WO2019209965A2 - Interleukin 12 fusion proteins, and compositions and therapeutic methods thereof - Google Patents

Interleukin 12 fusion proteins, and compositions and therapeutic methods thereof Download PDF

Info

Publication number
WO2019209965A2
WO2019209965A2 PCT/US2019/028933 US2019028933W WO2019209965A2 WO 2019209965 A2 WO2019209965 A2 WO 2019209965A2 US 2019028933 W US2019028933 W US 2019028933W WO 2019209965 A2 WO2019209965 A2 WO 2019209965A2
Authority
WO
WIPO (PCT)
Prior art keywords
protein
fusion protein
seq
subunit
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/028933
Other languages
English (en)
French (fr)
Other versions
WO2019209965A3 (en
Inventor
Yang-Xin Fu
Hua Peng
Diyuan XUE
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Immune Targeting Inc
Original Assignee
Immune Targeting Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2019261411A priority Critical patent/AU2019261411B2/en
Priority to US17/049,021 priority patent/US12473337B2/en
Priority to EA202092459A priority patent/EA202092459A1/ru
Priority to JP2020559408A priority patent/JP2021521822A/ja
Priority to EP19792585.2A priority patent/EP3810639A4/en
Priority to CA3097995A priority patent/CA3097995A1/en
Priority to CN201980042842.4A priority patent/CN112638938A/zh
Priority to BR112020021791-3A priority patent/BR112020021791A2/pt
Application filed by Immune Targeting Inc filed Critical Immune Targeting Inc
Priority to KR1020207033158A priority patent/KR20210024446A/ko
Publication of WO2019209965A2 publication Critical patent/WO2019209965A2/en
Publication of WO2019209965A3 publication Critical patent/WO2019209965A3/en
Anticipated expiration legal-status Critical
Priority to JP2024197045A priority patent/JP2025032113A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5434IL-12
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the invention generally relates to novel fusion proteins and therapeutic uses thereof. More particularly, the invention provides novel fusion proteins of Interleukin 12 and prodrugs, and compositions and methods of preparation thereof, useful in treating various diseases and disorders (e.g ., hyperplasia, solid tumor or hematopoietic malignancy).
  • diseases and disorders e.g ., hyperplasia, solid tumor or hematopoietic malignancy.
  • Interleukin- 12 also known as cytotoxic lymphocyte maturation factor (CLMF)
  • CLMF cytotoxic lymphocyte maturation factor
  • NK natural killer cell stimulating factor with multiple biological activities on peripheral blood lymphocytes.
  • IL12 is produced in response to infection by a variety of cells of the immune system, including phagocytic cells, B cells and activated dendritic cells.
  • IL12 plays an essential role in mediating the interaction of the innate and adaptive arms of the immune system, acting on T-cells and natural killer (NK) cells, enhancing the proliferation and activity of cytotoxic lymphocytes and the production of other inflammatory cytokines, especially interferon-g.
  • IL12 is a heterodimeric molecule composed of an a-chain (the p35 subunit) and a b-chain (the p40 subunit) covalently linked by a disulfide bridge to form the biologically active 74 kDa heterodimer.
  • IL12 is shown to be a potent activator of natural killer (NK) cell activity (Kobayashi, et al. 1989 J. Exp. Med. 170:827-845) and a major inducer of IFN- g from NK and T lymphocytes (Chan, et al. 1991 J. Exp. Med. 173:869-879), a cytokine with important immune cell activating capabilities.
  • NK natural killer
  • IFN- g is also an essential mediator of the anti angiogenic effects ascribed to IL12 (Voest, et al. 1995 J. Natl Cancer Inst. 87:581-586; Majewski, et al. 1996 J. Invest.
  • IL12 enhances tumor cell killing mediated by immune cells specifically directed toward tumor targets by antitumor antibodies (antibody-dependent cellular cytotoxicity, ADCC) (Lieberman, et al. 1991 ./ Surg. Res. 50:410-415). IL12 stimulates nitric oxide production in vivo, resulting in delayed tumor progression in mice (Wigginton, et al. 1996 Cancer Res. 56: 1131-1136). Endogenous IL12 production has also been documented to gradually diminish as tumor burden increases (Handel-Femandez, et al. 1997 J. Immunol. 158:280-286), thus forming a rationale for providing IL12 to cancer patients to reconstitute cell-mediated antitumor responses.
  • ADCC antibody-dependent cellular cytotoxicity
  • IL12 has also been reported to be a potent inhibitor of tumor-driven angiogenesis (Voest, et al. 1995 supra; Majewski, et al. 1996 supra) demonstrating significant in vivo inhibition of tumor blood vessel formation in mice mediated through IFN g inducible protein- 10 (IP- 10; Sgadari, et al. 1996 Blood 87:3877-3882), a chemokine that has a potent antiangiogenic effect on the vasculature of growing tumors (Angiolillo, et al. 1996 Ann NY Acad. Sci. 795: 158-167; Arenberg, et al. 1996 J.
  • IF12 has also been shown to exert antiangiogenic effects through its role as a regulator of VEGF and matrix metalloproteinase (MMP) production (Dias, et al. 1998 Int. J. Cancer 78: 361-365).
  • MMP matrix metalloproteinase
  • IF12 has shown potent anti-tumor effect in preclinical models, in the clinical trials, however, the systemic administration recombinant IF 12 has resulted in severe side effects, such as fever, gastrointestinal reactions, lymphopenia, and abnormal liver function seriously, and deaths of patients have been attributed to IF12 administration due to its severe toxicity.
  • severe side effects such as fever, gastrointestinal reactions, lymphopenia, and abnormal liver function seriously, and deaths of patients have been attributed to IF12 administration due to its severe toxicity.
  • novel fusion proteins of IF 12 and prodrugs thereof, compositions and methods of preparation thereof, are disclosed herein which are useful in treating various diseases and disorders, e.g., hyperplasia, solid tumor or hematopoietic malignancy, with reduced side effects and off-target toxicities.
  • the invention generally relates to a fusion protein.
  • the fusion protein comprises: a first structural unit: one or two subunits of IL12 selected from P35 and P40 subunits, wherein the first structural unit is located at the N-terminus of the fusion protein; a second structural unit: an antibody Fc fragment, wherein the second structural unit is located at the C-terminus of the fusion protein; and a first linker segment covalently linking the first structural unit and the second structural unit or covalently linking the two subunits of the first structural unit.
  • the invention generally relates to a homodimeric or heterodimeric protein, which comprises a fusion protein disclosed herein.
  • the invention generally relates to a substantially purified protein, such as a fusion protein or a fragment, disclosed herein.
  • the invention generally relates to a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
  • the invention generally relates to an expression vector comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
  • the invention generally relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent.
  • the invention generally relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent.
  • the invention generally relates to a method for treating a disease or condition.
  • the method comprises administering to a patient in need thereof a therapeutically effective amount of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein, wherein the disease or condition is selected from hyperplasia, solid tumor or hematopoietic malignancy.
  • the invention generally relates to use of a protein, such as a fusion protein or a fragment thereof, disclosed herein for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
  • a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy.
  • the invention generally relates to use of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
  • a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy.
  • the invention generally relates to use of a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent, in preparation of a medicament for treating or reducing a disease or disorder (e.g ., hyperplasia, solid tumor or hematopoietic malignancy).
  • the invention generally relates to use of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent, in preparation of a medicament for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
  • a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy
  • the invention generally relates to a cell line comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
  • the invention generally relates to a method for making a protein, comprising culturing the cell line.
  • the method further comprises purifying or isolating a produced protein, such as a fusion protein or a fragment thereof, disclosed herein.
  • the invention generally relates to a method for making a protein.
  • the method comprises: providing an expression vector encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein; introducing the expression vector into a host cell; culturing the host cell in media under conditions sufficient to express the protein; and purifying the protein from the host cell or media.
  • the invention generally relates to an isolated protein produced by a method disclosed herein.
  • FIG. 1 shows a schematic diagram of the structure of ILl2-Fc dimer prodrug:
  • Homodimer-ILl2-Fc (Homo IL12) in series form.
  • FIG. 2 shows a schematic diagram of the structure of ILl2-Fc dimer prodrug:
  • Heterodimer-ILl2-Fc Het IL12 in parallel form
  • Fc-k is a short for Fc-knob
  • Fc-h is short for Fc-hole.
  • FIG. 3 shows a schematic diagram of the structure of Homodimer-ILl2-R ⁇ Sl dimer prodrug (Homo-Rl).
  • FIG. 4 shows a schematic diagram of the structure of Homodimer-ILl2-R 2 dimer prodrug (Homo-R2).
  • FIG. 5 shows a schematic diagram of the structure of Heterodimer-ILl2-R l/R 2 dimer prodrug (Het-Rl/R2), Fc-k is a short for Fc-knob, and Fc-h is short for Fc-hole.
  • FIG. 6 shows a schematic diagram of the structure of Heterodimer-ILl2-R l dimer prodrug (Het-Rl), Fc-k is a short for Fc-knob, and Fc-h is short for Fc-hole.
  • FIG. 7 shows a schematic diagram of the structure of Heterodimer-ILl2-R 2 dimer prodrug (Het-R2), Fc-k is short for Fc-knob, and Fc-h is short for Fc-hole.
  • FIG. 8 shows exemplary data of SDS-PAGE electrophoresis results of the expression of the seven fusion proteins in FIGs. 1 ⁇ 7.
  • FIG. 9 shows exemplary data that injection of ILl2-Fc, not linked to the IL12 receptor, completely eliminates MC38 tumors, and Het IL12 has a stronger clearance effect than Homo IL12.
  • FIG. 10 shows exemplary data that Het IL12 has a higher cytotoxicity than Homo IL12.
  • FIG. 11 shows exemplary data that Het-Rl, Het-R2, and Het-Rl /R2 all effectively eliminate MC38 tumors.
  • FIG. 12 shows exemplary data that Het IL12 prodrug linked to IL12 receptor has fewer side effects when administered systemically.
  • FIG. 13 shows exemplary data of SDS-PAGE electrophoresis results of the expression of human Het-Rl and Het-Rl/R2 with or without digestion with MMP14.
  • FIG. 14 shows exemplary data that (A) human Het-Rl after MMP14 digest exhibits similar activity as Het IL12 and recombinant IL12 in vitro (B) human Het-Rl /R2 after MMP14 digest exhibits similar activity as Het IL12 and recombinant IL12 using a HEK Blue-ILl2 reporter cell line.
  • the trade name includes the product formulation, the generic drug, and the active pharmaceutical ingredient(s) of the trade name product, unless otherwise indicated by context.
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34,
  • the term“about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1%, 0.05%, or 0.01% of the stated value. Unless otherwise clear from context, all numerical values provided herein can be modified by the term about.
  • compositions and methods when used to define compositions and methods, is intended to mean that the compositions and methods include the recited elements, but do not exclude other elements.
  • “consisting essentially of’ refers to administration of the pharmacologically active agents expressly recited and excludes pharmacologically active agents not expressly recited.
  • the term consisting essentially of does not exclude pharmacologically inactive or inert agents, e.g., pharmaceutically acceptable excipients, carriers or diluents.
  • the term“agonist” refers to a compound that, in combination with a receptor, can produce a cellular response.
  • An agonist may be a ligand that directly binds to the receptor.
  • an agonist may combine with a receptor indirectly by, for example, (a) forming a complex with another molecule that directly binds to the receptor, or (b) otherwise resulting in the modification of another compound so that the other compound directly binds to the receptor.
  • the term“antagonist” refers to a compound that competes with an agonist or inverse agonist for binding to a receptor, thereby blocking the action of an agonist or inverse agonist on the receptor. However, an antagonist has no effect on constitutive receptor activity.
  • the term“antibody” refers to molecules that are capable of binding an epitope or antigenic determinant.
  • the term is meant to include whole antibodies and antigen-binding fragments thereof.
  • the term encompasses polyclonal, monoclonal, chimeric, Fabs, Fvs, single-chain antibodies and single or multiple immunoglobulin variable chain or CDR domain designs as well as bispecific and multispecific antibodies.
  • Antibodies can be from any animal origin. Preferably, the antibodies are mammalian, e.g., human, murine, rabbit, goat, guinea pig, camel, horse and the like, or other suitable animals. Antibodies may recognize polypeptide or polynucleotide antigens.
  • the term includes active fragments, including for example, an antigen binding fragment of an
  • immunoglobulin a variable and/or constant region of a heavy chain, a variable and/or constant region of a light chain, a complementarity determining region (cdr), and a framework region.
  • the terms include polyclonal and monoclonal antibody preparations, as well as preparations including hybrid antibodies, altered antibodies, chimeric antibodies, hybrid antibody molecules, F(ab) 2 and F(ab) fragments; Fv molecules (for example, noncovalent heterodimers), dimeric and trimeric antibody fragment constructs; minibodies, humanized antibody molecules, and any functional fragments obtained from such molecules, wherein such fragments retain specific binding.
  • the term“antigen” as used herein is meant any substance that causes the immune system to produce antibodies or specific cell-mediated immune responses against it.
  • a disease associated antigen is any substance that is associated with any disease that causes the immune system to produce antibodies or a specific-cell mediated response against it.
  • An antigen is capable of being recognized by the immune system and/or being capable of inducing a humoral immune response and/or cellular immune response leading to the activation of B- and/or T-lymphocytes.
  • An antigen can have one or more epitopes (B- and/or T-cell epitopes).
  • An antigen will preferably react, typically in a highly selective manner, with its corresponding antibody or TCR and not with the multitude of other antibodies or TCRs which may be evoked by other antigens.
  • Antigens as used herein may also be mixtures of several individual antigens.
  • biologically active entity is one having structural, regulatory, or biochemical functions of a naturally occurring molecule or any function related to or associated with a metabolic or physiological process.
  • a biologically active polypeptide or fragment thereof includes one that can participate in a biological process or reaction and/or can produce a desired effect.
  • the biological activity can include an improved desired activity, or a decreased undesirable activity.
  • an entity demonstrates biological activity when it participates in a molecular interaction with another molecule, when it has therapeutic value in alleviating a disease condition, when it has prophylactic value in inducing an immune response, or when it has diagnostic and/or prognostic value in determining the presence of a molecule.
  • a biologically active protein or polypeptide can be naturally-occurring or it can be synthesized from known components, e.g., by recombinant or chemical synthesis and can include heterologous components.
