, DSDMA, DODMA, DLinDMA, DLenDMA, etc.).
  • helper lipid(s) which can form liposomes, optionally in combination with at least one cationic lipid (such as DOTAP, DSDMA, DODMA, DLinDMA, DLenDMA, etc.).
  • Useful helper lipids include zwitterionic lipids, such as DPPC, DOPC, DSPC, dodecylphosphocholine, l,2-dioleoyl-sn-glycero-3- phosphatidylethanolamine (DOPE), and l,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (DPyPE); sterols, such as cholesterol; and PEGylated lipids, such as PEG-DMPE (PEG-conjugated 1, 2- dimyristoyl-Sn-glycero-3-phosphoethanolamine-N-[methoxy (polyethylene glycol)]) or PEG-DMG (PEG-conjugated 1,2-Dimyristoyl-sn-glycerol, methoxypolyethylene Glycol).
  • zwitterionic lipids such as DPPC, DOPC, DSPC, dodecylphosphocholine, l,2-diole
  • useful PEGylated lipids may be PEG2K-DMPE (PEG-conjugated 1, 2-dimyristoyl-Sn-glycero-3- phosphoethanolamine-N-[methoxy (polyethylene glycol)-2000]) or PEG2K-DMG (PEG-conjugated 1,2- Dimyristoyl-sn-glycerol, methoxypolyethylene Glycol-2000).
  • PEG2K-DMPE PEG-conjugated 1, 2-dimyristoyl-Sn-glycero-3- phosphoethanolamine-N-[methoxy (polyethylene glycol)-2000]
  • PEG2K-DMG PEG-conjugated 1,2- Dimyristoyl-sn-glycerol, methoxypolyethylene Glycol-2000.
  • a mixture of DSPC, DlinDMA, PEG-DMG and cholesterol is particularly effective.
  • LNPs are described in the following references: W02012/006376; W02012/030901; W02012/031046; W02012/031043; W02012/006378; W02011/076807; WO2013/033563; W02013/006825; WO2014/136086; W02015/095340; WO2015/095346; W02016/037053.
  • the LNPs are RV01 liposomes, see the following references: W02012/006376 and Geall et al. (2012) PNAS USA. Sep 4; 109(36): 14604-9.
  • the LNPs are RV01 liposomes wherein the cationic lipid is DLin-DMA.
  • Ri is CH3, R2 and R3 are both H, and Y is C;
  • Ri and R2 are collectively CH2-CH2 and together with the nitrogen form a five-, six-, or seven- membered heterocycloalkyl, R3 is CH3, and Y is C; or
  • R6 is -(CH2)p-0-C(0)-R8 or -Cp-Rs;
  • R 7 is -(CH2)p'-0-C(0)-R 8 ' or -C P' -R 8 ',
  • p and p' are independently 0, 1, 2, 3 or 4;
  • R 8 and R 8' are independently a
  • Ri is CH3, R2 and R3 are both H, and Y is C.
  • Ri and R2 are collectively CH2-CH2 and together with the nitrogen form a five-, six-, or seven- membered heterocycloalkyl, R3 is CH3, and Y is C.
  • Ri is CH3, R2 and R3 are both absent, and Y is O.
  • X is -CH(-R6)-R7
  • Re is -(QH2) P -0-C(0)-R8,
  • R7 is -(QH2) P' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions
  • Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R 6 )-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions
  • Rs' is a -Ci-3-C(-0-Ce-i2)-0-Ce-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-Rs'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions
  • Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions
  • Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions
  • Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0-
  • X is -CH(-R6)-R7
  • Re is -(QH2) P -0-C(0)-R8,
  • R7 is -(QH2) P' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions
  • Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R 6 )-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -Ci-3-C(-0-Ce-i2)-0-Ce-i2 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is -Ci-3-C(-0-Ce-i2)-0-Ce-i2 saturated or unsaturated hydrocarbon chain
  • Rs' is a -Ci-3-C(-0-Ce-i2)-0-Ce-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-Rs'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -Ci-3-C(-0-Ce-i2)-0-Ce-i2 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -Ci-3-C(-0-Ce-i2)-0-Ce-i2 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -Ci-3-C(-0-Ce-i2)-0-Ce-i2 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C6-16 saturated hydrocarbon chain
  • Rs' is a -Cs- 20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C6-16 saturated hydrocarbon chain
  • Rs' is a -C6- i6 saturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C6-16 saturated hydrocarbon chain
  • Rs' is a -C6- i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C[-C-0-C( O )-Ci- 12] -C-0-C( O )-C 4 - 12 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-Rs'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C6-16 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C6-16 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-Re)-R7
  • Re is -(QH2) -0-C(0)-Rs
  • R7 is -(QH2) ' -0-C(0)-R8'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C6-16 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, (3 ⁇ 4 is -(CH2)
  • P -0-C(0)-R8, R7 is -Cp'-Rs', p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions
  • Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7
  • Re is -(QH2)
  • R7 is -C P' -Rs'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions
  • Rs' is a -Ci-3-C(-0-Ce-i2)-0-Ce-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R 6 )-R7
  • R6 is -(CH2)
  • R7 is -C P' -Rs'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions
  • Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated
  • Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated
  • Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, (3 ⁇ 4 is -(CH2)
  • R7 is -Cp'-Rs', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -C6-16 saturated hydrocarbon chain; and Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ce-ie saturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6- i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -C6-16 saturated hydrocarbon chain; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ce-ie saturated hydrocarbon chain; and Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ce-ie saturated hydrocarbon chain; and Rs' is a -C[-C-0-C(0)- C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -C6-16 saturated hydrocarbon chain; and Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7
  • R6 is -(CH2)
  • R7 is -C P '-Rs'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain ; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is Cp'-Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7
  • R6 is -(CH2)
  • R7 is -C P' -Rs'
  • p and p' are independently 0, 1, 2, 3 or 4
  • Rs is a -C6-16 saturated or unsaturated hydrocarbon chain
  • Rs' is a -C(-C6-i6)-Ce-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -(CH2) P -0-C(0)-R8, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and
  • Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and
  • Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2)
  • P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and
  • Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and Rs' is a -C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ce-ie saturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6- i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -C6-16 saturated hydrocarbon chain; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ce-ie saturated hydrocarbon chain; and Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, (3 ⁇ 4 is -C -Rs, R7 is -(CH2)
  • P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -C6-16 saturated hydrocarbon chain; and
  • Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Re, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Re' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -(CH2) P' -0-C(0)-Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Re' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Re, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Re' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Re, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Re' is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Re, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Re' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain ; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2)
  • P' -0-C(0)-Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a -C(-C6-i6)-Ce-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -(CH2) P' -0-C(0)-R8', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a— C[— C— O— C(O)— C 4 - 12]— C— O— C(O)— C 4 - 12 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and
  • Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and
  • Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or
  • X is -CH(-R6)-R7, i3 ⁇ 4 is -C -Rs, R7 is -Cp'-Rs', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and Rs' is a -&-IQ saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and
  • Rs' is a -C(-C6-i6)-Ce-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and
  • Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4;
  • Rs is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions; and
  • Rs' is a -&-IQ saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C(-C6-i6)-Ce-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a— C[— C— O— C(O)— C 4 - 12]— C— O— C(O)— C 4 - 12 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -C6-16 saturated hydrocarbon chain; and Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, i3 ⁇ 4 is -C -Rs, R7 is -Cp'-Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ce-ie saturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ce-ie saturated hydrocarbon chain; and Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ce-ie saturated hydrocarbon chain; and Rs' is a -C[-C-0-C(0)-C 4 -i2]-C-0- C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; Rs is a -Ce-ie saturated hydrocarbon chain; and Rs' is a -Ce-ie saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Rs' is a -C8-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Rs' is a -Ci-3-C(-0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -Cs-2o hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain ; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C(-C6-i6)-C6-i6 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C[-C-0-C( O )-C4- 12] -C-0-C( O )-C 4 - 12 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C[-C-0-C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -Ce-ie saturated or unsaturated hydrocarbon chain; and Rs' is a -Cs-20 hydrocarbon chain having one or two cis alkene groups at either or both of the omega 6 and 9 positions.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 is -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -Ce-ie saturated or unsaturated hydrocarbon chain; and Rs' is a -Ci-3-C(- 0-C6-i2)-0-C6-i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C P -Rs, R7 -C P' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -C6-16 saturated or unsaturated hydrocarbon chain; and Rs' is a -C6-16 saturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C ' -Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -Ce-ie saturated or unsaturated hydrocarbon chain; and Rs' is a -C(-Ce-i6)- C6-16 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, R6 is -C -Rs, R7 is -C ' -Rs", p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -Ce-ie saturated or unsaturated hydrocarbon chain; and Rs' is a -C[-C-0- C(0)-C 4 -i2]-C-0-C(0)-C 4 -i2 saturated or unsaturated hydrocarbon chain.
  • X is -CH(-R6)-R7, i3 ⁇ 4 is -C P -Rs, R7 is -Cp'-Rs', p and p' are independently 0, 1, 2, 3 or 4; and Rs is a -Ce-ie saturated or unsaturated hydrocarbon chain; and Rs' is a -Ce-ie saturated or unsaturated hydrocarbon chain.
  • an exemplary cationic lipid is RV28 having the following structure:
  • an exemplary cationic lipid is RV31 having the following structure:
  • an exemplary cationic lipid is RV33 having the following structure:
  • an exemplary cationic lipid is RV42 having the following structure:
  • an exemplary cationic lipid is RV44 having the following structure:
  • an exemplary cationic lipid is RV73 having the following structure:
  • an exemplary cationic lipid is RV75 having the following structure:
  • an exemplary cationic lipid is RV81 having the following structure:
  • an exemplary cationic lipid is RV84 having the following structure:
  • an exemplary cationic lipid is RV85 having the following structure:
  • an exemplary cationic lipid is RV86 having the following structure:
  • an exemplary cationic lipid is RV88 having the following structure:
  • an exemplary cationic lipid is RV91 having the following structure:
  • an exemplary cationic lipid is RV92 having the following structure:
