WO2019170898A1 - Pd1 binding agents - Google Patents

Pd1 binding agents Download PDF

Info

Publication number
WO2019170898A1
WO2019170898A1 PCT/EP2019/055927 EP2019055927W WO2019170898A1 WO 2019170898 A1 WO2019170898 A1 WO 2019170898A1 EP 2019055927 W EP2019055927 W EP 2019055927W WO 2019170898 A1 WO2019170898 A1 WO 2019170898A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
antibody
region
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2019/055927
Other languages
English (en)
French (fr)
Inventor
William James Jonathan Finlay
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Ultrahuman Nine Ltd
Original Assignee
Ultrahuman Nine Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CN201980017416.5A priority Critical patent/CN111819199A/zh
Priority to AU2019229676A priority patent/AU2019229676A1/en
Priority to SG11202008246VA priority patent/SG11202008246VA/en
Priority to CA3092174A priority patent/CA3092174A1/en
Priority to EP19710389.8A priority patent/EP3762419A1/en
Priority to JP2020542228A priority patent/JP2021515541A/ja
Application filed by Ultrahuman Nine Ltd filed Critical Ultrahuman Nine Ltd
Publication of WO2019170898A1 publication Critical patent/WO2019170898A1/en
Priority to US16/912,023 priority patent/US10858435B2/en
Priority to IL277135A priority patent/IL277135A/en
Anticipated expiration legal-status Critical
Priority to US16/952,678 priority patent/US20210101981A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/10Immunoglobulins specific features characterized by their source of isolation or production
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the invention relates to antibody molecules binding specifically to PD1 (also known as Programmed cell death 1 , PDCD1 , CD279, PD-1 , SLEB2, PD-I, SLE1 ) and medical uses thereof.
  • PD1 also known as Programmed cell death 1 , PDCD1 , CD279, PD-1 , SLEB2, PD-I, SLE1
  • PD1 also known as Programmed cell death 1 , PDCD1 , CD279, PD-1 , SLEB2, PD-I, SLE1
  • PD1 is a cell surface receptor that is a member of the immunoglobulin superfamily and is principally expressed on T cells, but has also been observed on pro-B cells.
  • PD1 binds two known ligands, PD-L1 and PD-L2.
  • the interaction of these ligands with PD1 on T cells down- regulates T cell inflammatory activity, which promotes immune self-tolerance.
  • PD1 is, therefore, described as being an immune‘checkpoint’. This checkpoint activity has been demonstrated to minimise autoimmunity risk by promoting apoptosis (programmed cell death) in lymph node-resident T cells that are reactive to self-antigens.
  • PD1 ligation also promotes the survival of regulatory (anti-inflammatory) T cells.
  • anti-PD1 antagonistic antibodies may also have therapeutic value in infectious disease settings.
  • antagonistic anti-PD1 mAbs have the potential to act as immunotherapeutic agents in cancer, immune and infectious disease settings, and to amplify the effectiveness of currently established therapies.
  • antibodies humanized via CDR grafting and back mutations have been shown to induce lower immune response rates in the clinic in comparison to those with fully murine v- domains
  • antibodies humanized using this basic grafting method still carry significant clinical development risks due to the potential physical instability and immunogenicity motifs still housed in the grafted CDR loops.
  • Antibodies such as PD1 inhibitors that target receptors on immune cells, and whose pharmacological function is to stimulate immune responses, are at heightened risk of provoking anti-drug antibody responses. These anti-drug antibody responses in the patient can reduce drug half-life, potency and safety during clinical use.
  • antibody engineering for therapeutic use focuses on minimizing predicted human T- cell epitope content, non-human germline amino acid content and aggregation potential in the purified protein.
  • the ideal humanized, agonistic anti-PD1 antibody would therefore have as many identical residues as possible in the v-domains to those found in both the frameworks and CDRs of well-characterized human germline sequences.
  • Townsend et al. (2015; PNAS 1 12: 15354- 15359) describe a method for generating antibodies in which CDRs derived from rat, rabbit and mouse antibodies were grafted into preferred human frameworks and then subjected to a human germ-lining approach termed “Augmented Binary Substitution”.
  • CDR germ-lining and development quality optimisation is thus a complex, multifactorial problem, as multiple functional properties of the molecule should preferably be maintained or improved, including in this instance: target binding specificity, PD1 /PD-L1 signalling antagonism, affinity to PD1 from both human and animal test species (e.g. cynomolgus monkey, also known as the crab-eating macaque, i.e. Macaca fascicularis) should be as similar as possible to facilitate highly accurate preclinical safety testing, v-domain biophysical stability and/or IgG expression yield should be optimal for manufacturing purposes.