  • cancer and“cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
  • cancer include but are not limited to, carcinoma, lymphoma, sarcoma, blastoma and leukemia. More particular examples of such cancers include squamous cell carcinoma, lung cancer, pancreatic cancer, cervical cancer, bladder cancer, hepatoma, breast cancer, colon carcinoma, and head and neck cancer.
  • the term“cell” refers to any prokaryotic, eukaryotic, primary cell or immortalized cell line, any group of such cells as in, a tissue or an organ.
  • the cells are of mammalian (e.g., human) origin and can be infected by one or more pathogens.
  • the term“co-administer” refers to the presence of two pharmacological agents in the blood at the same time.
  • the two pharmacological agents can be administered concurrently or sequentially.
  • polypeptides are expressed simultaneously in a host cell such that the two polypeptides can interact or bind either in the host cell or in the host cell culture medium and form a complex.
  • the terms“disease” or“disorder” refer to a pathological condition, for example, one that can be identified by symptoms or other identifying factors as diverging from a healthy or a normal state.
  • the term“disease” includes disorders, syndromes, conditions, and injuries. Diseases include, but are not limited to, proliferative, inflammatory, immune, metabolic, infectious, and ischemic diseases.
  • the term“effective amount” of an active agent refers to an amount sufficient to elicit the desired biological response.
  • the effective amount of a compound of the invention may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the disease being treated, the mode of administration, and the patient.
  • the term "expression of a nucleic acid molecule” refers to the conversion of the information contained in the nucleic acid molecule into a gene product.
  • the gene product can be the direct transcriptional product of a gene (e.g ., mRNA, tRNA, rRNA, antisense RNA, ribozyme, structural RNA, or any other type of RNA) or a peptide or polypeptide produced by translation of an mRNA.
  • Gene products also include RNAs that are modified by processes such as capping, polyadenylation, methylation, and editing; and proteins modified by, for example, methylation, acetylation, phosphorylation, ubiquitination, ADP-ribosylation, myristilation, and glycosylation.
  • the term“host cell” refers to an individual cell or a cell culture that can be or has been a recipient of any recombinant vector(s) or isolated polynucleotide(s).
  • a host cell can be a transfected, transformed, transduced or infected cell of any origin, including prokaryotic, eukaryotic, mammalian, avian, insect, plant or bacteria cells, or it can be a cell of any origin that can be used to propagate a nucleic acid described herein.
  • Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in total DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation and/or change.
  • a host cell includes cells transfected or infected in vivo or in vitro with a recombinant vector or a polynucleotide of the invention.
  • a host cell that comprises a recombinant vector of the invention may be called a“recombinant host cell.”
  • Host cells include, without limitation, the cells of mammals, plants, insects, fungi and bacteria.
  • Bacterial cells include, without limitation, the cells of Gram-positive bacteria such as species of the genus Bacillus, Streptomyces and Staphylococcus and cells of Gram-negative bacteria such as cells of the genus Escherichia and Pseudomonas.
  • Fungal cells include, preferably, yeast cells such as Saccharomyces, Pichia pastoris and Hansenula polymorpha.
  • Insect cells include, without limitation, cells of Drosophila and Sf9 cells.
  • Plant cells include, among others, cells from crop plants such as cereals, medicinal or ornamental plants or bulbs.
  • Suitable mammal cells for the present invention include epithelial cell lines (porcine, etc.), osteosarcoma cell lines (human, etc.), neuroblastoma cell lines (human, etc.), epithelial carcinomas (human, etc.), glial cells (murine, etc.), liver cell lines (monkey, etc.).
  • CHO cells Choinese Hamster Ovary
  • COS cells BHK cells
  • human ECCs NTERA-2 cells D3 cells of the line of mESCs
  • human embryonic stem cells such as HS293 and BGV01, SHEF1, SHEF2 and HS181, cells NIH3T3, 293T, REH and MCF-7 and hMSCs cells.
  • the term“Fc” refers to a molecule or sequence comprising the sequence of a non-antigen-binding fragment of whole antibody, whether in monomeric or multimeric form.
  • the original immunoglobulin source of the native Fc is preferably of human origin and may be any of the immunoglobulins (e.g., IgGl, IgG2).
  • Native Fc's are made up of monomeric polypeptides that may be linked into dimeric or multimeric forms by covalent (i.e., disulfide bonds) and non-covalent association.
  • the number of intermolecular disulfide bonds between monomeric subunits of native Fc molecules ranges from 1 to 4 depending on class (e.g ., IgG, IgA, IgE) or subclass (e.g., IgGl, IgG2, IgG3, IgAl, IgGA2).
  • an Fc domain is capable of interacting with a second Fc domain to form a dimeric complex.
  • the Fc domain may be capable of binding cell surface receptors called Fc receptors and/or proteins of the complement system or may be modified to reduce or augment these binding activities.
  • the Fc domain may be derived from IgG, IgA, IgD, IgM or IgE antibody isotypes and effect immune activity including opsonization, cell lysis, degranulation of mast cells, basophils, and eosinophils, and other Fc receptor-dependent processes; activation of the complement pathway; and protein stability in vivo.
  • Fc domain encompasses native Fc and Fc variant molecules and sequences as defined herein.
  • Fc variants and native Fc include molecules in monomeric or multimeric form, whether digested from whole antibody or produced by recombinant gene expression or by other means.
  • Fc fusion proteins have been reported to combine the Fc regions of IgG with the domains of another protein, such as various cytokines and soluble receptors (e.g., Capon et al. 1989 Nature 337:525-531; Chamow et al. 1996 Trends Biotechnol. 14:52-60; U.S. Pat. Nos. 5,116,964 and 5,541,087).
  • Fc fusion proteins can include variant Fc molecules (e.g., as described in ET.S. Pat. No. 7,732,570). Fc fusion proteins can be soluble in the plasma or can associate to the cell surface of cells having specific Fc receptors.
  • the term“Fc variant” refers to a molecule or sequence that is modified from a native Fc but still comprises a binding site for the salvage receptor, FcRn.
  • International applications WO 97/34631 (published Sep. 25, 1997) and WO 96/32478 describe exemplary Fc variants, as well as interaction with the salvage receptor, and are hereby incorporated by reference.
  • the term“Fc variant” comprises a molecule or sequence that is humanized from a non-human native Fc.
  • a native Fc comprises sites that may be removed because they provide structural features or biological activity that are not required for the fusion molecules of the present invention.
  • the term“Fc variant” comprises a molecule or sequence that lacks one or more native Fc sites or residues that affect or are involved in (1) disulfide bond formation, (2) incompatibility with a selected host cell (3) N-terminal heterogeneity upon expression in a selected host cell, (4) glycosylation, (5) interaction with complement, (6) binding to an Fc receptor other than a salvage receptor, or (7) antibody-dependent cellular cytotoxicity (ADCC).
  • ADCC antibody-dependent cellular cytotoxicity
  • fusion protein refers to polypeptides comprising two or more regions from different or heterologous proteins covalently linked (i.e .,“fused”) by recombinant, chemical or other suitable method. If desired, the fusion molecule can be fused at one or several sites through a peptide or other linker segment or sequence. For example, one or more peptide linkers may be used to assist in construction of a fusion protein.
  • GC content refers to the percentage of a nucleic acid sequence comprised of deoxyguanosine (G) and/or deoxycytidine (C) deoxyribonucleosides, or guanosine (G) and/or cytidine (C) ribonucleoside residues.
  • the term“high dosage” is meant at least 5% ( e.g ., at least 10%, 20%, 50%, 100%, 200%, or even 300%) more than the highest standard recommended dosage of a particular compound for treatment of any human disease or condition.
  • the term“immune response” refers to a process whereby immune cells are stimulated and/or recruited from the blood to lymphoid as well as non-lymphoid tissues via a multifactorial process that involves distinct adhesive and/or activation steps. Activation conditions cause the release of cytokines, growth factors, chemokines and other factors, upregulate expression of adhesion and other activation molecules on the immune cells, promote adhesion, morphological changes, and/or extravasation concurrent with chemotaxis through the tissues, increase cell proliferation and cytotoxic activity, stimulate antigen presentation and provide other phenotypic changes including generation of memory cell types. Immune response is also meant to refer to the activity of immune cells to suppress or regulate inflammatory or cytotoxic activity of other immune cells. Immune response refers to the activity of immune cells in vivo or in vitro.
  • nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 70% identity, preferably 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region (e.g., of a IL12 or IL12R sequence), when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection.
  • a specified region e.g., of a IL12 or IL12R sequence
  • sequences are then said to be“substantially identical.”
  • This definition also refers to, or can be applied to, the compliment of a test sequence.
  • the definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. As described below, the preferred algorithms can account for gaps and the like.
  • identity exists over a region that is at least about 25, 50, 75, 100, 150, 200 amino acids or nucleotides in length, and oftentimes over a region that is 225, 250, 300, 350, 400, 450, 500 amino acids or nucleotides in length or over the full-length of an amino acid or nucleic acid sequences.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
  • sequence algorithm program parameters Preferably, default program parameters can be used, or alternative parameters can be designated.
  • sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
  • a preferred example of algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST algorithms, which are described in Altschul et al. 1977 Nuc. Acids Res. 25:3389-3402 and Altschul et al. 1990 J. Mol. Biol. 215:403-410, respectively.
  • BLAST software is publicly available through the National Center for Biotechnology Information on the worldwide web at ncbi.nlm.nih.gov/. Both default parameters or other non-default parameters can be used.
  • the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci.
  • inhibitor refers to any measurable reduction of biological activity.
  • inhibit or “inhibition” may be referred to as a percentage of a normal level of activity.
  • the term“interleukin 12” or“IL12” refers to a polypeptide that has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% sequence identity to a native mammalian IL12 amino acid sequence that is biologically active, meaning the mutated protein (“mutein”) has functionality similar (75% or greater) to that of a native IL12 protein in at least one functional assay.
  • Exemplified functional assays of an IL12 polypeptide include inducing the production of interferon-gamma (IFN- g), for example, by T cells or natural killer (NK) cells, and promoting the differentiation of T helper- 1 (Thl) cells.
  • IFN- g interferon-gamma
  • Thl T helper- 1
  • a T helper cell differentiated into a Thl cell can be identified by secretion of IFN-g.
  • IFN- g secreted by IL-12 stimulated T cells or NK cells can be conveniently detected, for example, in serum or cell culture supernatant using ELISA.
  • kits for detecting IFN-g are commercially available (e.g ., R&D Systems, Minneapolis, Minn.; Peprotech, Rocky Hill, N.J.; and Biosource Inti, Camarillo, Calif.) See also, Coligan, et al, Current Methods in Immunology, 1991-2006, John Wiley & Sons; Harlow and Lane, Using Antibodies: A Laboratory Manual, 1998, Cold Spring Harbor Laboratory Press; and The ELISA Guidebook, Crowther, ed., 2000, Humana Press.
  • an“isolated” molecule such as a polypeptide or
  • polynucleotide is one that has been manipulated to exist in a higher concentration than in nature or has been removed from its native environment.
  • a subject antibody is isolated, purified, substantially isolated, or substantially purified when at least 10%, or 20%, or 40%, or 50%, or 70%, or 90% of non-subject-antibody materials with which it is associated in nature have been removed.
  • a polynucleotide or a polypeptide naturally present in a living animal is not“isolated,” but the same polynucleotide or polypeptide separated from the coexisting materials of its natural state is“isolated.”
  • recombinant DNA molecules contained in a vector are considered isolated for the purposes of the present invention.
  • Isolated RNA molecules include in vivo or in vitro RNA replication products of DNA and RNA molecules. Isolated nucleic acid molecules further include synthetically produced molecules. Additionally, vector molecules contained in recombinant host cells are also isolated. Thus, not all“isolated” molecules need be“purified.”
  • linker or“linking segment” refer to a molecule or group that connects two other molecules or groups.
  • a peptide linker may allow the connected molecules or groups to acquire a functional configuration.
  • the linker peptide preferably comprises at least two amino acids, at least three amino acids, at least five amino acids, at least ten amino acids, at least 15 amino acids, at least 20 amino acids, at least 30 amino acids, at least 40 amino acids, at least 50 amino acids, at least 60 amino acids, at least 70 amino acids, at least 80 amino acids, at least 90 amino acids or approximately 100 amino acids.
  • each component of a fusion protein can be organized in nearly any fashion provided that the fusion protein has the function for which it was intended.
  • each component of a fusion protein can be spaced from another component by at least one suitable peptide linker segment or sequence if desired.
  • the fusion protein may include tags, e.g., to facilitate modification, identification and/or purification of the fusion protein. More specific fusion proteins are in the examples described below.
  • the term“low dosage” refers to at least 5% less ( e.g ., at least 10%, 20%, 50%, 80%, 90%, or even 95%) than the lowest standard recommended dosage of a particular compound formulated for a given route of administration for treatment of any human disease or condition.
  • a low dosage of an agent that is formulated for administration by inhalation will differ from a low dosage of the same agent formulated for oral administration.
  • the term“medium” or“media” includes any culture medium, solution, solid, semi-solid, or rigid support that may support or contain any host cell, including bacterial host cells, yeast host cells, insect host cells, plant host cells, eukaryotic host cells, mammalian host cells, CHO cells, prokaryotic host cells, E. coli, or Pseudomonas host cells, and cell contents.
  • the term may encompass medium in which the host cell has been grown, e.g., medium into which a polypeptide has been secreted, including medium either before or after a proliferation step.
  • the term also may encompass buffers or reagents that contain host cell lysates, such as in the case where a polypeptide is produced intracellularly and the host cells are lysed or disrupted to release the polypeptide.
  • the term“modulate” refers to the production, either directly or indirectly, of an increase or a decrease, a stimulation, inhibition, interference, or blockage in a measured activity when compared to a suitable control.
  • a “modulator” of a polypeptide or polynucleotide refers to a substance that affects, for example, increases, decreases, stimulates, inhibits, interferes with, or blocks a measured activity of the polypeptide or polynucleotide, when compared to a suitable control.