  • an exemplary cationic lipid is 2-(5-((4-((l,4-dimethylpiperidine-4- carbonyl)oxy)hexadecyl)oxy)-5-oxopentyl)propane-l,3-diyl dioctanoate (RV94), having the following structure:
  • an exemplary cationic lipid is RV95 having the following structure:
  • an exemplary cationic lipid is RV97 having the following structure:
  • an exemplary cationic lipid is RV99 having the following structure:
  • an exemplary cationic lipid is RV101 having the following structure:
  • the cationic lipid is selected from the group consisting of: RV28, RV31, RV33, RV37, RV39, RV42, RV44, RV73, RV75, RV81, RV84, RV85, RV86, RV88, RV91, RV92, RV93, RV94, RV95, RV96, RV97, RV99, and RV101. In an embodiment, the cationic lipid is selected from the group consisting of: RV39, RV88, and RV94.
  • compositions and methods for the synthesis of compounds having Formula I and RV28, RV31, RV33, RV37, RV39, RV42, RV44, RV73, RV75, RV81, RV84, RV85, RV86, RV88, RV91, RV92, RV93, RV94, RV95, RV96, RV97, RV99, and RV101 can be found in PCT/US2014/070882 (publication number WO/2015/095340) and PCT/US2014/070891 (publication number WO/2015/095346), filed 17 Dec 2014; as well as PCT/US2015/048535 (publication number WO/2017/037053), filed 4 Sep 2015.
  • the methods of manufacturing a non-viral delivery system comprising a liposome encapsulating an RNA comprise the following steps: (a) mixing (i) a first solution comprising a solvent, an ionizable cationic lipid, a zwitterionic lipid, a sterol, and a PEGylated lipid selected; and (ii) a second solution comprising water and the RNA; and (b) removing the solvent.
  • the mixing may be carried out in a T-junction device, a microfluidic device, or the like, as described in W02012031046 and/or PCT/IB2018/053850.
  • the immunogenic composition according to the invention may be a pharmaceutical composition e.g. a vaccine composition. Accordingly, the composition may also comprise a pharmaceutically acceptable carrier.
  • a “pharmaceutically acceptable carrier” includes any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition.
  • Suitable carriers are typically large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, sucrose, trehalose, lactose, and lipid aggregates (such as oil droplets or liposomes).
  • Such carriers are well known to those of ordinary skill in the art.
  • the compositions may also contain a pharmaceutically acceptable diluent, such as water, saline, glycerol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present. Sterile pyrogen-free, phosphate-buffered physiologic saline is a typical carrier.
  • compositions may include the immunogenic compositions, nucleic acid sequences, and/or polypeptide sequences described elsewhere herein in plain water (e.g. "w.f.i.") or in a buffer e.g. a phosphate buffer, a Tris buffer, a borate buffer, a succinate buffer, a histidine buffer, or a citrate buffer. Buffer salts will typically be included in the 5-20mM range.
  • Pharmaceutical compositions may have a pH between 5.0 and 9.5 e.g. between 6.0 and 8.0.
  • Compositions may include sodium salts (e.g. sodium chloride) to give tonicity. A concentration of 10 ⁇ 2 mg/mL NaCI is typical, e.g. about 9 mg/mL.
  • compositions may include one or more preservatives, such as thiomersal or 2-phenoxyethanol.
  • Mercury-free compositions are preferred, and preservative-free vaccines can be prepared.
  • Pharmaceutical compositions may be aseptic or sterile.
  • Pharmaceutical compositions may be non-pyrogenic e.g. containing ⁇ 1 EU (endotoxin unit, a standard measure) per dose, and preferably ⁇ 0.1 EU per dose.
  • Pharmaceutical compositions may be gluten free.
  • Pharmaceutical compositions may be prepared in unit dose form. In some embodiments a unit dose may have a volume of between 0.1 -1.0 ml. e.g. about 0.5ml_.
  • compositions disclosed herein are immunogenic composition that, when administered to a subject, induce a humoral and/or cellular antigen-specific immune response (i.e. an immune response which specifically recognizes a naturally occurring influenza virus antigen polypeptide).
  • an immunogenic composition may induce a memory T and/or B cell population relative to an untreated subject following influenza virus infection.
  • the subject is a vertebrate, such as a mammal e.g. a human or a veterinary mammal.
  • the immunogenic compositions of the invention can be formulated as vaccine compositions.
  • the vaccine will comprise an immunologically effective amount of antigen.
  • an immunologically effective amount is intended that the administration of that amount to a subject, either in a single dose or as part of a series, is effective for inducing a measurable immune response against influenza virus in the subject. This amount varies depending upon the health and physical condition of the individual to be treated, age, the taxonomic group of individual to be treated (e.g.
  • Vaccines as disclosed herein may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat infection), but will typically be prophylactic.
  • the vaccine compositions disclosed herein may induce an effective immune response against an influenza virus infection, i.e., a response sufficient for treatment or prevention of a influenza virus infection.
  • the immunogenic composition of the invention further comprises an additional antigen.
  • the immunogenic composition is administered to a subject in combination with a further composition which comprises an additional antigen.
  • a pharmaceutical composition (such as a vaccine composition) which comprises or consists of (i) from 3 to 10 self-replicating RNA molecules wherein each self-replicating RNA molecule encodes a polypeptide comprising an antigen from influenza virus, wherein each antigen is from a different strain of influenza virus to the other antigens and wherein the self-replicating RNA molecules are formulated in lipid nanoparticles (LNP) (iii) a pharmaceutical carrier, diluent and/or buffer and optionally (iii) an adjuvant.
  • LNP lipid nanoparticles
  • a vaccine composition which comprises or consists of (i) from 3 to 10 self-replicating RNA molecules formulated in lipid nanoparticles (LNP) and (ii) a pharmaceutical carrier, diluent and/or buffer, wherein:
  • each self-replicating RNA molecule encodes a polypeptide comprising an antigen from influenza virus, - each antigen is from a different strain of influenza virus to the other antigens and
  • An immunogenic composition of the present invention may also comprise, or be administered in conjunction with, one or more adjuvants (e.g. vaccine adjuvants).
  • adjuvant e.g. vaccine adjuvants
  • adjuvant compositions as disclosed herein further comprise one or more immunostimulants, for example, a saponin such as QS21.
  • Adjuvants which may be used in compositions of the invention include, but are not limited to: (A) Mineral- containing compositions, for example aluminum and calcium salts, such as aluminum phosphates. (B) Oil emulsions, for example squalene-in-water emulsions, such as MF59 or AS03. Complete Freund's adjuvant (CFA) and incomplete Freund's adjuvant (IF A) may also be used. (C) Saponin formulations. (D) Virosomes and virus-like particles (VLPs).
  • E Bacterial or microbial derivatives such as non-toxic derivatives of enterobacterial lipopolysaccharide (LPS), Lipid A derivatives, immunostimulatory oligonucleotides and ADP-ribosylating toxins and detoxified derivatives thereof.
  • LPS enterobacterial lipopolysaccharide
  • LPS Lipid A derivatives
  • immunostimulatory oligonucleotides immunostimulatory oligonucleotides and ADP-ribosylating toxins and detoxified derivatives thereof.
  • Human immunomodulators for example cytokines, such as interleukins, interferons, macrophage colony stimulating factor, and tumor necrosis factor.
  • G Bioadhesives and mucoadhesives, such as esterified hyaluronic acid microspheres, cross-linked derivatives of poly(acrylic acid), polyvinyl alcohol, polyvinyl pyrollidone, polysaccharides and carboxymethylcellulose.
  • Microparticles for example particles of ⁇ 100nm to ⁇ 150pm in diameter, more preferably ⁇ 200nm to ⁇ 30pm in diameter, and most preferably ⁇ 500nm to ⁇ 10 pm in diameter
  • materials that are biodegradable and non-toxic e.g. a poly(a-hydroxy acid), a polyhydroxybutyric acid, a polyorthoester, a polyanhydride, a polyca prolactone, etc.
  • a negatively-charged surface e.g. with SDS
  • a positively- charged surface e.g. with a cationic detergent, such as CTAB.
  • J Polyoxyethylene ether and polyoxyethylene ester formulations.
  • K Polyphosphazene (PCPP).
  • L Muramyl peptides.
  • M Imidazoquinolone compounds, for example Imiquamod and its homologues.
  • Combinations of one or more of the adjuvants identified above may also be used with the invention.
  • kits for inducing an immune response against influenza virus infection in a subject in need thereof comprising a step of administering an immunologically effective amount of the immunogenic or pharmaceutical compositions as disclosed herein.
  • subject is intended a vertebrate, such as a mammal e.g. a human or a veterinary mammal. In some embodiments the subject is human.
  • immunological response is intended a humoral and/or cellular antigen-specific immunological response (i.e. an immune response which specifically recognizes an antigen polypeptide) that can be demonstrated to neutralize influenza virus in vitro or control/reduce/eliminate infection virus infection in vivo.
  • the immune response is characterized by immunological memory against the influenza virus and/or an effective influenza virus-responsive memory T cell population.
  • the compositions disclosed herein are for use in therapy or medicine.
  • the therapy is a vaccine therapy.
  • the therapy is a vaccine to prevent influenza virus infection.
  • a composition disclosed herein is for use in preventing or treating influenza or for use in preventing or treating influenza virus infection in a subject in need thereof.
  • a composition disclosed herein is for use in inducing an immune response against a influenza virus infection in a subject in need thereof.
  • a composition described herein may be for use in preventing influenza virus infection by multiple different strains of influenza virus, or for inducing an immune response to an infection by any one of multiple different strains of influenza virus.
  • a composition may be for use in preventing or shortening influenza virus infection against two or more HI and/or two or more H3 type strains of influenza virus.
  • the composition may be for preventing or shortening influenza virus infection against both seasonal and pandemic strains of influenza virus.
  • the composition described herein may be for use in preventing influenza virus infection against homologous and/or heterologous strains of influenza virus.
  • the composition may be for use in preventing influenza virus infection against intrasubtypic and/or heterosubtypic strains of influenza virus.
  • an immunogenic or pharmaceutical composition as disclosed herein for use in preventing influenza virus infection against intrasubtypic strains of influenza virus.
  • a vaccine composition for use in preventing influenza virus infection against homologous and/or heterologous strains of influenza virus wherein the vaccine composition comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen and (ii) a second self-replicating RNA molecule encoding a polypeptide comprising a second antigen, wherein:
  • the first and second antigens are hemagglutinin or an immunogenic fragment or variant thereof and
  • RNA molecules are formulated in lipid nanoparticles (LNP) or a cationic nanoemulsion (CNE).
  • LNP lipid nanoparticles
  • CNE cationic nanoemulsion
  • a vaccine composition for use in preventing influenza virus infection against homologous and/or heterologous strains of influenza virus wherein the vaccine composition comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen and (ii) a second self-replicating RNA molecule encoding a polypeptide comprising a second antigen, wherein:
  • the first and second antigens are both from influenza virus but the first antigen is from a different strain of influenza virus to the second antigen
  • the first and second antigens are hemagglutinin or an immunogenic fragment or variant thereof
  • RNA molecules are formulated in lipid nanoparticles (LNP) or a cationic nanoemulsion (CNE) and
  • a vaccine composition for use in preventing influenza virus infection against homologous and/or heterologous intrasubtypic strains of influenza virus wherein the vaccine composition comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen and (ii) a second self-replicating RNA molecule encoding a polypeptide comprising a second antigen, wherein:
  • the first and second antigens are both from influenza virus but the first antigen is from a different strain of influenza virus to the second antigen
  • the first and second antigens are hemagglutinin or an immunogenic fragment or variant thereof and
  • each self- replicating RNA molecule encodes a RNA-dependent RNA polymerase which can transcribe RNA from the self-replicating RNA molecule.
  • a vaccine composition for use in preventing influenza virus infection against homologous and/or heterologous intrasubtypic strains of influenza virus wherein the vaccine composition comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen (ii) a second self-replicating RNA molecule encoding a polypeptide comprising a second antigen, and (iii) a third self-replicating RNA molecule encoding a polypeptide comprising a third antigen, wherein:
  • the first, second and third antigens are both from influenza virus but the first, second and third antigens are all from different strains of influenza virus,
  • the first, second and third antigens are hemagglutinin or an immunogenic fragment or variant thereof and
  • a vaccine composition for use in preventing influenza virus infection against homologous and/or heterologous intrasubtypic strains of influenza virus wherein the vaccine composition comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen (ii) a second self-replicating RNA molecule encoding a polypeptide comprising a second antigen, and (iii) a third self-replicating RNA molecule encoding a polypeptide comprising a third antigen, wherein:
  • the first, second and third antigens are both from influenza virus but the first, second and third antigens are all from different strains of influenza virus,
  • the first, second and third antigens are hemagglutinin or an immunogenic fragment or variant thereof, and
  • a vaccine composition for use in preventing influenza virus infection against homologous and/or heterologous intrasubtypic strains of influenza virus wherein the vaccine composition comprises (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen (ii) a second self-replicating RNA molecule encoding a polypeptide comprising a second antigen, and (iii) a third self-replicating RNA molecule encoding a polypeptide comprising a third antigen, wherein:
  • the first, second and third antigens are hemagglutinin or an immunogenic fragment or variant thereof
  • each self- replicating RNA molecule encodes a RNA-dependent RNA polymerase which can transcribe RNA from the self-replicating RNA molecule.
  • methods are provided for preventing or shortening influenza virus infection against multiple different strains of influenza virus.
  • the methods may be for preventing or shortening influenza virus infection against two or more HI and/or two or more H3 type strains of influenza virus and optionally against two or more strains of influenza B virus.
  • the methods may be for preventing or shortening influenza virus infection against both seasonal and pandemic strains of influenza virus.
  • the methods described herein may be for use in preventing influenza virus infection against homologous and/or heterologous strains of influenza virus.
  • composition disclosed herein in the manufacture of an immunogenic composition for preventing or shortening influenza virus infection in a subject and/or reducing or prevent the clinical symptoms upon influenza virus infection in a subject.
  • the subject is a human subject.
  • the human subject has been exposed, or is at risk of being exposed, to an influenza virus infection.
  • a method of prevention and/or treatment against influenza disease comprising (i) the administration of a first immunogenic composition comprising a first self-replicating RNA molecule and pharmaceutically acceptable carrier and (ii) simultaneous or sequential administration of a second immunogenic composition comprising a second self-replicating RNA molecule and pharmaceutically acceptable carrier, wherein the first and second self-replicating RNA molecules each encode a polypeptide encoding an antigen from influenza virus but the first self-replicating RNA molecule encodes an antigen from a different strain of influenza to that encoded by the second self-replicating RNA molecule.
  • compositions may be administered sequentially, for example at substantially the same time such as at an interval of less than 10 hours, from 1 second to 10 hours or from 1 second to 1 hour, or at larger intervals of from 10 hours to 6 months, from 10 hours to 1 month, from 10 hours to 2 weeks, from 10 hours to 1 week or from 10 hours to 1 day.
  • the sequential administration is at an interval of from 1 second to 10 hours.
  • the first or second immunogenic composition may comprise one or more additional (e.g.
  • RNA molecules each encoding a polypeptide comprising an antigen from influenza virus, but wherein the antigen in each self-replicating RNA molecule is from a different strain of influenza virus to the other antigens from influenza virus.
  • a method of prevention and/or treatment against influenza disease comprising (i) the administration of a first immunogenic composition comprising a first self-replicating RNA molecule and pharmaceutically acceptable carrier and (ii) simultaneous or sequential administration of a second immunogenic composition comprising a second self-replicating RNA molecule and pharmaceutically acceptable carrier, wherein:
  • the first and second self-replicating RNA molecules each encode a polypeptide encoding an antigen from influenza virus but the first self-replicating RNA molecule encodes an antigen from a different strain of influenza to that encoded by the second self-replicating RNA molecule
  • the antigen from influenza virus is hemagglutinin or an immunogenic fragment or variant thereof and
  • the second immunogenic composition is administered from 1 day to 6 months after the first immunogenic composition.
  • a first immunogenic composition comprising a first self-replicating RNA molecule and a pharmaceutically acceptable carrier for use in a method of preventing influenza disease, said method comprising administration to a subject in need the first immunogenic composition followed by administration of a second immunogenic composition comprising a self-replicating RNA molecule and a pharmaceutically acceptable carrier, wherein the first and second self-replicating RNA molecules each encode a polypeptide comprising an antigen, wherein the antigen is from influenza virus but the antigen encoded by the first self-replicating RNA molecule is from a different strain of influenza virus to that encoded by the second self-replicating RNA molecule.
  • compositions may be administered at an interval of less than 10 hours, from 1 second to 10 hours or from 1 second to 1 hour, or at larger intervals of from 10 hours to 6 months, from 10 hours to 1 month, from 10 hours to 2 weeks, from 10 hours to 1 week or from 10 hours to 1 day.
  • the first/second immunogenic composition may comprise one or more additional (e.g. a 3rd, 4th, 5th, 6th, 7th, 8th, 9th and/or 10th) self-replicating RNA molecules each encoding a polypeptide comprising an antigen from influenza virus, but wherein the antigen in each self-replicating RNA molecule is from a different strain of influenza virus to the other antigens from influenza virus.
  • the antigen from influenza virus is hemagglutinin or an immunogenic fragment or variant thereof and
  • compositions disclosed herein will generally be administered directly to a subject.
  • Direct delivery may be accomplished by parenteral injection (e.g. subcutaneously, intra peritonea I ly, intravenously, intramuscularly, intraderma I ly, or to the interstitial space of a tissue).
  • Alternative delivery routes include rectal, oral (e.g. tablet, spray), buccal, sublingual, vaginal, topical, transdermal or transcutaneous, intranasal, ocular, aural, pulmonary or other mucosal administration.
  • Intradermal and intramuscular administration are two preferred routes. Injection may be via a needle (e.g. a hypodermic needle), but needle-free injection may alternatively be used.
  • the dose volume may be from 0.25ml to 1 ml, in particular 0.5 ml or 0.7 ml. Slight adaptation of the dose volume will be made routinely depending on the RNA concentration in the original bulk sample and depending also on the delivery route, with smaller doses being given by the intranasal or interdermal route.
  • a typical human intramuscular dose volume is 0.5 ml.
  • a dose of a self-replicating RNA vaccine may have about 50 pg to about 100 pg nucleic acid.
  • a vaccine dose contains 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or 100 pg self- replicating RNA.
  • a dose of a composition according to the invention may have ⁇ 10pg self-replicating RNA; e.g. from l-10pg, such as about lpg, 2.5pg, 5pg, 7.5pg or lOpg, but expression can be seen at much lower levels; e.g. using ⁇ lpg/dose, ⁇ 100ng/dose, ⁇ 10ng/dose, ⁇ lng/dose, etc.
  • a composition described herein (such as a vaccine composition) has an effective dose that is less than or equal to 50%, 40%, 30%, 20% or 10% of the effective dose of a DNA vaccine or vaccine composition encoding the same antigen.
  • a vaccine described herein has an effective dose that is one third or less of the effective dose of a DNA vaccine or vaccine composition encoding the same antigen.
  • the process of manufacturing a self-replicating RNA comprises a step of in vitro transcription (IVT) as described elsewhere herein.
  • the process of manufacturing a self-replicating RNA comprises a step of IVT to produce a RNA, and further comprises a step of combining the RNA with a non-viral delivery system as described elsewhere herein.
  • the process of manufacturing a self-replicating RNA comprises a step of IVT to produce a RNA, and further comprises a step of combining the RNA with a CNE or LNP delivery system as described elsewhere herein.
  • Identity or homology with respect to an amino acid sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the reference amino acid sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
  • Identity or homology with respect to a nucleic acid sequence is defined herein as the percentage of nucleotides in the candidate sequence that are identical with the reference nucleic acid sequence after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity.
  • Sequence identity can be determined by standard methods that are commonly used to compare the similarity in position of the amino acids of two polypeptides. Using a computer program such as BLAST, two polypeptides are aligned for optimal matching of their respective amino acids (either along the full length of one or both sequences or along a pre-determined portion of one or both sequences). The programs provide a default opening penalty and a default gap penalty, and a scoring matrix such as PAM 250 [a standard scoring matrix; see Dayhoff et al., in Atlas of Protein Sequence and Structure, vol. 5, supp. 3 (1978)] can be used in conjunction with the computer program.
  • PAM 250 a standard scoring matrix; see Dayhoff et al., in Atlas of Protein Sequence and Structure, vol. 5, supp. 3 (1978)
  • the percent identity can then be calculated as: the total number of identical matches multiplied by 100 and then divided by the sum of the length of the longer sequence within the matched span and the number of gaps introduced into the shorter sequences in order to align the two sequences.
  • the same methods used to compare polypeptides can also be used to calculate the percent identity of two polynucleotide sequences.
  • Example 1 materials and methods