  • a“modulator” may bind to and /or activate or inhibit the target with measurable affinity, or directly or indirectly affect the normal regulation of a receptor activity.
  • operably linked refers to a functional linkage between a first nucleic acid sequence and a second nucleic acid sequence, such that the first and second nucleic acid sequences are transcribed into a single nucleic acid sequence. Operably linked nucleic acid sequences need not be physically adjacent to each other.
  • the term“operably linked” also refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a transcribable nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the transcribable sequence.
  • the term“pharmaceutically acceptable” excipient, carrier, or diluent refers to a pharmaceutically acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting the subject pharmaceutical agent from one organ, or portion of the body, to another organ, or portion of the body.
  • a pharmaceutically acceptable material, composition or vehicle such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting the subject pharmaceutical agent from one organ, or portion of the body, to another organ, or portion of the body.
  • Each carrier must be “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the patient.
  • materials which can serve as pharmaceutically-acceptable carriers include: sugars, such as lactose, glucose and sucrose; starches, such as com starch and potato starch; cellulose, and its derivatives, such as sodium carboxymethyl cellulose, ethyl cellulose and cellulose acetate; powdered tragacanth; malt; gelatin; talc; excipients, such as cocoa butter and suppository waxes; oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, com oil and soybean oil; glycols, such as propylene glycol;
  • polyols such as glycerin, sorbitol, mannitol and polyethylene glycol
  • esters such as ethyl oleate and ethyl laurate
  • agar buffering agents, such as magnesium hydroxide and aluminum hydroxide; alginic acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl alcohol; phosphate buffer solutions; and other non-toxic compatible substances employed in pharmaceutical formulations.
  • wetting agents such as sodium lauryl sulfate, magnesium stearate, and polyethylene oxide-polypropylene oxide copolymer as well as coloring agents, release agents, coating agents, sweetening, flavoring and perfuming agents, preservatives and antioxidants can also be present in the compositions.
  • nucleic acid As used herein, the terms“polynucleotide,”“nucleic acid molecule,”“nucleotide,” “oligonucleotide,” and “nucleic acid” are used interchangeably herein to refer to polymeric forms of nucleotides, including ribonucleotides as well as deoxyribonucleotides, of any length.
  • They can include both double-, single-stranded or triple helical sequences and include, but are not limited to, cDNA from viral, prokaryotic, and eukaryotic sources; mRNA; genomic DNA sequences from viral ( e.g ., DNA viruses and retroviruses) or prokaryotic sources; RNAi; cRNA; antisense molecules; recombinant polynucleotides; ribozymes; and synthetic DNA sequences.
  • the term also captures sequences that include any of the known base analogs of DNA and RNA. Nucleotides can be referred to by their commonly accepted single-letter codes.
  • Polynucleotides are not limited to polynucleotides as they appear in nature, and also include polynucleotides where unnatural nucleotide analogues and inter-nucleotide bonds appear.
  • a nucleic acid molecule may comprise modified nucleic acid molecules (e.g., modified bases, sugars, and/or intemucleotide linkers).
  • Non-limitative examples of this type of unnatural structures include polynucleotides wherein the sugar is different from ribose, polynucleotides wherein the
  • the polynucleotides of the invention include unnatural inter nucleotide bonds such as peptide nucleic acids (PNA), locked nucleic acids (LNA), C1-C4 alkylphosphonate bonds of the methylphosphonate, phosphoramidate, C1-C6 alkylphosphotriester, phosphorothioate and phosphorodithioate type.
  • PNA peptide nucleic acids
  • LNA locked nucleic acids
  • C1-C4 alkylphosphonate bonds of the methylphosphonate phosphoramidate
  • C1-C6 alkylphosphotriester phosphorothioate
  • phosphorodithioate type phosphorodithioate type
  • nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g ., degenerate codon substitutions) and complementary sequences, as well as the sequence explicitly indicated.
  • Degenerate codon substitutions can be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues. (Batzer el al. 1991 Nucleic Acid Res. 19:5081; Ohtsuka e/ al. 1985 J. Biol. Chem. 260:2605-2608; Rossolini et al. 1994 Mol. Cell. Probes 8:91-98.)
  • the terms“prevent”,“preventing”, or“prevention” refer to a method for precluding, delaying, averting, or stopping the onset, incidence, severity, or recurrence of a disease or condition.
  • a method is considered to be a prevention if there is a reduction or delay in onset, incidence, severity, or recurrence of a disease or condition or one or more symptoms thereof in a subject susceptible to the disease or condition as compared to a subject not receiving the method.
  • the disclosed method is also considered to be a prevention if there is a reduction or delay in onset, incidence, severity, or recurrence of one or more symptoms of a disease or condition in a subject susceptible to the disease or condition after receiving the method as compared to the subject's progression prior to receiving treatment.
  • the reduction or delay in onset, incidence, severity, or recurrence of osteoporosis can be about a 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between.
  • Prevention and the like do not mean preventing a subject from ever getting the specific disease or disorder. Prevention may require the administration of multiple doses. Prevention can include the prevention of a recurrence of a disease in a subject for whom all disease symptoms were eliminated, or prevention of recurrence in a relapsing-remitting disease.
  • promoter refers to a DNA regulatory region capable of binding RNA polymerase in a mammalian cell and initiating transcription of a downstream (3' direction) coding sequence operably linked thereto.
  • a promoter sequence includes the minimum number of bases or elements necessary to initiate transcription of a gene of interest at levels detectable above background. Within the promoter sequence may be a transcription initiation site, as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase. Eukaryotic promoters will often, but not always, contain“TATA” boxes and“CAT” boxes.
  • Promoters include those that are naturally contiguous to a nucleic acid molecule and those that are not naturally contiguous to a nucleic acid molecule. Additionally, the term “promoter” includes inducible promoters, conditionally active promoters such as a cre-lox promoter, constitutive promoters, and tissue specific promoters.
  • the terms“protein” and“polypeptide” are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length. Thus, peptides, oligopeptides, dimers, multimers, and the like, are included within the definition. Both full-length proteins and fragments thereof are encompassed by the definition. The terms also include post expression modifications of the polypeptide, for example, glycosylation, acetylation,
  • a polypeptide may refer to a protein which includes modifications, such as deletions, additions, and substitutions (generally conservative in nature), to the native sequence, as long as the protein maintains the desired activity. These modifications may be deliberate or may be accidental. Amino acids can be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB
  • the term“purified” refers to a protein that may be substantially or essentially free of components that normally accompany or interact with the protein as found in its naturally occurring environment, i.e. a native cell, or host cell in the case of a recombinantly produced protein.
  • a protein that may be substantially free of cellular material includes preparations of protein having less than about 30%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, or less than about 1% (by dry weight) of contaminating protein(s).
  • the protein When a protein or variant thereof is recombinantly produced by the host cells, the protein may be present at about 30%, at about 20%, about 15%, about 10%, about 5%, about 4%, about 3%, about 2%, or about 1% or less of the dry weight of the cells.
  • the protein When a protein or variant thereof is recombinantly produced by the host cells, the protein may be present in the culture medium at about 5 g/L, about 4 g/L, about 3 g/L, about 2 g/L, about 1 g/L, about 750 mg/L, about 500 mg/L, about 250 mg/L, about 100 mg/L, about 50 mg/L, about 10 mg/L, or about 1 mg/L or less of the dry weight of the cells.
  • a“substantially purified” protein may have a purity level of at least at least about 80%, specifically, a purity level of at least about 85%, and more specifically, a purity level of at least about 90%, a purity level of at least about 95%, a purity level of at least about 99% or greater as determined by appropriate methods such as SDS/PAGE analysis, RP-HPLC, SEC, and capillary electrophoresis.
  • Proteins and prodrugs of the present invention are, subsequent to their preparation, preferably isolated and/or purified to obtain a composition containing an amount by weight equal to or greater than 80% (“substantially pure”), which is then used or formulated as described herein. In certain embodiments, the compounds of the present invention are more than 95% pure.
  • the term“receptor” refers to proteins, including glycoproteins or fragments thereof, capable of interacting with another molecule, called the ligand.
  • the ligand may belong to any class of biochemical or chemical compounds.
  • the ligand is usually an extracellular molecule which, upon binding to the receptor, usually initiates a cellular response, such as initiation of a signal transduction pathway.
  • the receptor need not necessarily be a membrane-bound protein.
  • the term“recombinant,” with respect to a nucleic acid molecule means a polynucleotide of genomic, cDNA, viral, semisynthetic, and/or synthetic origin which, by virtue of its origin or manipulation, is not associated with all or a portion of the polynucleotide with which it is associated in nature.
  • the term “recombinant”, as used with respect to a protein or polypeptide means a polypeptide produced by expression of a recombinant polynucleotide.
  • the term“recombinant” as used with respect to a host cell means a host cell into which a recombinant polynucleotide has been introduced.
  • the term“recombinant virus” refers to a virus that is genetically modified by the hand of man. The phrase covers any virus known in the art.
  • sample refers to a sample from a human, animal, or to a research sample, e.g., a cell, tissue, organ, fluid, gas, aerosol, slurry, colloid, or coagulated material.
  • The“sample” may be tested in vivo, e.g., without removal from the human or animal, or it may be tested in vitro.
  • sample also refers, e.g., to a cell comprising a fluid or tissue sample or a cell separated from a fluid or tissue sample.“Sample” may also refer to a cell, tissue, organ, or fluid that is freshly taken from a human or animal, or to a cell, tissue, organ, or fluid that is processed or stored.
  • the term“soluble” refers to a fusion molecule, particularly a fusion protein, that is not readily sedimented under low G-force centrifugation (e.g., less than about 30,000 revolutions per minute in a standard centrifuge) from an aqueous buffer, e.g., cell media.
  • a fusion molecule is soluble if it remains in aqueous solution at a temperature greater than about 5-37° C. and at or near neutral pH in the presence of low or no concentration of an anionic or non-ionic detergent. Under these conditions, a soluble protein will often have a low sedimentation value, e.g., less than about 10 to 50 svedberg units.
  • Aqueous solutions referenced herein typically have a buffering compound to establish pH, typically within a pH range of about 5-9, and an ionic strength range between about 2 mM and 500 mM. Sometimes a protease inhibitor or mild non-ionic detergent is added. Additionally, a carrier protein may be added if desired (e.g., bovine serum albumin). Exemplary aqueous buffers include standard phosphate buffered saline, tris-buffered saline, or other well-known buffers and cell media formulations.
  • the terms“stimulate” or“stimulating” refer to increase, to amplify, to augment, to boost a physiological activity, e.g., an immune response. Stimulation can be a positive alteration. For example, an increase can be by 5%, 10%, 25%, 50%, 75%, or even 90-100%. Other exemplary increases include 2-fold, 5 -fold, 10-fold, 20-fold, 40-fold, or even lOO-fold.
  • the terms“subject” and“patient” are used interchangeably herein to refer to a living animal (human or non-human).
  • the subject may be a mammal.
  • the terms“mammal” or “mammalian” refer to any animal within the taxonomic classification mammalia.
  • a mammal may be a human or a non-human mammal, for example, dogs, cats, pigs, cows, sheep, goats, horses, rats, and mice.
  • the term "subject” does not preclude individuals that are entirely normal with respect to a disease or condition, or normal in all respects.
  • the terms“suppress” or“suppressing” refer to decrease, to attenuate, to diminish, to arrest, or to stabilize a physiological activity, e.g., an immune response. Suppression can be a negative alteration. For example, a decrease can be by 5%, 10%, 25%, 50%, 75%, or even 90- 100%. Exemplary decreases include 2-fold, 5 -fold, 10-fold, 20-fold, 40-fold, or even lOO-fold.
  • the term“therapeutically effective amount” refers to the dose of a therapeutic agent or agents sufficient to achieve the intended therapeutic effect with minimal or no undesirable side effects.
  • a therapeutically effective amount can be readily determined by a skilled physician, e.g., by first administering a low dose of the pharmacological agent(s) and then incrementally increasing the dose until the desired therapeutic effect is achieved with minimal or no undesirable side effects.
  • transfected means possessing introduced DNA or RNA, with or without the use of any accompanying facilitating agents such as lipofectamine.
  • Methods for transfection include, for example, calcium phosphate transfection, DEAE dextran transfection, protoplast fusion, electroporation, and lipofection.
  • treatment refers to a method of reducing, delaying or ameliorating such a condition, or one or more symptoms of such disease or condition, before or after it has occurred. Treatment may be directed at one or more effects or symptoms of a disease and/or the underlying pathology.
  • the treatment can be any reduction and can be, but is not limited to, the complete ablation of the disease or the symptoms of the disease. As compared with an equivalent untreated control, such reduction or degree of prevention is at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, or 100% as measured by any standard technique.
  • tumor refers to any malignant or neoplastic cell.
  • vector refers to a nucleic acid molecule that is able to transmit genetic material to a host cell or organism.
  • a vector may be composed of either DNA or RNA.
  • a vector carries its own origin of replication, one or more unique recognition sites for restriction endonucleases which can be used for the insertion of foreign DNA, and usually selectable markers such as genes coding for antibiotic resistance, and often recognition sequences ( e.g ., promoter) for the expression of the inserted DNA.
  • Common vectors include plasmid vectors and phage vectors.
  • compositions or methods disclosed herein can be combined with one or more of any of the other compositions and methods provided herein.
  • the invention provides novel fusion proteins and therapeutic uses thereof. More particularly, the invention provides novel fusion proteins of IL12 and prodrugs thereof, compositions and methods of preparation thereof, which are useful in treating various diseases and disorders, e.g., hyperplasia, solid tumor or hematopoietic malignancy with reduced off-target toxicities and side effects during treatment.
  • various diseases and disorders e.g., hyperplasia, solid tumor or hematopoietic malignancy with reduced off-target toxicities and side effects during treatment.