  • influenza H3N2 subtypes were selected on the basis of three major criteria 1) major glycosylation sites 2) important seasonal and pandemic vaccine strains 3) cell adapted strains only. Sequence information for full length genes encoding for influenza HA proteins was obtained from the Global Initiative on Sharing All Influenza Data Epiflu database (www.qisaid.orqj.
  • H3N2 HA gene segments from A/Bilthoven/16398/1968 (EPI362379), A/Bangkok/1/79 (EPI367158), A/Beijing/32/92 (EPI365898), A/Fujian/411/2002 (EPI362915), A/Brisbane/10/2007 (EPI362338) and A/Texas/50/2012 (EPI398417) were selected.
  • SAM(HA) vaccine constructs SAM (Hl-Cal), SAM (H1-PR8), SAM (H5-turkey),
  • SAM vector TC83 a bicistronic SAM construct (Fig. la) harboring two HA genes, H5 and HI, was produced by cloning the second HA gene downstream of the full length 2A-driven sequence using a splicing by overlap extension (SOEing) method with monomeric HA forms as primary PCR templates.
  • SOEing overlap extension
  • HA genes were either chemically synthesized (GeneArt, Thermo Fischer, USA) or amplified from the reverse-transcribed RNA genome of influenza H1N1 A/California/07/2009 using forward primer 5'-ATT CCC GTC GAC GCC ACC ATG AAG GCA ATA CTA GTA GTT CT-3' and reverse primer 5 '-ATT TAC GCC TAG GTT ATC AAA TAC ATA TTC TAC ACT GTA GAG AC-3').
  • H5 HA gene (H5) from A/turkey/Turkey/01/2005 (H5N1) virus strain was also amplified. Further, H7 HA gene from A/Shanghai/2/2013 was amplified from a DNA fragment, assembled based on a previously described enzymatic isothermal assembly method with error correction (Dormitzer et al, Sci Transl Med 2013, 15;5(185): 185ra68), using forward primer 5'-AAT TAA GTC GAC GCC ACC ATG AAC ACT CAA ATC CTG GTA TTC G-3' and reverse primer 5'-AAT TAA TCT AGA TTA TCA TAT ACA AAT AGT GCA CCG CAT G-3'. Amplicons were cloned into the A836 TC83 vector shown as SEQ ID NO: [INSERT no. for TC83 sequence].
  • Plasmids were amplified in Escherichia coli and purified using Qiagen maxi Kits (Qiagen, Valencia, CA, USA). DNA was linearized immediately following the 3' end of the self-amplifying RNA sequence by restriction digestion with Pmel. Linearized DNA plasmids were transcribed in to RNA using MEGAscript T7 Kit (Life Technologies) and purified by LiCI precipitation. RNA was then capped using the ScriptCap m 7 G capping system (Cell Script) and purified by 2.8 M LiCI precipitation before formulation. Protein expression was confirmed by Western blot analysis of transfected baby hamster kidney (BHK) cell lysate.
  • RNA amplification efficiency was carried out, as previously reported (Magini et al, PLoS One 2016;l l(8):e0161193). Briefly, BHK cells were electroporated with 200 ng of RNA and incubated for overnight (15-17) hours at 37° C and 5% CO2. Next day, cells were collected and stained with Live/Dead Aqua (Invitrogen), APC-conjugated anti-double stranded (ds) RNA antibody (J2 monoclonal mouse antibody IgG2a kappa chain, Bioclass). Frequencies of dsRNA-i- cells were analyzed by FACS CANTO II flow cytometer (BD Biosciences).
  • HA from replicon RNA 10 6 BHK cells were transfected with 3 pg of each RNA using Lipofectamine 2000TM (LifeTechnologies, CA, USA). Cells were harvested 16 hours after transfection and lysed in 100 pL of IX radio-immunoprecipitation assay (RIPA) buffer (Cell Signaling Technology, MA, USA) with complete protease inhibitor cocktail (Roche, Madison, WI, USA). Lysates were subjected to SDS-PAGE and blotted on to PVDF membrane. Protein expression was detected with HA-specific monoclonal or polyclonal antibodies.
  • RIPA IX radio-immunoprecipitation assay
  • RNAs were mixed prior to encapsulation in LNPs. Formulations were characterized for particle size, RNA concentration, encapsulation efficiency and RNA integrity (using gel electrophoresis) as previously described (Hekele et al, Emerg Microbes Infect 2013). Encapsulation of RNA within LNP was carried out as described previously (Geall et al Proc Natl Acad Sci USA 2012;109: 14604-9). DLinDMA was synthesized as previously described (Heyes et al, J Control Release 107:276-287). The l,2-Diastearoyl-sn-glycero-3-phosphocholine (DSPC) was purchased from Genzyme. Cholesterol was obtained from Sigma-Aldrich.
  • PEG DMG 2000 l,2-dimyristoyl-sn-glycero-3- phosphoethanolamine-/V-[methoxy(polyethylene glycol)-2000] (ammonium salt)
  • PEG DMG 2000 was obtained from Avanti Polar Lipids.
  • An ethanol dilution process was used to produce the LNP formulation with the following molar ratios of lipid components: DSPC: cholesterol: PEG-DMG 2000: DLinDMA 10:48:2:40 molar percent.
  • LNPs obtained (“RV01" LNPs) were concentrated and dialyzed against lx PBS using tangential flow filtration (TFF) (Spectrum Labs) with polyethersulfone (PES) hollow fiber membranes with a 100-kDa pore size cutoff and 20 cm 2 surface area.
  • TMF tangential flow filtration
  • PES polyethersulfone
  • formulations were diluted to the required RNA concentration with lx PBS (Teknova).
  • mice were housed in the GlaxoSmithKline (GSK) Vaccines Animal Facilities, in compliance with ARRIVE guidelines and with the GSK Animal Welfare Policy and Standards.
  • mice were immunized intramuscularly (i.m.) with each 0.1 pg of each LNP encapsulated monocistronic or bicistronic SAM RNA separately: SAM (Hl-Cal); SAM (H5- turkey); SAM (H5-H1) or in combination of groups: SAM(H1)+SAM(H5); SAM(H3-Biltho)+SAM(H3- Bang)+SAM(H3-Fuj) [group 2], SAM(H3-Beij)+SAM(H3-Bris)+SAM(H3-Tex) [group 3], SAM(H1- Cal)+SAM(Hl-PR8)+SAM(H5-turkey)+SAM (H7-Shan) [group 4], SAM(H3-Biltho)+SAM(H3- Bang)+SAM(H3-Fuj)+SAM(H3-Beij)+SAM(H3-Beij)+
  • Serum Ab titers measured by hemagglutination inhibition (HI) assays were performed according to standard procedure using a 0.5% suspension of adult turkey erythrocytes. To inactivate nonspecific inhibitors, all serum samples were pre-treated with receptor-destroying enzymes (DENKA, Tokyo, Japan) according to manufacturer's instructions. Duplicate of individual sera were serially 2- fold diluted in V-bottom microtiter plates to achieve serum final dilutions of 1: 10. Diluted sera samples were incubated with an equal volume of strain-specific influenza antigen for 60 min at room temperature followed by 60 min incubation with 0.5% turkey red blood cell suspension. The outcomes were analyzed by visual inspection and HI titres calculated as the reciprocal of the last serum dilution at which the last complete agglutination occurred.
  • HI hemagglutination inhibition
  • T-cells were stained with anti-CD3- PerCp-Cy5.5, anti-CD4-BV510, anti-CD8-PE-Texas Red, anti-CD44-240 V450, anti-IFN-g Bv785, anti- IL-2-PEcy5, anti-TNF-BV605 (All from eBiosciences).
  • Example 2 Generation and characterisation of SAM vaccines expressing one or more influenza HA antigens
  • HA monocistronic SAM
  • SAM SAM (H1-PR8), SAM (H3-Biltho), SAM (H3-Bang), SAM (H3-Beij), SAM (H3-Fuj), SAM (H3-Bris), SAM (H3-Tex) and SAM (H7-Shan) were generated.
  • In-vitro synthesis of RNAs from all the SAM replicons was carried out by enzymatic transcription reaction from linearized DNA. Selfamplification efficiency of RNA was measured by quantitative detection of the intracellular dsRNA in BHK cells, followed by flow cytometric analysis.
  • LNP/RNA particle size and encapsulation efficiency data suggest that LNP are excellent delivery vehicles for nucleic acid delivery. Agarose gel electrophoresis showed that RNA integrity was maintained during formulation.
  • Example 3 Humoral immune responses following monocistronic SAM(Hl-Cal), SAM(H5- turkey) or bicistronic SAM (H5-H1) vaccines
  • mice groups of 10 Balb/c mice vaccinated i.m. twice, 3 weeks apart, with 0.1 pg of SAM (Hl-Cal), SAM (H5-turkey), a mixture of both SAM(H1)+SAM(H5) or SAM (H5-H1) and formulated with LNP. Serum samples were collected about 3 weeks after the first immunization and 2 weeks after the second immunization. However, only final serum samples were analyzed for antibody responses because previous results suggested that SAM vaccines can induce immune responses already at 3 weeks after a first immunization (Hekele et al, Emerg Microbes Infect, 2013; 2, e52).
  • Serum samples from vaccinated Balb/c mice were tested for the presence of HA-specific functional antibodies by HI assays.
  • Animals that received monocistronic SAM(H1-Cal)/LNP or SAM(H5- turkey)/LNP vaccine candidates developed geometric mean titer (GMT) of 597 and 905, respectively against homologous A/California/07/2009 (H1N1) and A/turkey/Turkey/5/2005 (H5Nl)(Fig 2 a & b).
  • GTT geometric mean titer
  • HI GMTs of bicistronic of SAM(H5-H1)/LNP appeared more than two fold lower than monocistronic vaccines against A/California/07/2009 (H1N1) and A/turkey/Turkey/5/2005 (H5N1) viruses suggesting that combinations of two different influenza antigens in a single SAM vector is not effective in boosting functional antibody responses (Fig 2 a & b).
  • the combination of SAM(H1)+SAM(H5)/LNP candidate vaccines induced comparable responses to monocistronic SAM(H1- Cal) or SAM(H5-turkey) and the difference was not statistically significant (Fig 2 a & b).
  • HA bicistronic SAM
  • Example 4 Cellular immune responses following monocistronic SAM(Hl-Cal), SAM(H5- turkey) or bicistronic SAM (H5-H1) vaccines
  • mice were immunized with 0.1 pg of SAM/LNP and splenocytes were collected 2 weeks after the second vaccination and stimulated in-vitro with peptide pools covering full length HA sequence from Hl-Cal and H5-turkey.
  • the frequencies of antigen-specific CD4 + and CD8 + cytokine producing (IFN-g, TNFa and IL-2) T-cells were analyzed by flow cytometry.
  • Splenocytes from Balb/c mice vaccinated with SAM (Hl-Cal) and SAM (H5-turkey) were stimulated with peptide pools spanning full length HA from Hl/PR/8 influenza virus for determination of heterologous T-cell responses.
  • Stimulated CD4 + and CD8 + T-cells reacted with mismatched H1-PR8 peptide pools (Fig 2 g, j & m) suggesting the presence of shared T-cell epitopes in HA antigens from heterologous virus strains.
  • Cross-reactive T-cell responses against bicistronic vaccine candidates were not tested because of limitations in the amount of splenocytes.
  • Example 5 - Vaccination with a cocktail of SAM vectors expressing HA of H3, HI, H5 and H7 influenza subtypes
  • multivalent vaccines comprised of cocktails of 10 SAM replicons expressing HAs from four different influenza subtypes (H1N1, H3N2, H5N1 and H7N9) have been assessed.
  • Cocktails of 3, 4, 6 or 10 different mRNAs were encapsulated in lipid nanoparticles (LNP).
  • LNP lipid nanoparticles
  • Groups of 10 Balb/c mice were immunized i.m. with multivalent SAM (HA) vaccine or PBS.
  • Sera samples were collected 2 weeks after second immunization (day 35) and functional antibodies were studied by HI assays.
  • mice were analyzed with influenza HA viral antigens that were identical to those contained in the SAM (HA) cocktail vaccines (homologous responses) (Fig 3 a to g). All vaccinated mice were shown to induce functional antibody responses. Functional antibody responses against the vaccine cocktail groups containing 3 SAM(HAs) (group 2 and 3) showed stronger responses than cocktail group 6 (containing 10 SAM(HAs).
  • SAM SAM
  • CD4 + T-cell responses provide protection against mismatched influenza virus.
  • groups of mice were vaccinated with multivalent SAM (HA) vaccine twice, 3 weeks apart.
  • CD4 + T cells responses were analyzed by in-vitro stimulation of splenocytes from vaccinated Balb/c mice with full length recombinant HA proteins and peptide pools.
  • CD4 + T-cell responses against HA recombinant proteins or peptides from homologous influenza viruses were tested: A/Fujian/411/2002, A/Brisbane/10/2007, A/Texas/50/2012 (H3N2), A/turkey/Turkey/1/2005 (H5N1) and A/California/07/2009, A/PR/8/1934 (H1N1). Results demonstrated CD4+ T cell responses against all homologous influenza HAs (Fig 4 a to f).
  • mice splenocyteswith intrasubtypic and heterosubtypic virus strains were analyzed mice splenocyteswith intrasubtypic and heterosubtypic virus strains. All SAM (HA) vaccine groups containing H3 (groups 2, 3, 5 and 6) HA induced cross reactive CD4+ T cell responses against distantly or closely related H3N2 influenza virus strains.
  • Glycosylation pattern directly contributes to virulence and is partially responsible for distinct antigenicity of influenza viruses. Glycosylation sites present on the globular head domain of HA can tolerate substitutions without compromising functionality and antibodies generated are generally strain-specific with limited breadth of cross reactivity (Gomez Lorenzo et al, Chest 2013; 143:502-10). In contrast, the HA stem domain is highly conserved across several virus strains and in many studies antibodies directed against the stem are found with cross neutralizing properties (Sun et al, J Virol, 2013;87:8756-66 and Nabel et al, Nat Med 2010; 16: 1389-91). Therefore, HA is an attractive candidate for a multivalent influenza vaccine.
  • the experiments described herein use a cocktail strategy by combining 3, 4, 6, or 10 SAM (HA) from H I, H3, H5 and H7 subtypes for exploring cross-protective B and T-cell immune responses in a Balb/c mice model. Sequences for particular strains are shown in Table 2. Multivalent SAM (HA) vaccines were tested for the induction of functional antibodies directed against homologous and heterologous influenza virus by HI assays. Homologous and intrasubtypic antibody responses were observed (Fig 3 h, i, j and I) because of high amino acid homology (see Table 1 below).
  • ClustalW (EMBL-EBI) tool was used for amino acid similarity search for full length HA gene sequences of Hl-Cal (A/California/07/2009); H1-PR8 (A/PR/8/1934); H5-turkey (A/turkey/Turkey/5/2005); H3- Biltho (A/Bilthoven/16398/1968); H3-Bang (A/Bangkok/1/79); H3-Beij (A/Beijing/32/92); H3-Fuj (A/Fujian/411/2002); H3-Bris (A/Brisbane/10/2007); H3-Tex (A/Texas/50/2012); H7-Anh (A/Anhui/1/2013); H3-Mem (A/Memphis/1/1971); H3-Mos (A/Moscow/10/1999); H2-Jap (A/Japan/305/1957); HlO-Ho
  • Table 2 sequences obtained from Global Initiative on Sharing All Influenza Data Epiflu database (www.gisaid.org)
  • an alternative vaccine platform technology based on SAM technology, is used to deliver multiple influenza antigens simultaneously and induce protective immune responses.
  • This vaccine platform technology can induce a broad spectrum of immune responses and deliver multiple influenza antigens simultaneously without compromising antiginicity. This technology might be beneficial for the development of a universal influenza vaccine.
  • An immunogenic composition comprising: (i) a first self-replicating RNA molecule encoding a polypeptide comprising a first antigen and (ii) a second self-replicating RNA molecule encoding a polypeptide comprising a second antigen, wherein the first and second antigens are both from influenza virus but the first antigen is from a different strain of influenza virus to the second antigen.
  • Clause 3 The immunogenic composition of clause 1 wherein the first and second antigens are an immunogenic fragment or variant of hemagglutinin (HA).
  • HA hemagglutinin
  • the immunogenic composition of any preceding clause wherein the first and second antigens are the only antigens derived from influenza virus in the self-replicating RNA molecules.
  • the immunogenic composition of any preceding clause further comprising: (iii) a third self-replicating RNA molecule encoding a polypeptide comprising a third antigen, wherein the third antigen is from influenza virus but is from a different strain of influenza virus to both the first and second antigens.
  • Clause 7 The immunogenic composition of clause 6 wherein the first, second and third antigens are the only antigens derived from influenza virus in the self-replicating RNA molecules.
  • Clause 8 The immunogenic composition of clause 6 or 7 further comprising: (iii) a fourth self- replicating RNA molecule encoding a polypeptide comprising a fourth antigen, wherein the fourth antigen is from influenza virus but is from a different strain of influenza virus to both the first, second and third antigens.
  • Clause 10 The immunogenic composition of any one of clauses 1 to 8 wherein the first and second antigens are from influenza A subtype H3, and wherein both antigens are derived from different strains of H3 influenza virus.
  • Clause 11 The immunogenic composition of clause 8 wherein the first and second antigens are from influenza A subtype HI and the third and fourth antigens are from influenza A subtype H3, and wherein the first and second antigens are derived from different strains of HI virus and the third and fourth antigens are from different strains of H3 influenza virus.
  • Clause 14 The immunogenic composition of any of clauses 8 to 13 further comprising one or more further self-replicating RNA molecules, wherein each further self-replicating RNA molecules encodes a polypeptide comprising a further antigen, wherein each further antigen is from influenza virus but is from a different strain of influenza virus to any of the other antigens in the composition.
  • Clause 15 The immunogenic composition of clause 14 wherein the composition comprises 5, 6, 7, 8, 9 or 10 further self-replicating RNA molecules.
  • composition comprises six self-replicating RNA molecules, wherein each self-replicating RNA molecules encodes a polypeptide comprising an antigen from a different strain of influenza subtype H3N2.
  • RNA molecule is a derived from an alphavirus.
  • a pharmaceutical composition comprising an immunogenic composition according to any one of the preceding clauses and a pharmaceutically acceptable carrier.
  • Clause 22 The pharmaceutical composition of clause 21 further comprising a cationic lipid, a liposome, a microparticle, viral replicon particles (VRPs), an oil-in-water emulsion or a cationic nanoemulsion.
  • VRPs viral replicon particles
  • Clause 23 The pharmaceutical composition of clause 23 wherein the self-replicating RNA molecules are encapsulated in, bound to or adsorbed on a cationic lipid, a liposome, a microparticle, viral replicon particles (VRPs), an oil-in-water emulsion or a cationic nanoemulsion.
  • VRPs viral replicon particles
  • Clause 24 The immunogenic composition of any one of clauses 1 to 20 or the pharmaceutical composition of any one of clauses 21 to 23 wherein the self-replicating RNA molecules are formulated in lipid nanoparticles (LNP) or in a cationic nanoemulsion (CNE).
  • LNP lipid nanoparticles
  • CNE cationic nanoemulsion
  • Clause 25 The immunogenic composition of any one of clauses 1 to 20 or the pharmaceutical composition of any one of clauses 21 to 23 for use as a vaccine.
  • Clause 26 The immunogenic composition of any one of clauses 1 to 20 or the pharmaceutical composition of any one of clauses 21 to 23 for use in the prevention of influenza.
  • Clause 27 A method of prevention and/or treatment against influenza disease, comprising the administration of an immunogenic composition according to any one of clauses 1 to 20 or the pharmaceutical composition of any one of clauses 21 to 23 to a person in need thereof.
  • Clause 28 A method for inducing an immune response in a subject comprising administering to the subject an effective amount of a pharmaceutical composition according to any one of clauses 21 to 23 or the immunogenic composition of any one of clauses 1 to 20.
  • a method of prevention and/or treatment against influenza disease comprising (i) the administration of a first immunogenic composition comprising a first self-replicating RNA molecule and pharmaceutically acceptable carrier and (ii) simultaneous or sequential administration of a second immunogenic composition comprising a second self-replicating RNA molecule and pharmaceutically acceptable carrier, wherein the first and second self-replicating RNA molecules encode a polypeptide encoding an antigen from influenza virus but the first self-replicating RNA molecule encodes an antigen from a different strain of influenza to that encoded by the second self-replicating RNA molecule.
  • a first immunogenic composition comprising a first self-replicating RNA molecule and a pharmaceutically acceptable carrier for use in a method of preventing influenza disease, said method comprising administration to a subject in need the first immunogenic composition followed by administration of a second immunogenic composition comprising a self-replicating RNA molecule and a pharmaceutically acceptable carrier, wherein the first and second self- replicating RNA molecules each encode a polypeptide comprising an antigen, wherein the antigen is from influenza virus but the antigen encoded by the first self-replicating RNA molecule is from a different strain of influenza virus to that encoded by the second self- replicating RNA molecule.
  • Clause 31 The immunogenic composition for use according to clause 30 wherein the first and second immunogenic compositions are administered simultaneously, at substantially the same time or sequentially.
  • Clause 32 The immunogenic composition for use according to clause 30 wherein the first and second immunogenic compositions are administered sequentially with an interval of less than 10 hours, from 1 second to 10 hours or from 1 second to 1 hour.
  • Clause 34 A method of preparing an immunogenic composition according to any one of clauses 1 to 20 or 24, the method comprising: (i) providing at least one lipid which forms nanoparticles; (ii) providing an aqueous solution comprising the self-replicating RNA molecules; and (iii) combining the aqueous solution of (ii) and the at least one lipid of (i), thereby preparing the composition.
  • SEQ ID NO: l Nucleotide cDNA sequence of A836 TC83 VEE/SINV (Venezuelan equine encephalitis- Sindbis virus) chimeric replicon containing T7 DNA polymerase promoter
  • SEQ ID N0:2 Nucleotide cDNA sequence of A836 TC83 VEE/SINV chimeric replicon without insert ataggcggcgcatgagagaagcccagaccaattacctacccaaaatggagaaagttcacgttgacatcgaggaagacagcccattcctcag agctttgcagcggagcttcccgcagtttgaggtagaagccaagcaggtcactgataatgaccatgctaatgccagagcgttttcgcatctggct tcaaaactgatcgaaacggaggtggacccatccgacacgatccttgacattggaagtgcgcccgcgcagaatgtattctaagcacaagtat cattgtatctgtcgatgagatgtga
  • SEQ ID N0:3 nucleotide cDNA sequence of hemagglutinin (HA) from influenza virus
  • SEQ ID NO:4 amino acid sequence of HA from influenza virus A/California/07/2009 (H1N1)
  • STRIYQILAIYSTVASSLVLWSLGAISFWMCSNGSLQCRICI SEQ ID NO:5 nucleotide DNA sequence of HA from influenza virus A/PR/8/34 (H 1N1)
  • SEQ ID NO:7 nucleotide cDNA sequence of HA from influenza virus A/Bilthoven/16398/1968 (H3N2) GGGCCCCTATAACTCTCTACGGCTAACCTGAATGGACTACGACATAGTCTAGTCCGCCAAGATGAAGACCAT
  • SEQ ID NO:8 amino acid sequence of HA from influenza virus A/Bilthoven/16398/1968 (H3N2)
  • SEQ ID NO: 11 nucleotide cDNA sequence of HA from influenza virus A/Beijing/32/92 (H3N2)
  • SEQ ID NO: 12 amino acid sequence of HA from influenza virus A/Beijing/32/92 (H3N2)
  • SEQ ID NO: 13 nucleotide cDNA sequence of HA from influenza virus A/Fujain/411/2002 (H3N2) GGGCCCCTATAACTCTCTACGGCTAACCTGAATGGACTACGACATAGTCTAGTCCGCCAAGATGAAGACCAT CATTGCCCTGAGCTACATCCTGTGCCTGGTGTTCGCCCAGAAGCTGCCCGGCAACGACAATAGCACCGCCAC CCTGTGTCTGGGCCACCACGCCGTGCCTAACGGCACCATCGTGAAAACCATCACCAACGACCAGATCGAAGT
  • SEQ ID NO: 14 amino acid sequence of HA from influenza virus A/Fujain/411/2002 (H3N2)
  • SEQ ID NO: 15 nucleotide cDNA sequence of HA from influenza virus A/Brisbane/10/2007 (H3N2)
  • SEQ ID NO: 16 amino acid sequence of HA from influenza virus A/Brisbane/10/2007 (H3N2)
  • SEQ ID NO: 17 nucleotide cDNA sequence of HA from influenza virus A/Texas/50/2012 (H3N2)
  • SEQ ID NO: 18 amino acid sequence of HA from influenza virus A/Texas/50/2012
  • SEQ ID NO: 19 nucleotide cDNA sequence of HA from influenza virus A/turkey/Turkey/1/2005 (H5N1)
  • SEQ ID NO: 20 amino acid sequence of HA from influenza virus A/turkey/Turkey/1/2005 (H5N1)
  • SEQ ID NO:21 nucleotide cDNA sequence of HA from influenza virus A/Shanghai/2/2013 (H7N9)
  • SEQ ID NO: 23 forward primer for influenza H 1N1 A/California/07/2009 insert
  • SEQ ID NO: 24 reverse primer for influenza H 1N1 A/California/07/2009 insert
  • SEQ ID NO: 25 forward primer for H7 HA gene from A/Shanghai/2/2013
  • AATT AAGT CG ACGCCACCAT G AACACTCAAAT CCTGGT ATT CG
  • SEQ ID NO: 26 reverse primer for H7 HA gene from A/Shanghai/2/2013