  • the invention generally relates to a fusion protein.
  • the fusion protein comprises: a first structural unit: one or two subunits of IL12 selected from P35 and P40 subunits, wherein the first structural unit is located at the N-terminus of the fusion protein; a second structural unit: an antibody Fc fragment, wherein the second structural unit is located at the C-terminus of the fusion protein; and a first linker segment covalently linking the first structural unit and the second structural unit or covalently linking the two subunits of the first structural unit.
  • the P35 and P40 subunits are derived from a mammal selected from the group consisting of human, monkey, mouse, dog, rat, cow, pig and sheep.
  • the P35 and P40 subunits are derived from human. In certain embodiments of the fusion protein, the P35 and P40 subunits are derived from monkey. In certain embodiments of the fusion protein, the P35 and P40 subunits are derived from mouse. In certain embodiments of the fusion protein, the P35 and P40 subunits are derived from dog. In certain embodiments of the fusion protein, the P35 and P40 subunits are derived from a mammal selected from rat. In certain embodiments of the fusion protein, the P35 and P40 subunits are derived from cow. In certain embodiments of the fusion protein, the P35 and P40 subunits are derived from pig. In certain embodiments of the fusion protein, the P35 and P40 subunits are derived from sheep.
  • Any suitable antibody Fc fragment may be employed.
  • the antibody Fc fragment comprises a human Fc fragment. In certain embodiments, the antibody Fc fragment comprises the amino acid sequence set forth in SEQ ID No. 5.
  • the antibody Fc fragment comprises a human IgGl. In certain embodiments, the antibody Fc fragment comprises the amino acid sequence set forth in SEQ ID No.
  • the human IgGl is human Fc-knob or human Fc-hole.
  • the human IgGl comprises the amino acid sequence set forth in
  • the mouse P35 subunit has the amino acid sequence set forth in SEQ ID No. 3.
  • the human P35 subunit has the amino acid sequence set forth in SEQ ID No. 4.
  • the mouse P40 subunit has the amino acid sequence set forth in SEQ ID No. 1.
  • the human P40 subunit has the amino acid sequence set forth in SEQ ID No. 2.
  • the first linker segment, Ll has the amino acid sequence set forth in SEQ ID No. 12.
  • the fusion protein further comprises a signal peptide, e.g., modified at the N-terminus of the first structural unit.
  • the signal peptide, SP1 modified at the N-terminus of the mouse P35 subunit comprises the amino acid sequence set forth in SEQ ID No. 27.
  • the signal peptide, SP1 modified at the N-terminus of the human P35 subunit comprises the amino acid sequence set forth in SEQ ID No. 28.
  • the signal peptide, SP2 modified at the N-terminus of the mouse P40 subunit comprises the amino acid sequence set forth in SEQ ID No. 29.
  • the signal peptide, SP2, modified at the N-terminus of the human P40 subunit comprises the amino acid sequence set forth in SEQ ID No. 30.
  • the fusion protein further comprises a portion of an interleukin 12 receptor (IL12R), linked covalently to the N-terminus of the first structural unit by a second linker segment (L2).
  • IL12R is selected from R 1 and RP2.
  • the mouse R l comprises the amino acid sequence set forth in SEQ ID No. 8 and the mouse R 2 comprises the amino acid sequence set forth in SEQ ID No. 10.
  • the human R 1 comprises the amino acid sequence set forth in SEQ ID No. 9 and the human R 2 comprises the amino acid sequence set forth in SEQ ID No. 11.
  • the second linker segment, L2 is capable of being recognized and hydrolyzed by a proteolytic enzyme specifically expressed in a tumor microenvironment.
  • the proteolytic enzyme specifically expressed in the tumor microenvironment is a matrix metalloproteinase, e.g., matrix metalloproteinase 14 (MMP14).
  • MMP14 matrix metalloproteinase 14
  • the second linker segment L2 comprises the amino acid sequence set forth in SEQ ID No. 13-26.
  • the C-terminus of the IL12R is linked to the N-terminus of the first structural unit via the L2; and the C-terminus of the first structural unit and the N-terminus of the second structural unit are linked by the Ll.
  • the first structural unit comprises two subunits
  • the C-terminus of the first subunit and the N-terminus of the second subunit are linked by linker segment Ll.
  • the invention generally relates to a homodimeric or heterodimeric protein, which comprises a fusion protein disclosed herein.
  • the homodimeric or heterodimeric protein is a homodimer of the monomer comprising a mouse P40 subunit, an Ll linker, a mouse P35 subunit, an Ll linker, and a fusion protein of human IgGl, e.g., having the amino acid sequence set forth in SEQ ID No. 31.
  • the homodimeric or heterodimeric protein is a homodimer of the monomer comprising a human P40 subunit, an Ll linker, a human P35 subunit, an Ll linker, and a fusion protein of human IgGl, e.g., having the amino acid sequence set forth in SEQ ID No. 32.
  • the homodimeric or heterodimeric protein is a heterodimer of a first monomer: a fusion protein comprising a mouse P40 subunit, an Ll linker, and a human Fc-knob, and having the amino acid sequence set forth in SEQ ID No. 33; and a second monomer: a fusion protein comprising a mouse P35 subunit, an Ll linker, and a human Fc-hole, e.g., having the amino acid sequence structure set forth in SEQ ID No. 35.
  • the homodimeric or heterodimeric protein is a heterodimer of a first monomer: a fusion protein comprising a human P40 subunit, an Ll linker, and a human Fc- knob, and having the amino acid sequence set forth in SEQ ID No. 34; and a second monomer: a fusion protein comprising a human P35 subunit, an Ll linker , and a human Fc-hole, e.g., having the amino acid sequence structure set forth in SEQ ID No. 36.
  • the homodimeric or heterodimeric protein is a homodimer of the monomer: mouse IL 12Kb 1 , an L2 linker, a mouse P40 subunit, an Ll linker, a mouse P35 subunit, an Ll linker, and human IgGl, e.g., having the amino acid sequence set forth in SEQ ID No. 37.
  • the homodimeric or heterodimeric protein is a homodimer of the monomer: human IL 12R 1 , an L2 linker, a human P40 subunit, an Ll linker, a human P35 subunit, an Ll linker, and human IgGl, e.g., having the amino acid sequence set forth in SEQ ID No. 38.
  • the homodimeric or heterodimeric protein is a homodimer of the monomer: mouse ILl2R ⁇ 12, an L2 linker, a mouse P40 subunit, an Ll linker, a mouse P35 subunit, an Ll linker, and human IgGl, e.g., having the amino acid sequence set forth in SEQ ID No. 39.
  • the homodimeric or heterodimeric protein is a homodimer of the monomer: human IL 12R.p2, an L2 linker, a human P40 subunit, an Ll linker, a human P35 subunit, an Ll linker, and human IgGl, e.g., having the amino acid sequence set forth in SEQ ID No. 40.
  • the homodimeric or heterodimeric protein is a heterodimer of a first monomer: mouse IL 12R 1 , an L2 linker, a mouse P40 subunit, an Ll linker, a fusion protein of human Fc-knob, e.g., having the amino acid sequence set forth in SEQ ID No. 41; and a second monomer: a fusion protein of mouse ILl2R ⁇ 12, an L2 linker, a mouse P35 subunit, an Ll linker, and human Fc-hole of IL12, e.g., having the amino acid sequence set forth in SEQ ID No. 43.
  • the homodimeric or heterodimeric protein is a heterodimer of a first monomer: human IL 12R 1 , an L2 linker, a human P40 subunit, an Ll linker, a fusion protein of human Fc-knob, e.g., having the amino acid sequence set forth in SEQ ID No. 42; and a second monomer: a fusion protein of human ILl2R ⁇ 12, an L2 linker, a human P35 subunit, an Ll linker, and human Fc-hole of IL12, e.g., having the amino acid sequence set forth in SEQ ID No. 44.
  • the homodimeric or heterodimeric protein is a heterodimer of a first monomer: mouse IL 12R 1 , an L2 linker, a mouse P40 subunit, an Ll linker, a fusion protein of a human Fc-knob, e.g., having the amino acid sequence set forth in SEQ ID No. 45; and a second monomer: a fusion protein comprising a mouse P35 subunit comprising an SP1 signal peptide, an Ll linker, and a human Fc-hole, e.g., having the amino acid sequence set forth in SEQ ID No. 47.
  • the homodimeric or heterodimeric protein is a heterodimer of a first monomer: human ILl2R]3l, an L2 linker, a human P40 subunit, an Ll linker, a fusion protein of a human Fc-knob, e.g., having the amino acid sequence set forth in SEQ ID No. 46; and a second monomer: a fusion protein comprising a human P35 subunit comprising an SP1 signal peptide, an Ll linker, and a human Fc-hole, e.g., having the amino acid sequence set forth in SEQ ID No. 48.
  • the homodimeric or heterodimeric protein is a heterodimer of a first monomer: a fusion protein comprising a mouse P40 subunit, an Ll linker, and a human Fc-knob, e.g., having the amino acid sequence set forth in SEQ ID No. 49; and a second monomer: a fusion protein comprising mouse ILl2R ⁇ S2, an L2 linker, a mouse P35 subunit, an Ll linker, and human Fc- hole, e.g., having the amino acid sequence set forth in SEQ ID No. 51.
  • the homodimeric or heterodimeric protein is a heterodimer of a first monomer: a fusion protein comprising a human P40 subunit, an Ll linker, and a human Fc- knob, e.g., having the amino acid sequence set forth in SEQ ID No. 50; and a second monomer: a fusion protein comprising human ILl2R ⁇ S2, an L2 linker , a human P35 subunit, an Ll linker , and human Fc-hole, e.g., having the amino acid sequence set forth in SEQ ID No. 52.
  • the homodimeric or heterodimeric protein is hydrolyzed by a proteolytic enzyme specifically expressed in a tumor microenvironment.
  • the invention generally relates to a substantially purified protein, such as a fusion protein or a fragment, disclosed herein.
  • the invention generally relates to a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
  • the invention generally relates to an expression vector comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
  • the invention generally relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent.
  • the invention generally relates to a pharmaceutical composition
  • a pharmaceutical composition comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent.
  • the invention generally relates to a method for treating a disease or condition.
  • the method comprises administering to a patient in need thereof a therapeutically effective amount of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein, wherein the disease or condition is selected from hyperplasia, solid tumor or hematopoietic malignancy.
  • the disease or condition being treated is hyperplasia.
  • the disease or condition being treated is a solid tumor.
  • the disease or condition being treated is a hematopoietic malignancy.
  • the subject being treated is further administered one or more of chemotherapy, radiotherapy, targeted therapy, immunotherapy or hormonal therapy.
  • the method further comprises administering a chemotherapeutic agent to the subject.
  • the method further comprises administering a radiotherapy to the subject.
  • the method further comprises administering a targeted therapy to the subject.
  • the method further comprises administering an immunotherapy to the subject.
  • the method further comprises administering hormonal therapy to the subject.
  • chemotherapeutic agent refers to a chemical compound useful in the treatment of cancer.
  • examples of chemotherapeutic agents include Erlotinib (TARCEVA®, Genentech/OSI Pharm.), Bortezomib (VELCADE®, Millennium Pharm.), Fulvestrant
  • Imatinib mesylate GLEEVEC®, Novartis
  • PTK787/ZK 222584 Novartis
  • Oxaliplatin Eloxatin®, Sanofi
  • 5-FU 5-fluorouracil
  • Leucovorin Rapamycin (Sirolimus, RAPAMUNE®, Wyeth)
  • Lapatinib TYKERB®, GSK572016, Glaxo Smith Kline
  • Lonafamib SCH 66336
  • Sorafenib BAY43-9006, Bayer Labs
  • Gefitmib IRESSA®, AstraZeneca
  • alkylating agents such as thiotepa and CYTOXAN® cyclosphosphamide
  • alkyl sulfonates such as busulfan, improsulfan and piposulfan
  • aziridines such as benzodopa, carboquone, me
  • calicheamicin especially calicheamicin gammall and calicheamicin omegall (Angew Chem. Intl. Ed. Engl. (1994) 33: 183-186); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6- diazo-5-oxo-L-norleucine, ADRIAMYCIN ® (doxorubicin), morpholino-doxorubicin,
  • cyanomorpholino-doxorubicin 2-pyrrolino-doxorubicin and deoxydoxorubicin
  • epirubicin esonibicin, idarubicin, marcellomycin
  • mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin
  • anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogs such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6- mercaptopurine, thiamniprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carm
  • dromostanolone propionate epitiostanol, mepitiostane, testolactone
  • anti-adrenals such as aminoglutethimide, mitotane, trilostane
  • folic acid replenisher such as frobnic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phena
  • mitobronitol mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide;
  • thiotepa thiotepa
  • taxoids e.g. , TAXOL ® (paclitaxel; Bristol-Myers Squibb Oncology, Princeton, N.J.), ABRAXANE® (Cremophor-free), albumin-engineered nanoparticle formulations of paclitaxel (American Pharmaceutical Partners, Schaumberg, 111.), and TAXOTERE ® (doxetaxel; Rhone- Poulenc Rorer, Antony, France); chloranmbucil; GEMZAR ® (gemcitabine); 6-thioguanine;
  • mercaptopurine methotrexate
  • platinum analogs such as cisplatin and carboplatin
  • vinblastine
  • etoposide VP- 16
  • ifosfamide mitoxantrone; vincristine
  • NAVELBINE ® vinylelbine
  • novantrone teniposide
  • edatrexate daunomycin
  • aminopterin capecitabine
  • XELODA XELODA ®
  • ibandronate CPT-l l
  • topoisomerase inhibitor RFS 2000 difluoromethylomithine (DMFO); retinoids such as retinoic acid
  • pharmaceutically acceptable salts, acids and derivatives of any of the above etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine; NAVELBINE ® (vinorelbine); novantrone; teniposide; edatrexate; daunomycin; aminopterin; capecitabine (XELODA ® ); ibandronate; CPT-l l; topoisome
  • Examples of the second (or further) agent or therapy may include, but are not limited to, immunotherapies (e.g . PD-l inhibitors (pembrolizumab, nivolumab, cemiplimab), PD-L1 inhibitors (atezolizumab, avelumab, durvalumab), CTLA4 antagonists (ipilimumab), cell signal transduction inhibitors (e.g., imatinib, gefitinib, bortezomib, erlotinib, sorafenib, sunitinib, dasatinib, vorinostat, lapatinib, temsirolimus, nilotinib, everolimus, pazopanib, trastuzumab, bevacizumab, cetuximab, ranibizumab, pegaptanib, panitumumab and the like), mitosis inhibitors (e.
  • the invention generally relates to use of a protein, such as a fusion protein or a fragment thereof, disclosed herein for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
  • a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy.
  • the invention generally relates to use of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
  • a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy.
  • the invention generally relates to use of a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent, in preparation of a medicament for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
  • a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy
  • the invention generally relates to use of a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein and a pharmaceutically acceptable excipient, carrier, or diluent, in preparation of a medicament for treating or reducing a disease or disorder (e.g., hyperplasia, solid tumor or hematopoietic malignancy).
  • a disease or disorder e.g., hyperplasia, solid tumor or hematopoietic malignancy.
  • the medicament is an anticancer drug.
  • the disease or disorder is one or more selected from head and neck cancer, endometrial cancer, colorectal cancer, ovarian cancer, breast cancer, melanoma, lung cancer, renal cancer, liver cancer, anal cancer, sarcoma, lymphoma, leukemia, brain tumors, gastric cancer, testicular cancer, pancreatic cancer, and thyroid cancer.
  • the anticancer drug is effective for treating B-cell lymphoma or anti-colorectal cancer.
  • the invention generally relates to a cell line comprising a polynucleotide encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein.