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Virology (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Epidemiology (AREA)
  • Mycology (AREA)
  • Pulmonology (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Communicable Diseases (AREA)
  • Molecular Biology (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Organic Chemistry (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
PCT/EP2019/072052 2018-08-17 2019-08-16 Immunogenic compositions and uses thereof Ceased WO2020035609A2 (en)

Priority Applications (7)

Application Number Priority Date Filing Date Title
EP19758926.0A EP3836963A2 (en) 2018-08-17 2019-08-16 Immunogenic compositions and uses thereof
CN201980068212.4A CN113164584A (zh) 2018-08-17 2019-08-16 免疫原性组合物及其用途
JP2021507889A JP2021534182A (ja) 2018-08-17 2019-08-16 免疫原性組成物及びその使用
AU2019321186A AU2019321186B2 (en) 2018-08-17 2019-08-16 Immunogenic compositions and uses thereof
CA3109165A CA3109165A1 (en) 2018-08-17 2019-08-16 Immunogenic compositions and uses thereof
US17/268,647 US12083174B2 (en) 2018-08-17 2019-08-16 Immunogenic compositions and uses thereof
US18/795,336 US20250064916A1 (en) 2018-08-17 2024-08-06 Immunogenic compositions and uses thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201862719219P 2018-08-17 2018-08-17
US62/719,219 2018-08-17

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US17/268,647 A-371-Of-International US12083174B2 (en) 2018-08-17 2019-08-16 Immunogenic compositions and uses thereof
US18/795,336 Continuation US20250064916A1 (en) 2018-08-17 2024-08-06 Immunogenic compositions and uses thereof

Publications (2)

Publication Number Publication Date
WO2020035609A2 true WO2020035609A2 (en) 2020-02-20
WO2020035609A3 WO2020035609A3 (en) 2020-05-28

Family

ID=67766133

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2019/072052 Ceased WO2020035609A2 (en) 2018-08-17 2019-08-16 Immunogenic compositions and uses thereof

Country Status (7)

Country Link
US (2) US12083174B2 (cg-RX-API-DMAC7.html)
EP (1) EP3836963A2 (cg-RX-API-DMAC7.html)
JP (1) JP2021534182A (cg-RX-API-DMAC7.html)
CN (1) CN113164584A (cg-RX-API-DMAC7.html)
AU (1) AU2019321186B2 (cg-RX-API-DMAC7.html)
CA (1) CA3109165A1 (cg-RX-API-DMAC7.html)
WO (1) WO2020035609A2 (cg-RX-API-DMAC7.html)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2023521662A (ja) * 2020-04-03 2023-05-25 グリットストーン バイオ インコーポレイテッド 感染症抗原及びワクチン
JP2023526423A (ja) * 2020-05-20 2023-06-21 フラッグシップ パイオニアリング イノベーションズ シックス,エルエルシー 免疫原性組成物及びその使用
JP2023530132A (ja) * 2020-06-19 2023-07-13 インターベット インターナショナル ベー. フェー. 2つの異なるrnaレプリコン粒子を含むブタインフルエンザaウイルスワクチン
US11744887B2 (en) 2020-03-09 2023-09-05 Arcturus Therapeutics, Inc. Coronavirus vaccine compositions and methods
WO2023213378A1 (en) * 2022-05-02 2023-11-09 BioNTech SE Replicon compositions and methods of using same for the treatment of diseases
US20240024455A1 (en) * 2020-12-02 2024-01-25 Seqirus Inc. Multicistronic rna vaccines and uses thereof
WO2024165992A1 (en) * 2023-02-09 2024-08-15 Pfizer Inc. Nucleic acids and uses thereof
WO2024261648A1 (en) * 2023-06-19 2024-12-26 Seqirus Inc. Multivalent subtype influenza vaccine
US12178921B2 (en) 2020-08-14 2024-12-31 Arcturus Therapeutics, Inc. Method of lyophilizing lipid nanoparticles
US12290556B2 (en) 2017-12-18 2025-05-06 Intervet Inc. Swine influenza a virus vaccine
EP4342490A4 (en) * 2021-05-19 2025-06-04 Daiichi Sankyo Company, Limited Influenza virus nucleic acid lipid particle vaccine
US12458604B2 (en) 2020-10-14 2025-11-04 The Trustees Of The University Of Pennsylvania Methods of lipid nanoparticle manufacture and compositions derived therefrom
RU2857683C2 (ru) * 2020-12-02 2026-03-05 Секвирус Инк. Мультицистронная самореплицирующаяся РНК для эффективной экспрессии более чем одного антигена, содержащая ее фармацевтическая композиция и способы применения
EP4441075A4 (en) * 2021-11-29 2026-03-18 Replicate Bioscience Inc METHODS FOR GENERING SELF-REPLICATING RNA MOLECULES

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20240009296A1 (en) * 2022-07-10 2024-01-11 Pfizer Inc. Self-amplifying rna encoding an influenza virus antigen
WO2024254461A2 (en) * 2023-06-07 2024-12-12 Nutech Ventures Methods and compositions for vaccine development and delivery
CN117205309B (zh) * 2023-11-07 2024-02-02 今发制药(南京)有限公司 一种流感免疫原组合物和制备方法及其用途
WO2025210141A1 (en) * 2024-04-05 2025-10-09 Boehringer Ingelheim Vetmedica Gmbh Delivery system useful for topical administration of rna

Citations (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4373071A (en) 1981-04-30 1983-02-08 City Of Hope Research Institute Solid-phase synthesis of polynucleotides
US4458066A (en) 1980-02-29 1984-07-03 University Patents, Inc. Process for preparing polynucleotides
US4500707A (en) 1980-02-29 1985-02-19 University Patents, Inc. Nucleosides useful in the preparation of polynucleotides
US4668777A (en) 1981-03-27 1987-05-26 University Patents, Inc. Phosphoramidite nucleoside compounds
US4973679A (en) 1981-03-27 1990-11-27 University Patents, Inc. Process for oligonucleo tide synthesis using phosphormidite intermediates
US5047524A (en) 1988-12-21 1991-09-10 Applied Biosystems, Inc. Automated system for polynucleotide synthesis and purification
US5132418A (en) 1980-02-29 1992-07-21 University Patents, Inc. Process for preparing polynucleotides
US5153319A (en) 1986-03-31 1992-10-06 University Patents, Inc. Process for preparing polynucleotides
US5262530A (en) 1988-12-21 1993-11-16 Applied Biosystems, Inc. Automated system for polynucleotide synthesis and purification
US5700642A (en) 1995-05-22 1997-12-23 Sri International Oligonucleotide sizing using immobilized cleavable primers
WO2005113782A1 (en) 2004-05-18 2005-12-01 Alphavax, Inc. Tc-83-derived alphavirus vectors, particles and methods
WO2011076807A2 (en) 2009-12-23 2011-06-30 Novartis Ag Lipids, lipid compositions, and methods of using them
WO2012006380A2 (en) 2010-07-06 2012-01-12 Novartis Ag Cationic oil-in-water emulsions
WO2012006359A1 (en) 2010-07-06 2012-01-12 Novartis Ag Delivery of self-replicating rna using biodegradable polymer particles
WO2012006378A1 (en) 2010-07-06 2012-01-12 Novartis Ag Liposomes with lipids having an advantageous pka- value for rna delivery
WO2012006376A2 (en) 2010-07-06 2012-01-12 Novartis Ag Virion-like delivery particles for self-replicating rna molecules
WO2012031043A1 (en) 2010-08-31 2012-03-08 Novartis Ag Pegylated liposomes for delivery of immunogen-encoding rna
WO2012031046A2 (en) 2010-08-31 2012-03-08 Novartis Ag Lipids suitable for liposomal delivery of protein-coding rna
WO2012030901A1 (en) 2010-08-31 2012-03-08 Novartis Ag Small liposomes for delivery of immunogen-encoding rna
WO2013006837A1 (en) 2011-07-06 2013-01-10 Novartis Ag Cationic oil-in-water emulsions
WO2013006825A1 (en) 2011-07-06 2013-01-10 Novartis Ag Liposomes having useful n:p ratio for delivery of rna molecules
WO2013006834A1 (en) 2011-07-06 2013-01-10 Novartis Ag Oil-in-water emulsions that contain nucleic acids
WO2013033563A1 (en) 2011-08-31 2013-03-07 Novartis Ag Pegylated liposomes for delivery of immunogen-encoding rna
WO2014136086A1 (en) 2013-03-08 2014-09-12 Novartis Ag Lipids and lipid compositions for the delivery of active agents
WO2015095340A1 (en) 2013-12-19 2015-06-25 Novartis Ag Lipids and lipid compositions for the delivery of active agents
WO2015095346A1 (en) 2013-12-19 2015-06-25 Novartis Ag Lipids and lipid compositions for the delivery of active agents
WO2016037053A1 (en) 2014-09-05 2016-03-10 Novartis Ag Lipids and lipid compositions for the delivery of active agents

Family Cites Families (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2766907A1 (en) * 2009-07-06 2011-01-13 Novartis Ag Self replicating rna molecules and uses thereof
CA2841047A1 (en) 2011-07-06 2013-01-10 Novartis Ag Immunogenic compositions and uses thereof
RU2014118727A (ru) * 2011-10-11 2015-11-20 Новартис Аг Рекомбинантные самореплицирующиеся полицистронные молекулы рнк
CN109045294A (zh) * 2013-01-10 2018-12-21 思齐乐 流感病毒免疫原性组合物及其应用
BR112018014109A2 (en) * 2016-01-11 2018-12-11 Verndari, Inc. microneedle compositions and methods of using them
CN106822887A (zh) 2017-01-26 2017-06-13 中国科学院微生物研究所 一种流感病毒四价亚单位疫苗及其应用