  • the invention generally relates to a method for making a protein, comprising culturing the cell line.
  • the method further comprises purifying or isolating a produced protein, such as a fusion protein or a fragment thereof, disclosed herein.
  • the invention generally relates to a method for making a protein.
  • the method comprises: providing an expression vector encoding a protein, such as a fusion protein or a fragment thereof, disclosed herein; introducing the expression vector into a host cell; culturing the host cell in media under conditions sufficient to express the protein; and purifying the protein from the host cell or media.
  • Any suitable expression vectors may be employed.
  • An exemplary expression vector is rEE12.4 expression vector.
  • Any suitable host cell may be employed, for examples, 293F and CHO cells.
  • Introduction of the expression vector can be accomplished by any suitable transfection method and can be via a transient transfection or a stable cell line.
  • Any suitable purification method may be employed.
  • An exemplary purification method is by affinity chromatography of ProteinA/G or size exclusion methods.
  • the invention generally relates to an isolated protein produced by a method disclosed herein.
  • the isolated protein is substantially pure.
  • linker sequences can be used to link two or more polypeptides of the biologically active polypeptide to generated a single-chain molecule with a desired functional activity.
  • exemplary peptide linker sequences include those having from about 7 to 20 amino acids, e.g., from about 8 to 16 amino acids.
  • the linker sequence is preferably flexible so as not hold the biologically active polypeptide or effector molecule in a single undesired conformation.
  • the linker sequence can be used, e.g., to space the recognition site from the fused molecule.
  • the peptide linker sequence can be positioned so as to provide molecular flexibility.
  • the linker preferably predominantly comprises amino acids with small side chains, such as glycine, alanine and serine, to provide for flexibility.
  • preparation of the fusion protein complexes of the invention can be accomplished by procedures disclosed herein and by recognized recombinant DNA techniques involving, e.g., polymerase chain amplification reactions (PCR), preparation of plasmid DNA, cleavage of DNA with restriction enzymes, preparation of oligonucleotides, ligation of DNA, isolation of mRNA, introduction of the DNA into a suitable cell, transformation or transfection of a host, culturing of the host.
  • the fusion molecules can be isolated and purified using chaotropic agents and well known electrophoretic, centrifugation and chromatographic methods. (Sambrook, et al., Molecular Cloning: A Laboratory Manual (2nd ed. (1989); and Ausubel, et al, Current Protocols in Molecular Biology, John Wiley & Sons, New York (1989) for disclosure relating to these methods.)
  • the invention further provides nucleic acid sequences and DNA sequences that encode the present fusion proteins.
  • the DNA sequence may be carried by a vector suited for
  • extrachromosomal replication such as a phage, virus, plasmid, phagemid, cosmid, YAC, or episome.
  • a DNA vector that encodes a desired fusion protein can be used to facilitate preparative methods described herein and to obtain significant quantities of the fusion protein or components thereof.
  • the DNA sequence can be inserted into an appropriate expression vector, i.e., a vector that contains the necessary elements for the transcription and translation of the inserted protein-coding sequence.
  • a variety of host- vector systems may be utilized to express the protein-coding sequence.
  • viruses may include mammalian cell systems infected with virus (e.g., vaccinia virus, adenovirus, etc.); insect cell systems infected with virus (e.g., baculovirus); microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage DNA, plasmid DNA or cosmid DNA.
  • virus e.g., vaccinia virus, adenovirus, etc.
  • insect cell systems infected with virus e.g., baculovirus
  • microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage DNA, plasmid DNA or cosmid DNA.
  • any one of a number of suitable transcription and translation elements may be used.
  • Fusion protein components encoded by the DNA vector can be provided in a cassette format.
  • cassette is meant that each component can be readily substituted for another component by standard recombinant methods.
  • a DNA vector configured in a cassette format is particularly desirable when the encoded fusion complex is to be used against pathogens that may have or have capacity to develop serotypes.
  • DNA coding for the biologically active polypeptide is linked to a sequence coding for the effector peptide by use of suitable ligases.
  • DNA coding for the presenting peptide can be obtained by isolating DNA from natural sources such as from a suitable cell line or by known synthetic methods, e.g. the phosphate triester method. (Oligonucleotide Synthesis, IRL Press, M. J. Gait, ed., 1984). Synthetic
  • oligonucleotides also may be prepared using commercially available automated oligonucleotide synthesizers.
  • the gene coding for the biologically active polypeptide can be amplified by PCR or other means known in the art. Suitable PCR primers to amplify the biologically active polypeptide gene may add restriction sites to the PCR product.
  • the PCR product preferably includes splice sites for the effector peptide and leader sequences necessary for proper expression and secretion of the biologically active polypeptide-effector fusion complex.
  • the PCR product also preferably includes a sequence coding for the linker sequence, or a restriction enzyme site for ligation of such a sequence.
  • the fusion proteins described herein may be produced by standard recombinant DNA techniques. For example, once a DNA molecule encoding the biologically active polypeptide is isolated, sequence can be ligated to another DNA molecule encoding the effector polypeptide.
  • the nucleotide sequence coding for a biologically active polypeptide may be directly joined to a DNA sequence coding for the effector peptide or, more typically, a DNA sequence coding for the linker sequence as discussed herein may be interposed between the sequence coding for the biologically active polypeptide and the sequence coding for the effector peptide and joined using suitable ligases.
  • the resultant hybrid DNA molecule can be expressed in a suitable host cell to produce the fusion protein complex.
  • the DNA molecules are ligated to each other in a 5' to 3' orientation such that, after ligation, the translational frame of the encoded polypeptides is not altered (i.e., the DNA molecules are ligated to each other in-frame).
  • the resulting DNA molecules encode an in-frame fusion protein.
  • nucleotide sequences also can be included in the gene construct.
  • a promoter sequence which controls expression of the sequence coding for the biologically active polypeptide fused to the effector peptide, or a leader sequence, which directs the fusion protein to the cell surface or the culture medium, can be included in the construct or present in the expression vector into which the construct is inserted.
  • polypeptides may be modified by certain amino acid substitutions, additions, deletions, and post-translational modifications, without loss or reduction of biological activity.
  • conservative amino acid substitutions that is, substitution of one amino acid for another amino acid of similar size, charge, polarity and conformation, are unlikely to significantly alter protein function.
  • the 20 standard amino acids that are the constituents of proteins can be broadly categorized into four groups of conservative amino acids as follows: the nonpolar (hydrophobic) group includes alanine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan and valine; the polar (uncharged, neutral) group includes asparagine, cysteine, glutamine, glycine, serine, threonine and tyrosine; the positively charged (basic) group contains arginine, histidine and lysine; and the negatively charged (acidic) group contains aspartic acid and glutamic acid.
  • the nonpolar (hydrophobic) group includes alanine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan and valine
  • the polar (uncharged, neutral) group includes asparagine, cysteine, glutamine, glycine, serine, threonine and
  • Homology between nucleotide sequences can be determined by DNA hybridization analysis, wherein the stability of the double-stranded DNA hybrid is dependent on the extent of base pairing that occurs. Conditions of high temperature and/or low salt content reduce the stability of the hybrid, and can be varied to prevent annealing of sequences having less than a selected degree of homology. For instance, for sequences with about 55% G-C content, hybridization and wash conditions of 40-50 C, 6*SSC (sodium chloride/sodium citrate buffer) and 0.1% SDS (sodium dodecyl sulfate) indicate about 60-70% homology, hybridization and wash conditions of 50-65 C,
  • HSSC and 0.1% SDS indicate about 82-97% homology, and hybridization and wash conditions of 52 C, O. HSSC and 0.1% SDS indicate about 99-100% homology.
  • a wide range of computer programs for comparing nucleotide and amino acid sequences (and measuring the degree of homology) are also available. Readily available sequence comparison and multiple sequence alignment algorithms are, respectively, the Basic Local Alignment Search Tool (BLAST) and ClustalW programs.
  • BLAST Basic Local Alignment Search Tool
  • fusion protein construct described above can be incorporated into a suitable vector by known means such as by use of restriction enzymes to make cuts in the vector for insertion of the construct followed by ligation.
  • the vector containing the gene construct is then introduced into a suitable host for expression of the fusion protein.
  • Suitable host cells include eukaryotic and prokaryotic cells, preferably those cells that can be easily transformed and exhibit rapid growth in culture medium.
  • preferred hosts cells include prokaryotes such as E. colt, Bacillus subtillus, etc. and eukaryotes such as animal cells and yeast strains, e.g., S. cerevisiae.
  • Mammalian cells are generally preferred, particularly J558, NSO, SP2-0 or CHO.
  • Other suitable hosts include, e.g., insect cells such as Sf9. Conventional culturing conditions are employed. See Sambrook, supra. Stable transformed or transfected cell lines can then be selected.
  • Cells expressing a fusion protein complex of the invention can be determined by known procedures. For example, expression of a fusion protein complex linked to an immunoglobulin can be determined by an ELISA specific for the linked immunoglobulin and/or by immunoblotting. Other methods for detecting expression of fusion proteins comprising biologically active polypeptides linked to IL12 or IL12R domains are disclosed in the Examples.
  • a host cell can be used for preparative purposes to propagate nucleic acid encoding a desired fusion protein or a component thereof.
  • a host cell can include a prokaryotic or eukaryotic cell in which production of the fusion protein is specifically intended.
  • host cells specifically include yeast, fly, worm, plant, frog, mammalian cells and organs that are capable of propagating nucleic acid encoding the fusion.
  • mammalian cell lines which can be used include CHO dhfr-cells (Urlaub and Chasm, 1980 Proc. Natl. Acad. Sci. USA, 77:4216), 293 cells (Graham et al. 1977 J. Gen. Virol., 36:59 ()) or myeloma cells like SP2 or NSO (Galfre and
  • Host cells capable of propagating nucleic acid encoding a desired fusion protein complexs encompass non-mammalian eukaryotic cells as well, including insect (e.g., Sp . frugiperda), yeast (e.g., S. cerevisiae, S. pombe, P. pastoris, K. lactis, H. polymorpha; as generally reviewed by Fleer, R., 1992 Current Opinion in Biotechnology, 3(5):486496), fungal and plant cells. Also contemplated are certain prokaryotes such as E. colt and Bacillus.
  • Nucleic acid encoding a desired fusion protein can be introduced into a host cell by standard techniques for transfecting cells.
  • the term“transfecting” or“transfection” is intended to encompass all conventional techniques for introducing nucleic acid into host cells, including calcium phosphate co-precipitation, DEAE-dextran-mediated transfection, lipofection, electroporation, microinjection, viral transduction and/or integration.
  • promoters transcriptional initiation regulatory region
  • the selection of the appropriate promoter is dependent upon the proposed expression host. Promoters from heterologous sources may be used as long as they are functional in the chosen host.
  • Promoter selection is also dependent upon the desired efficiency and level of peptide or protein production.
  • Inducible promoters such as tac are often employed in order to dramatically increase the level of protein expression in E. coli. Overexpression of proteins may be harmful to the host cells. Consequently, host cell growth may be limited.
  • the use of inducible promoter systems allows the host cells to be cultivated to acceptable densities prior to induction of gene expression, thereby facilitating higher product yields.
  • Various signal sequences may be used according to the invention.
  • a signal sequence which is homologous to the biologically active polypeptide coding sequence may be used.
  • a signal sequence which has been selected or designed for efficient secretion and processing in the expression host may also be used.
  • a signal sequence may be joined directly through the sequence encoding the signal peptidase cleavage site to the protein coding sequence, or through a short nucleotide bridge.
  • the expression construct can be assembled by employing known recombinant DNA techniques. Restriction enzyme digestion and ligation are the basic steps employed to join two fragments of DNA. Polylinkers and adaptors may be employed to facilitate joining of selected fragments.
  • the expression construct can typically be assembled in stages employing rounds of restriction, ligation, and transformation of E. coli. Numerous cloning vectors suitable for construction of the expression construct are known in the art (lZAR and pBLUESCRIPT SK-l, Stratagene, La Jolla, Calif., pET, Novagen Inc., Madison, Wis.).
  • the expression construct may be transformed into the host as the cloning vector construct, either linear or circular, or may be removed from the cloning vector and used as is or introduced onto a delivery vector.
  • the delivery vector facilitates the introduction and maintenance of the expression construct in the selected host cell type.
  • the expression construct is introduced into the host cells by any of a number of known gene transfer systems (e.g., natural competence, chemically mediated transformation, protoplast transformation, electroporation, biolistic transformation, transfection, or conjugation). The gene transfer system selected depends upon the host cells and vector systems used.
  • the present invention further provides a production process for isolating a fusion protein of interest.
  • a host cell e.g., a yeast, fungus, insect, bacterial or animal cell
  • a nucleic acid encoding the protein of the interest operatively linked to a regulatory sequence is grown at production scale in a culture medium to stimulate transcription of the nucleotides sequence encoding the fusion protein of interest.
  • the fusion protein of interest is isolated from harvested host cells or from the culture medium.
  • Standard protein purification techniques can be used to isolate the protein of interest from the medium or from the harvested cells.
  • the purification techniques can be used to express and purify a desired fusion protein on a large-scale (i.e. in at least milligram quantities) from a variety of implementations including roller bottles, spinner flasks, tissue culture plates, bioreactor, or a fermentor.
  • An expressed protein fusion complex can be isolated and purified by known methods. Typically the culture medium is centrifuged or filtered and then the supernatant is purified by affinity or immunoaffmity chromatography, e.g. Protein- A or Protein-G affinity chromatography or an immunoaffmity protocol comprising use of monoclonal antibodies that bind the expressed fusion complex such as a linked TCR or immunoglobulin region thereof.
  • affinity or immunoaffmity chromatography e.g. Protein- A or Protein-G affinity chromatography or an immunoaffmity protocol comprising use of monoclonal antibodies that bind the expressed fusion complex such as a linked TCR or immunoglobulin region thereof.
  • the fusion proteins of the present invention can be separated and purified by appropriate combination of known techniques.
  • methods utilizing solubility such as salt precipitation and solvent precipitation
  • methods utilizing the difference in molecular weight such as dialysis, ultra-filtration, gel-filtration, and SDS-polyacrylamide gel electrophoresis
  • methods utilizing a difference in electrical charge such as ion-exchange column chromatography
  • methods utilizing specific affinity such as affinity chromatography
  • methods utilizing a difference in hydrophobicity such as reverse- phase high performance liquid chromatography
  • methods utilizing a difference in isoelectric point such as isoelectric focusing electrophoresis
  • metal affinity columns such as Ni-NTA.
  • the fusion proteins of the present invention be substantially pure. That is, the fusion proteins have been isolated from cell substituents that naturally accompany it so that the fusion proteins are present preferably in at least 80% or 90% to 95% homogeneity (w/w). Fusion proteins having at least 98 to 99% homogeneity (w/w) are most preferred for many pharmaceutical, clinical and research applications.
  • the fusion protein should be substantially free of contaminants for therapeutic applications.
  • the soluble fusion proteins can be used therapeutically, or in performing in vitro or in vivo assays as disclosed herein. Substantial purity can be determined by a variety of standard techniques such as chromatography and gel electrophoresis.
  • the invention also provides a pharmaceutical preparation comprising a therapeutically effective amount of a composition, a fusion protein, a polynucleotide, a gene construct, a vector or a host cell according to the invention and a pharmaceutically acceptable excipient or vehicle.
  • Preferred excipients for use in the present invention include sugars, starches, celluloses, gums and proteins.
  • the pharmaceutical composition of the invention is formulated in a pharmaceutical form for administration as a solid (for example tablets, capsules, lozenges, granules, suppositories, crystalline or amorphous sterile solids that can be reconstituted to provide liquid forms, etc.), liquid (for example solutions, suspensions, emulsions, elixirs, lotions, unguents, etc.) or semi-solid (gels, ointments, creams and similar).
  • a solid for example tablets, capsules, lozenges, granules, suppositories, crystalline or amorphous sterile solids that can be reconstituted to provide liquid forms, etc.
  • liquid for example solutions, suspensions, emulsions, elixirs, lotions, unguents, etc.
  • semi-solid gels, ointments,
  • compositions of the invention can be administered by any route, including, without limitation, oral, intravenous, intramuscular, intraarterial, intramedullary, intratecal, intraventricular, transdermic, subcutaneous, intraperitoneal, intranasal, enteric, topical, sublingual or rectal route.
  • routes including, without limitation, oral, intravenous, intramuscular, intraarterial, intramedullary, intratecal, intraventricular, transdermic, subcutaneous, intraperitoneal, intranasal, enteric, topical, sublingual or rectal route.
  • a revision of the different forms of administration of active principles, the excipients to be used and their manufacturing procedures can be found in Remington's Pharmaceutical Sciences (A. R.
  • compositions comprising said vehicles can be formulated by conventional procedures known in the state of the technique.
  • nucleic acids the polynucleotides of the invention, vectors or gene constructs
  • the invention contemplates specially prepared pharmaceutical compositions for administering said nucleic acids.
  • the pharmaceutical compositions can comprise said nucleic acids in naked form, in other words, in the absence of compounds protecting the nucleic acids from degradation by the organism's nucleases, which entails the advantage of eliminating the toxicity associated to the reagents used for transfection.
  • Suitable routes of administration for the naked compounds include intravascular, intratumoral, intracraneal, intraperitoneal, intrasplenic, intramuscular, subretinal, subcutaneous, mucous, topical and oral route (Templeton, 2002 DNA Cell Biol., 21 :857-867).
  • the nucleic acids can be administered forming part of liposomes, conjugated to cholesterol or conjugated to compounds capable of promoting translocation through cell membranes such as the Tat peptide derived from the TAT protein of EEV-l, the third helix of the homeodomain of the Antennapedia protein of D.
  • polynucleotide can be administered forming part of a plasmidic vector or of a viral vector, preferably vectors based on an adenovirus, in adeno-associated viruses or in retroviruses, such as viruses based on the virus of murine leukaemia (MLV) or on lentiviruses (HIV, FIV, EIAV).
  • a viral vector preferably vectors based on an adenovirus, in adeno-associated viruses or in retroviruses, such as viruses based on the virus of murine leukaemia (MLV) or on lentiviruses (HIV, FIV, EIAV).
  • compositions of the invention can be administered at doses of less than 10 mg per kilogram of body weight, preferably less than 5, 2, 1, 0.5, 0.1, 0.05, 0.01, 0.005, 0.001, 0.0005, 0.0001, 0.00005 or 0.00001 mg per each kg of body weight and less than 200 nmol of agent, in other words, approximately 4.4x l0 16 copies per kg of body weight or less than 1500, 750, 300, 150, 75, 15, 7.5, 1.5, 0.75, 0.15 or 0.075 nmol per Kg of body weight.
  • the unitary dose can be administered by injection, by inhalation or by topical administration.
  • the bifunctional polynucleotides and compositions of the invention can be administered directly into the organ in which the target mRNA is expressed in which case doses will be administered of between 0.00001 mg and 3 mg per organ, or preferably between 0.0001 and 0.001 mg per organ, about 0.03 and 3.0 mg per organ, about 0.1 and 3.0 mg per organ or between 0.3 and 3.0 mg per organ.
  • the dose will depend on the severity and response to the condition to be treated and may vary between several days and several months or until the condition is seen to remit.
  • the optimum dose can be determined by periodically measuring the agent's concentrations in the patient's organism.
  • the optimum dose can be determined from the EC50 values obtained through previous in vitro or in vivo tests in animal models.
  • the unitary dose can be administered once a day or less than once a day, preferably, less than once every 2, 4, 8 or 30 days. Alternatively, it is possible to administer an initial dose followed by one or several maintenance doses, generally in a lesser amount that the initial dose.
  • the maintenance regime may involve treating the patient with doses ranging between 0.01 pg and 1.4 mg/kg of body weight per day, for example 1, 0.1, 0.01, 0.001, or 0.00001 mg per kg of body weight per day.
  • Maintenance doses are administered, preferably, at most once every 5, 10 or 30 days.
  • the treatment must continue for a time that will vary according to the type of alteration suffered by the patient, its severity and the patient's condition.
  • the patient's evolution must be monitored in order to determine whether the dose ought to be increased in the case of the disease not responding to the treatment or whether the dose ought to be decreased in the case of observing an improvement in the disease or unwanted secondary effects.
  • the daily dose can be administered in a single dose or in two or more doses according to the particular circumstances. If a repeated administration or frequent administrations are required, it is advisable to implant an administration device, such as a pump, a semi-permanent catheter
  • compositions of the invention are administered according to methods known to an expert in the art, including, without limitation, intravenous, oral, nasal, parenteral, topical, transdermic, rectal and similar.
  • IL12 has two subunits, p35 and p40.
  • the Fc segment of human IgGl, human Fc-knob and human Fc-hole were used to construct the corresponding prodrugs.
  • the prodrug design links the two subunits of IF12 in serial or parallel. The specific forms are as follows:
  • FIG. 2 is a schematic diagram showing the structure of Heterodimer-IFl2-Fc (Het IF12), in which two subunits are linked in parallel.
  • the molecular weight of the dimer is 115KD
  • the prodrug forms block IF 12 from binding to either of its receptors or simultaneously block binding to both receptors, IL 12Kb 1 and IL 12R.p2.
  • a portion of the extracellular domain of IL 12Kb 1 comprised of two Fibronectin type-III domains (I+II) at the N-terminus of IFl2R ⁇ Sl and referred to as RJ31, is fused to the N-terminus of P40.
  • R ⁇ Sl serves as a decoy competitively preventing endogenous IL 12Kb 1 interaction with P40.
  • P35 is blocked using the two Fibronectin type-III domains (I+II) at the N-terminus of ILl2R ⁇ S2, referred to as R ⁇ S2, thereby preventing P35 interaction with endogenous ILl2R ⁇ S2.
  • FIG. 4 is a schematic diagram of the prodrug structure of Homodimer-ILl2-Rp2
  • dimer MW 250KD.
  • Het-Rl Heterodimer-ILl2-Rpl
  • dimer MW 144 KD
  • P35 signal peptide was added to the C-terminus of the fusion segment P35 of the P35-Fc-hole monomer in this dimer.
  • Het-R2 Heterodimer-ILl2-Rp2
  • dimer MW 153 KD
  • P40 signal peptide was added to the C-terminal of the fusion segment P40 of the P40-Fc-knob monomer in this dimer.
  • Example 1 The seven proteins described in Example 1 were expressed and produced. First, the recombinant DNA for each fusion protein, constructed on the expression vector rEE12.4, were transfected into 293F or CHO cells. The host cells were cultured and the cell supernatant was collected. Then, the protein was purified from the supernatant by affinity chromatography column of Protein A/G.
  • heterodimer protein spontaneously form a homodimer protein.
  • Hindlll, Nrul, BsiWI, and EcoRI are enzyme cleavage sites.
  • Homo IL12 Linker Ll between P40 and P35, Linker Ll between P35 and Fc.
  • Het IL12 Linker Ll between P40 and Fc, Linker Ll between P35 and Fc.
  • OptiCHOTM media at 37 ° C, 8% CO2, 135 rpm. After 4 days, the cells were expanded and cultured, and the concentration was not more than 3 c 10 6 cells/mL when expanded.
  • Sample preparation Suspension cell culture solution was transferred to a 500 mL centrifuge barrel and centrifuged at 8,000 rpm for 20 minutes. The supernatant was discarded and impurities were removed using a 0.45 pM filter. 0.05% NaN3 was added to prevent bacteria growth during the purification process.
  • the target protein solution was replaced with the desired buffer using a Zeba desalting spin column or a concentrated spin column (buffer pH is adjusted to avoid the isoelectric point of the protein).
  • buffer pH is adjusted to avoid the isoelectric point of the protein.
  • BSA BSA as a standard, the protein concentration was determined by SDS- PAGE electrophoresis (2.5 pg of protein loading per sample) and NanoDrop2000.
  • IF12 receptors are widely present in T, B, and NK cells, the use of IF12 is often accompanied by strong toxic side effects. Clinically, patients are mainly characterized by various blood diseases and liver toxicity. Various inflammatory cytokines in mouse serum were
  • HeiIL12 receptor yrodrus eliminates MC 38 tumor effectively
  • IL12 prodrugs were constructed by linking IL12 decoy receptors using a substrate sequence sensitive to certain proteolytic enzymes in order to castrate the decoy from IL12 in the tumor microenvironment.
  • the proteolytic enzyme capable of cleaving the substrate is more highly expressed in certain tumor types compared to normal tissue, therefore the localization of active IL12 at the tumor site is increased while systemic toxicity of IL12 is decreased.
  • the amount used was less than 5 pg/mouse, Het IL12 yielded a stronger antitumor effect on MC38 tumors than Homo IL12, and it was also more toxic.
  • Het IL12 (described in Example 1) was bound to a decoy IL12 receptor in several configurations (e.g. Het-Rl, Het-R2, Het-Rl/R2).
  • Homo IL12 linked to a decoy IL12 receptor e.g. Homo-Rl, Homo-R2
  • HeiIL12 yrodrus linked to IL12 receptor has fewer side effects when administered systemically
  • FIG. 12B-G The blood was taken from the mouse eye vein while being treated. The serum levels of inflammatory cytokines ILl2p70, TNF, IFN-g, MCP-l, IL-10 and IL-6 were measured.
  • Het IL12 linked to IL12 receptor prodrug (Het-Rl, Het-R2) has fewer toxic side effects than Het IL12 unlinked to IL12 receptor at a dose of 2.5 pg/mouse, and Het- R2 was less toxic than other types of prodrug.
  • the prodrug of ILl2-Fc linked to the IL12 receptor maintains antitumor effectiveness and increases the safety of the ILl2-Fc.
  • Low dose (2.5 pg) of Het IL12 prodrug linked to IL12 receptor completely eliminated MC38 tumors with a tumor volume of 130-150 mm 3 and the tumor did not relapse.
  • the former Het ILl2-Fc prodrug linked to the IL12 receptor
  • Het-R2 was the safest construct.
  • HEK-BlueTM IL12 reporter cell line assay (Invivogen).
  • HEK-BlueTM IL-12 cells are designed to detect bioactive human IL-12 by expressing a STAT4-inducible SEAP reporter gene. Binding of IL-12 to the IL-12R on the surface of HEK-BlueTM IL-12 cells triggers a signaling cascade leading to the activation STAT-4 with the subsequent production of SEAP.
  • HEK-BlueTM IL-12 cells activation was measured using QUANTI-BlueTM to detect SEAP in cell supernatant.
  • HEK-BlueTM IL-12 cells were gently rinsed in PBS and suspended in fresh, pre- warmed test medium (DMEM, 4.5 g/l glucose, 2mM L-glutamine, 10% (v/v) heat-inactivated PBS (30 mins at 56°C at ⁇ l x 10 6 cells/ml.
  • DMEM pre- warmed test medium
  • FIG. 14A shows IL12 activity of the Het-Rl prodrug after MMP14 digestion is comparable or greater than Het IL12. In contrast, Het-Rl without MMP14 digestion is less active, indicating that the prodrug blocking mechanism works as expected.
  • FIG. 14B shows activity of Het- R1/R2 prodrug after MMP14 digestion is comparable to Het IL12 and recombinant IL12. In contrast, Het-Rl /R2 without MMP14 digestion is less active, indicating that the prodrug blocking mechanism works as expected.
  • SEQ ID No. 1 mouse P40 subunit (no signal peptide)
  • SEQ ID No. 2 human P40 subunit (no signal peptide)
  • RVI PVSGPAR CLSQSRNLLK TTDDMVKTAR EKLKHYSCTA EDIDHEDITR
  • DQTSTLKTCL PLELHKNESC
  • LATRETSSTT RGSCLPPQKT SLMMTLCLGS IYEDLKMYQT EFQAINAALQ NHNHQQIILD
  • KGMLVAIDEL MQSLNHNGET LRQKPPVGEA DPYRVKMKLC ILLHAFSTRV VTINRVMGYL SSA
  • SEQ ID No. 4 human P35 subunit (no signal peptide)
  • SEQ ID No. 11 human RJ32 MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTWITCSLKPRQGCFHYSRRNKL
  • SEQ ID No. 28 human P35 signal peptide SP1
  • SEQ ID No. 30 human P40 signal peptide SP2
  • SEQ ID No. 31 mouse Homo IL-12
  • SEQ ID No. 32 human Homo IL12
  • SEQ ID No. 33 mouse Het IL-12 subunit 1
  • SEQ ID No. 34 human Het IL12 subunit 1
  • SEQ ID No. 35 mouse Het IL12 subunit 2
  • SEQ ID No. 36 human Het IL12 subunit 2
  • SEQ ID No. 37 mouse Homo-Rl
  • SEQ ID No. 38 human Homo-Rl
  • SEQ ID No. 39 mouse Homo-R2
  • SEQ ID No. 40 human Homo-R2
  • SEQ ID No. 41 mouse Het-Rl/R2 subunit 1
  • SEQ ID No. 42 human Het-Rl/R2 subunit 1
  • SEQ ID No. 43 mouse Het-Rl/R2 subunit 2
  • SEQ ID No. 44 human Het-Rl/R2 subunit 2
  • SEQ ID No. 48 human Het-Rl subunit 2
  • SEQ ID No. 50 human Het-R2 subunit 1
  • SEQ ID No. 52 human Het-R2 subunit 2
  • composition and/or method may be practiced without one or more of the specific details, or with other methods, components, materials, and so forth.
  • well-known structures, materials, or operations are not shown or described in detail to avoid obscuring aspects of the disclosure.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Toxicology (AREA)
  • Zoology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Immunology (AREA)
  • Cell Biology (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2019/028933 2018-04-25 2019-04-24 Interleukin 12 fusion proteins, and compositions and therapeutic methods thereof Ceased WO2019209965A2 (en)