Patent Citations (27)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4458066A (en) 1980-02-29 1984-07-03 University Patents, Inc. Process for preparing polynucleotides
US4500707A (en) 1980-02-29 1985-02-19 University Patents, Inc. Nucleosides useful in the preparation of polynucleotides
US5132418A (en) 1980-02-29 1992-07-21 University Patents, Inc. Process for preparing polynucleotides
US4668777A (en) 1981-03-27 1987-05-26 University Patents, Inc. Phosphoramidite nucleoside compounds
US4973679A (en) 1981-03-27 1990-11-27 University Patents, Inc. Process for oligonucleo tide synthesis using phosphormidite intermediates
US4373071A (en) 1981-04-30 1983-02-08 City Of Hope Research Institute Solid-phase synthesis of polynucleotides
US5153319A (en) 1986-03-31 1992-10-06 University Patents, Inc. Process for preparing polynucleotides
US5047524A (en) 1988-12-21 1991-09-10 Applied Biosystems, Inc. Automated system for polynucleotide synthesis and purification
US5262530A (en) 1988-12-21 1993-11-16 Applied Biosystems, Inc. Automated system for polynucleotide synthesis and purification
US5700642A (en) 1995-05-22 1997-12-23 Sri International Oligonucleotide sizing using immobilized cleavable primers
WO2005113782A1 (en) 2004-05-18 2005-12-01 Alphavax, Inc. Tc-83-derived alphavirus vectors, particles and methods
WO2011076807A2 (en) 2009-12-23 2011-06-30 Novartis Ag Lipids, lipid compositions, and methods of using them
WO2012006380A2 (en) 2010-07-06 2012-01-12 Novartis Ag Cationic oil-in-water emulsions
WO2012006359A1 (en) 2010-07-06 2012-01-12 Novartis Ag Delivery of self-replicating rna using biodegradable polymer particles
WO2012006378A1 (en) 2010-07-06 2012-01-12 Novartis Ag Liposomes with lipids having an advantageous pka- value for rna delivery
WO2012006376A2 (en) 2010-07-06 2012-01-12 Novartis Ag Virion-like delivery particles for self-replicating rna molecules
WO2012031043A1 (en) 2010-08-31 2012-03-08 Novartis Ag Pegylated liposomes for delivery of immunogen-encoding rna
WO2012031046A2 (en) 2010-08-31 2012-03-08 Novartis Ag Lipids suitable for liposomal delivery of protein-coding rna
WO2012030901A1 (en) 2010-08-31 2012-03-08 Novartis Ag Small liposomes for delivery of immunogen-encoding rna
WO2013006837A1 (en) 2011-07-06 2013-01-10 Novartis Ag Cationic oil-in-water emulsions
WO2013006825A1 (en) 2011-07-06 2013-01-10 Novartis Ag Liposomes having useful n:p ratio for delivery of rna molecules
WO2013006834A1 (en) 2011-07-06 2013-01-10 Novartis Ag Oil-in-water emulsions that contain nucleic acids
WO2013033563A1 (en) 2011-08-31 2013-03-07 Novartis Ag Pegylated liposomes for delivery of immunogen-encoding rna
WO2014136086A1 (en) 2013-03-08 2014-09-12 Novartis Ag Lipids and lipid compositions for the delivery of active agents
WO2015095340A1 (en) 2013-12-19 2015-06-25 Novartis Ag Lipids and lipid compositions for the delivery of active agents
WO2015095346A1 (en) 2013-12-19 2015-06-25 Novartis Ag Lipids and lipid compositions for the delivery of active agents
WO2016037053A1 (en) 2014-09-05 2016-03-10 Novartis Ag Lipids and lipid compositions for the delivery of active agents

Non-Patent Citations (20)

* Cited by examiner, † Cited by third party
Title
"Pandemic influenza preparedness and response", A WHO GUIDANCE DOCUMENT, 2009
BRAZZOLI ET AL., J VIROL, vol. 90, 2015, pages 332 - 44
DAYHOFF ET AL., ATLAS OF PROTEIN SEQUENCE AND STRUCTURE, vol. 5, no. 3, 1978
DORMITZER ET AL., IMMUNOL REV, vol. 239, 2011, pages 167 - 77
DORMITZER ET AL., SCI TRANSL MED, vol. 5, no. 185, 2013, pages 185ra68
FITZMAURICE ET AL., VACCINE, vol. 14, 1996, pages 553 - 60
FLOREK ET AL., J VIROL, vol. 88, 2014, pages 13418 - 28
GEALL ET AL., PNAS USA, vol. 109, no. 36, 4 September 2012 (2012-09-04), pages 14604 - 9
GEALL ET AL., PROC NATL ACAD SCI USA, vol. 109, 2012, pages 14604 - 9
GOMEZ LORENZO ET AL., CHEST, vol. 143, 2013, pages 502 - 10
HEKELE ET AL., EMERG MICROBES INFECT, vol. 2, 2013, pages e52
HEYES ET AL., J CONTROL RELEASE, vol. 107, pages 276 - 287
KHURANA ET AL., SCI TRANSL MED, vol. 3, 2011, pages 85ra48
MAGINI ET AL., PLOS ONE, vol. 11, no. 8, 2016, pages e0161193
NABEL ET AL., NAT MED, vol. 16, 2010, pages 1389 - 91
PERRI ET AL., JOURNAL OF VIROLOGY, October 2003 (2003-10-01), pages 10394 - 10403
SRIDHAR ET AL., FRONT IMMUNOL, 2016, pages 7
SUN ET AL., J VIROL, vol. 87, 2013, pages 8756 - 66
THE BULLETIN OF THE WORLD HEALTH ORGANIZATION, vol. 58, no. 4, February 1980 (1980-02-01), pages 585 - 591
WRAMMERT ET AL., J EXP MED, vol. 208, 2011, pages 181 - 93

Cited By (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12290556B2 (en) 2017-12-18 2025-05-06 Intervet Inc. Swine influenza a virus vaccine
US12220455B2 (en) 2020-03-09 2025-02-11 Arcturus Therapeutics, Inc. Coronavirus vaccine compositions and methods
US12390524B2 (en) 2020-03-09 2025-08-19 Arcturus Therapeutics, Inc. Compositions and methods for inducing immune responses
US11744887B2 (en) 2020-03-09 2023-09-05 Arcturus Therapeutics, Inc. Coronavirus vaccine compositions and methods
US11759515B2 (en) 2020-03-09 2023-09-19 Arcturus Therapeutics, Inc. Compositions and methods for inducing immune responses
EP4125944A4 (en) * 2020-04-03 2024-08-14 Gritstone bio, Inc. ANTIGENS AND VACCINES AGAINST INFECTIOUS DISEASES
JP2023521662A (ja) * 2020-04-03 2023-05-25 グリットストーン バイオ インコーポレイテッド 感染症抗原及びワクチン
JP2023526423A (ja) * 2020-05-20 2023-06-21 フラッグシップ パイオニアリング イノベーションズ シックス,エルエルシー 免疫原性組成物及びその使用
JP2023530132A (ja) * 2020-06-19 2023-07-13 インターベット インターナショナル ベー. フェー. 2つの異なるrnaレプリコン粒子を含むブタインフルエンザaウイルスワクチン
US12178921B2 (en) 2020-08-14 2024-12-31 Arcturus Therapeutics, Inc. Method of lyophilizing lipid nanoparticles
US12576040B2 (en) 2020-10-14 2026-03-17 The Trustees Of The University Of Pennsylvania Ionizable lipids and methods of manufacture and use thereof
US12458604B2 (en) 2020-10-14 2025-11-04 The Trustees Of The University Of Pennsylvania Methods of lipid nanoparticle manufacture and compositions derived therefrom
US20240024455A1 (en) * 2020-12-02 2024-01-25 Seqirus Inc. Multicistronic rna vaccines and uses thereof
RU2857683C2 (ru) * 2020-12-02 2026-03-05 Секвирус Инк. Мультицистронная самореплицирующаяся РНК для эффективной экспрессии более чем одного антигена, содержащая ее фармацевтическая композиция и способы применения
EP4342490A4 (en) * 2021-05-19 2025-06-04 Daiichi Sankyo Company, Limited Influenza virus nucleic acid lipid particle vaccine
EP4441075A4 (en) * 2021-11-29 2026-03-18 Replicate Bioscience Inc METHODS FOR GENERING SELF-REPLICATING RNA MOLECULES
WO2023213378A1 (en) * 2022-05-02 2023-11-09 BioNTech SE Replicon compositions and methods of using same for the treatment of diseases
WO2023213783A1 (en) * 2022-05-02 2023-11-09 BioNTech SE Replicon compositions and methods of using same for the treatment of diseases
US12616746B2 (en) 2022-10-03 2026-05-05 Seattle Project Corp. Infectious disease antigens and vaccines
WO2024165992A1 (en) * 2023-02-09 2024-08-15 Pfizer Inc. Nucleic acids and uses thereof
WO2024261648A1 (en) * 2023-06-19 2024-12-26 Seqirus Inc. Multivalent subtype influenza vaccine

Also Published As

Publication number Publication date
US20250064916A1 (en) 2025-02-27
AU2019321186A1 (en) 2021-02-18
AU2019321186B2 (en) 2024-05-23
JP2021534182A (ja) 2021-12-09
CN113164584A (zh) 2021-07-23
EP3836963A2 (en) 2021-06-23
CA3109165A1 (en) 2020-02-20
US20210252133A1 (en) 2021-08-19
WO2020035609A3 (en) 2020-05-28
US12083174B2 (en) 2024-09-10

Similar Documents

Publication Publication Date Title
US20250064916A1 (en) Immunogenic compositions and uses thereof
US10967057B2 (en) Zika viral antigen constructs
US20230242593A1 (en) Zika viral antigen constructs
US20220241398A1 (en) Lyssavirus antigen constructs
US20230234992A1 (en) Modified betacoronavirus spike proteins
US20240181038A1 (en) Immunogenic compositions
US20230364219A1 (en) Sars cov-2 spike protein construct
KR20250075664A (ko) 인플루엔자 바이러스 백신
US20240301006A1 (en) Self-amplifying messenger rna
HK40073646A (en) Zika viral antigen constructs
WO2024223728A1 (en) Influenza virus vaccines

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19758926

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3109165

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2021507889

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019321186

Country of ref document: AU

Date of ref document: 20190816

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019758926

Country of ref document: EP

Effective date: 20210317