Priority Applications (10)

Application Number Priority Date Filing Date Title
CN201980042842.4A CN112638938A (zh) 2018-04-25 2019-04-24 白介素12融合蛋白及其组合物和治疗方法
EA202092459A EA202092459A1 (ru) 2018-04-25 2019-04-24 Гибридные белки интерлейкина 12, композиции и способы терапевтического применения, которые их включают
JP2020559408A JP2021521822A (ja) 2018-04-25 2019-04-24 インターロイキン12融合タンパク質および組成物、ならびにその治療方法
EP19792585.2A EP3810639A4 (en) 2019-04-24 Interleukin 12 fusion proteins, and compositions and therapeutic methods thereof
CA3097995A CA3097995A1 (en) 2018-04-25 2019-04-24 Interleukin 12 fusion proteins, and compositions and therapeutic methods thereof
AU2019261411A AU2019261411B2 (en) 2018-04-25 2019-04-24 Interleukin 12 fusion proteins, and compositions and therapeutic methods thereof
US17/049,021 US12473337B2 (en) 2018-04-25 2019-04-24 Homodimeric or heterodimeric interleukin 12 fusion proteins, and compositions and therapeutic methods thereof
BR112020021791-3A BR112020021791A2 (pt) 2018-04-25 2019-04-24 proteínas de fusão de interleucina 12 e composições e métodos terapêuticos das mesmas
KR1020207033158A KR20210024446A (ko) 2018-04-25 2019-04-24 인터루킨 12 융합 단백질 및 이의 조성물 및 치료 방법
JP2024197045A JP2025032113A (ja) 2018-04-25 2024-11-11 インターロイキン12融合タンパク質および組成物、ならびにその治療方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
CN201810376920.1 2018-04-25
CN201810376920.1A CN110396133B (zh) 2018-04-25 2018-04-25 一种以白介素12为活性成分的融合蛋白型药物前体

Publications (2)

Publication Number Publication Date
WO2019209965A2 true WO2019209965A2 (en) 2019-10-31
WO2019209965A3 WO2019209965A3 (en) 2019-12-05

Family

ID=68294664

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/028933 Ceased WO2019209965A2 (en) 2018-04-25 2019-04-24 Interleukin 12 fusion proteins, and compositions and therapeutic methods thereof

Country Status (9)

Country Link
US (1) US12473337B2 (OSRAM)
JP (2) JP2021521822A (OSRAM)
KR (1) KR20210024446A (OSRAM)
CN (2) CN110396133B (OSRAM)
AU (1) AU2019261411B2 (OSRAM)
BR (1) BR112020021791A2 (OSRAM)
CA (1) CA3097995A1 (OSRAM)
EA (1) EA202092459A1 (OSRAM)
WO (1) WO2019209965A2 (OSRAM)

Cited By (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021016640A1 (en) * 2019-07-25 2021-01-28 The University Of Chicago Compositions and methods comprising protease-activated therapeutic agents
US11471490B2 (en) 2017-07-03 2022-10-18 Torque Therapeutics, Inc. T cells surface-loaded with immunostimulatory fusion molecules and uses thereof
WO2022226073A1 (en) * 2021-04-21 2022-10-27 Cue Biopharma, Inc. Mhc class ii t-cell modulatory polypeptides and methods of use thereof
WO2023004282A3 (en) * 2021-07-19 2023-05-04 Regeneron Pharmaceuticals, Inc. Il12 receptor agonists and methods of use thereof
JP2023520518A (ja) * 2020-04-01 2023-05-17 エクシリオ デベロップメント, インコーポレイテッド マスクされたil-12サイトカイン及びその切断産物
JP2023553323A (ja) * 2020-11-25 2023-12-21 エクシリオ デベロップメント, インコーポレイテッド 腫瘍特異的に切断可能なリンカー
JP2023553692A (ja) * 2020-12-18 2023-12-25 エフ. ホフマン-ラ ロシュ アーゲー 標的治療のための前駆体タンパク質及びキット
US12103954B2 (en) 2021-10-20 2024-10-01 Synthekine, Inc. Heterodimeric Fc cytokines and uses thereof
WO2024212827A1 (en) 2023-04-12 2024-10-17 Shanghai Kangabio Co., Limited Multifunctional molecules comprising masked interleukin 12 and methods of use
EP4314073A4 (en) * 2021-03-24 2025-02-19 Alkermes, Inc. Upar antibodies and fusion proteins with the same
WO2025119304A1 (en) * 2023-12-07 2025-06-12 Wuxi Biologics (Shanghai) Co., Ltd. Heterodimeric proteins against il-12 receptor
US12465640B2 (en) 2019-02-25 2025-11-11 The University Of Chicago Methods and compositions for treating inflammatory and autoimmune conditions with ECM-affinity peptides linked to anti-inflammatory agents

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020023702A1 (en) 2018-07-25 2020-01-30 AskGene Pharma, Inc. Novel il-21 prodrugs and methods of use thereof
CA3141626A1 (en) 2019-06-12 2020-12-17 AskGene Pharma, Inc. Novel il-15 prodrugs and methods of use thereof
CA3165927A1 (en) 2020-01-11 2021-07-15 AskGene Pharma, Inc. Novel masked cytokines and methods of use thereof
IL322055A (en) * 2023-01-13 2025-09-01 Regeneron Pharma IL12 receptor agonists and methods of using them
WO2025256578A1 (zh) * 2024-06-12 2025-12-18 龙启生物制药(杭州)有限公司 Treg细胞靶向IL12融合蛋白及其制备、治疗方法
WO2026020161A1 (en) * 2024-07-19 2026-01-22 Cytomx Therapeutics, Inc. Activatable il-12 constructs and related compositions and methods

Family Cites Families (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5116964A (en) 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
EP0939121B2 (de) 1989-09-12 2007-12-26 AHP Manufacturing B.V. TFN-bindende Proteine
ATE311895T1 (de) 1992-05-26 2005-12-15 Immunex Corp Neue zytokine die cd30 binden
AU1407997A (en) * 1995-12-01 1997-06-19 Beth Israel Hospital Il-12 p40 subunit fusion polypeptides and uses thereof
JP4046354B2 (ja) 1996-03-18 2008-02-13 ボード オブ リージェンツ,ザ ユニバーシティ オブ テキサス システム 増大した半減期を有する免疫グロブリン様ドメイン
CA2275183A1 (en) 1996-12-20 1998-07-02 Amgen Inc. Ob fusion protein compositions and methods
ES2590912T3 (es) * 1997-12-08 2016-11-24 Merck Patent Gmbh Proteínas de fusión heterodiméricas útiles para inmunoterapia dirigida y estimulación general del sistema inmunitario
US7754855B1 (en) 1999-07-13 2010-07-13 Bolder Biotechnology, Inc. Immunoglobulin fusion proteins
EP1418184A1 (en) * 2002-11-08 2004-05-12 Cell Center Cologne GmbH Recombinant fusion protein consisting of the p40 and p35 subunits of IL-12 and a ScFv and use thereof
WO2005037867A1 (en) 2003-10-15 2005-04-28 Pdl Biopharma, Inc. ALTERATION OF Fc-FUSION PROTEIN SERUM HALF-LIVES BY MUTAGENESIS OF POSITIONS 250, 314 AND/OR 428 OF THE HEAVY CHAIN CONSTANT REGION OF IG
JP4718274B2 (ja) 2005-08-25 2011-07-06 東京エレクトロン株式会社 半導体製造装置,半導体製造装置の流量補正方法,プログラム
EP1969000A2 (en) 2005-12-06 2008-09-17 Centre National de la Recherche Scientifique Cell penetrating peptides for intracellular delivery of molecules
MX387323B (es) * 2014-02-19 2025-03-18 Merck Patent Gmbh Il-12 dirigida al cáncer en combinación con il-7 para usarse en el tratamiento de cáncer.
CN105543279A (zh) * 2014-10-30 2016-05-04 常州卡斯比生物科技有限公司 一种防治辐射线损伤、肿瘤治疗的IL-12/Fc融合蛋白的制备方法及其药剂
CN104628870A (zh) * 2015-02-04 2015-05-20 中国药科大学 一种人IL12Rβ1-CHR蛋白及其Fc融合蛋白
CN105218682B (zh) * 2015-10-26 2019-05-07 杨晶 经il-12/cd62l融合蛋白改造的肿瘤治疗剂及其制法和用途
EP3184548A1 (en) * 2015-12-23 2017-06-28 Miltenyi Biotec GmbH Chimeric antigen receptor with cytokine receptor activating or blocking domain
WO2018030806A1 (ko) * 2016-08-10 2018-02-15 아주대학교산학협력단 항체 중쇄불변부위 이종이중체에 융합된 사이토카인 및 이를 포함하는 약제학적 조성물
US10696722B2 (en) * 2016-08-10 2020-06-30 Ajou University Industry-Academic Cooperation Foundation Heterodimeric Fc-fused cytokine and pharmaceutical composition comprising the same

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11471490B2 (en) 2017-07-03 2022-10-18 Torque Therapeutics, Inc. T cells surface-loaded with immunostimulatory fusion molecules and uses thereof
US12465640B2 (en) 2019-02-25 2025-11-11 The University Of Chicago Methods and compositions for treating inflammatory and autoimmune conditions with ECM-affinity peptides linked to anti-inflammatory agents
WO2021016640A1 (en) * 2019-07-25 2021-01-28 The University Of Chicago Compositions and methods comprising protease-activated therapeutic agents
JP2023520518A (ja) * 2020-04-01 2023-05-17 エクシリオ デベロップメント, インコーポレイテッド マスクされたil-12サイトカイン及びその切断産物
JP7771076B2 (ja) 2020-04-01 2025-11-17 エクシリオ デベロップメント, インコーポレイテッド マスクされたil-12サイトカイン及びその切断産物
JP2023553323A (ja) * 2020-11-25 2023-12-21 エクシリオ デベロップメント, インコーポレイテッド 腫瘍特異的に切断可能なリンカー
JP2023553692A (ja) * 2020-12-18 2023-12-25 エフ. ホフマン-ラ ロシュ アーゲー 標的治療のための前駆体タンパク質及びキット
EP4314073A4 (en) * 2021-03-24 2025-02-19 Alkermes, Inc. Upar antibodies and fusion proteins with the same
US12338293B2 (en) 2021-03-24 2025-06-24 Mural Oncology, Inc. UPAR antibodies and fusion proteins with the same
WO2022226073A1 (en) * 2021-04-21 2022-10-27 Cue Biopharma, Inc. Mhc class ii t-cell modulatory polypeptides and methods of use thereof
WO2023004282A3 (en) * 2021-07-19 2023-05-04 Regeneron Pharmaceuticals, Inc. Il12 receptor agonists and methods of use thereof
US12522638B2 (en) 2021-07-19 2026-01-13 Regeneron Pharmaceuticals, Inc. IL12 receptor agonists and methods of use thereof
US12103954B2 (en) 2021-10-20 2024-10-01 Synthekine, Inc. Heterodimeric Fc cytokines and uses thereof
US12522639B2 (en) 2021-10-20 2026-01-13 Synthekine, Inc. Heterodimeric FC cytokines and uses thereof
WO2024212827A1 (en) 2023-04-12 2024-10-17 Shanghai Kangabio Co., Limited Multifunctional molecules comprising masked interleukin 12 and methods of use
WO2025119304A1 (en) * 2023-12-07 2025-06-12 Wuxi Biologics (Shanghai) Co., Ltd. Heterodimeric proteins against il-12 receptor

Also Published As

Publication number Publication date
JP2025032113A (ja) 2025-03-11
BR112020021791A2 (pt) 2021-02-23
KR20210024446A (ko) 2021-03-05
EA202092459A1 (ru) 2021-06-15
JP2021521822A (ja) 2021-08-30
EP3810639A2 (en) 2021-04-28
US20220162280A1 (en) 2022-05-26
CA3097995A1 (en) 2019-10-31
CN112638938A (zh) 2021-04-09
WO2019209965A3 (en) 2019-12-05
AU2019261411A1 (en) 2020-11-26
CN110396133B (zh) 2021-07-23
AU2019261411B2 (en) 2024-11-14
CN110396133A (zh) 2019-11-01
US12473337B2 (en) 2025-11-18

Similar Documents

Publication Publication Date Title
AU2019261411B2 (en) Interleukin 12 fusion proteins, and compositions and therapeutic methods thereof
US12441781B2 (en) Interleukin 15 fusion proteins, and compositions and therapeutic methods thereof
JP3652582B2 (ja) タイプiiインターロイキン−1受容体
US20220402988A1 (en) Interleukin 15 fusion proteins and prodrugs, and compositions and methods thereof
US20020085992A1 (en) Method for treating inflammation
BR112016002614B1 (pt) Imunocitoquina e composição farmacêutica
US12522639B2 (en) Heterodimeric FC cytokines and uses thereof
EA005581B1 (ru) ПОЛИПЕПТИДЫ ЦИТОКИНА Zcyto10 ЧЕЛОВЕКА И МЫШИ, КОДИРУЮЩИЕ ИХ ПОЛИНУКЛЕОТИДЫ И АНТИТЕЛА К УКАЗАННЫМ ПОЛИПЕПТИДАМ
WO2022015711A1 (en) Fusion proteins of anti-pd-l1 and attenuated interferon, and compositions and therapeutic methods thereof
AU2021202787A1 (en) Combination therapy for the treatment of cancer
US20260070957A1 (en) Interleukin 15 fusion proteins, and compositions and therapeutic methods thereof
HK40050873A (en) Interleukin 12 fusion proteins, and compositions and therapeutic methods thereof
HK40050872A (en) Interleukin 15 fusion proteins, and compositions and therapeutic methods thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19792585

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2020559408

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3097995

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020021791

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 20207033158

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019261411

Country of ref document: AU

Date of ref document: 20190424

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019792585

Country of ref document: EP

Effective date: 20201125

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19792585

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 112020021791

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20201023

WWW Wipo information: withdrawn in national office

Ref document number: 202092459

Country of ref document: EA

WWW Wipo information: withdrawn in national office

Ref document number: 278285

Country of ref document: IL

WWW Wipo information: withdrawn in national office

Ref document number: 769589

Country of ref document: NZ

WWG Wipo information: grant in national office

Ref document number: 17049021

Country of ref document: US