  • Antibody engineering studies have shown that mutation of even single residue positions in key CDRs can have dramatic negative effects on all of these desired molecular properties.
  • WO2015/035606 A1 describes an antagonistic murine anti-PD1 IgG molecule termed “Mu317”, and also the preparation of humanized forms of Mu317 (designated hu317). Those humanized forms of Mu317 were produced using classical humanization
  • the present invention provides a number of anti-PD1 antibodies and medical uses thereof.
  • an antibody molecule which specifically binds to human PD1 , and optionally also to cynomolgus monkey PD1 , or an antigen-binding portion thereof, wherein the antibody molecule or antigen-binding portion comprises a heavy chain variable region with:
  • an HCDR1 having amino acids in sequence in the following order: G-F-T or a conservative substitution of T (for example S)-F or a conservative substitution of F (for example L)-S or a conservative substitution of S (for example T)-S-Y-G or any amino acid (for example W)-M or a conservative substitution of M (for example V)-S or any amino acid (for example H) (SEQ ID NO:20);
  • an HCDR2 having amino acids in sequence in the following order: V or a conservative substitution of V (for example L)-A or a conservative substitution of A (for example G)-V/N-l- W/K-Q/A-D/G-G-S-T/E-N/K/S-Y-N/V-D-S-V-K-G (SEQ ID NO:21 ); and
  • an HCDR3 having amino acids in sequence in the following order: A or any amino acid (for example D/E/G/H/l/K/L/H/Q/S/V/W)-Y or a conservative substitution of Y (for example F/W)- G-N or any amino acid (for example A/E/F/G/H/l/Q/R/S/T/V/W/Y)-Y or a conservative substitution of Y (for example V/W)-W or any amino acid (for example F/H/M/P/Q/S/V)-Y-l or any amino acid (for example L/M/S/T/V/Y)-D or a conservative substitution of D (for example E)-V or any amino acid (for example A/E/F/G/H/l/K/L/M/R/S/T/W/Y) (SEQ ID NO:22).
  • the HCDR1 of the antibody molecule or antigen-binding portion may exclude the sequences GFSLTSYGVH (SEQ ID NO:23; Mu317 murine/humanized antibody HCDR1 disclosed in WO2015/035606 A1 ; US2015/079109A1 ),
  • VIWAGGSTNYNSALMS SEQ ID NO:24; Mu317 murine/humanized antibody HCDR2 disclosed in WO2015/035606 A1 ; US2015/079109A1
  • the HCDR3 of the antibody molecule or antigen-binding portion may exclude the sequence AYGNYWYIDV (SEQ ID NO:25; Mu317 murine/humanized antibody HCDR3 disclosed in WO2015/035606 A1 ; US2015/079109A1 ).
  • the antibody molecule or antigen-binding portion may further comprise a light chain variable region with:
  • an LCDR1 having amino acids in sequence in the following order: K-S-S-Q/E-S-V-S or a conservative substitution of S (such as G/T)-N-D-L or a conservative substitution of L (such as V)-A (SEQ ID NO:26);
  • an LCDR2 having amino acids in sequence in the following order: Y-A-F or any amino acid (for example S)-H or any amino acid (for example P/T)-R-F-S or a conservative substitution of S (such as A/T) (SEQ ID NO:27); and
  • an LCDR3 having amino acids in sequence in the following order: Q or any amino acid (for example H)-Q-A or any amino acid (for example S)-Y-S-T or any amino acid (for example, N/S)-P-Y or any amino acid (for example W)-T (SEQ ID NO:28).
  • the LCDR1 of the antibody molecule or antigen-binding portion may exclude the sequence KASQSVSNDVA / KSSQEVSNDVA (SEQ ID NO:29 / SEQ ID NO:30; Mu317 murine/humanized antibody LCDR1 disclosed in WQ2015/035606 A1 ; US2015/079109A1 ), and/or the LCDR2 of the antibody molecule or antigen-binding portion may exclude the sequence YAFHRFT (SEQ ID NO:31 ; Mu317 murine/humanized antibody LCDR2 disclosed in WO2015/035606 A1 ; US2015/079109A1 ) and/or the LCDR3 of the antibody molecule or antigen-binding portion may exclude the sequence HQAYSSPYT (SEQ ID NO:32; Mu317 murine/humanized antibody LCDR3 disclosed in WO2015/035606 A1 ; US2015/079109A1 ).
  • an anti-PD1 antibody or an antigen-binding portion thereof wherein the antibody comprises a heavy chain variable (VH) region comprising HCDR1 , HCDR2, and HCDR3 and a light chain variable (VL) region comprising LCDR1 , LCDR2, and LCDR3, wherein
  • VH heavy chain variable
  • VL light chain variable
  • the HCDR1 comprises the amino acid sequence G-F-X1 -X2-X3-S-Y-X4-X5-X6, wherein X1 is T or a conservative substitution of T, X 2 is F or a conservative substitution of F, X 3 is S or a conservative substitution of S, X 4 is G or any other amino acid, X5 is M or a conservative substitution of M, and Xe is S or any other amino acid (SEQ ID NO:20);
  • the HCDR2 comprises the amino acid sequence X1 -X2-X3-I-X4-X5-X6-G-S-X7-X8- Y-Xg-D-S-V-K-G, wherein X1 is V or a conservative substitution of V, X 2 is A or a conservative substitution of A, X 3 is V or N, X 4 is W or K, X 5 is Q or A, X 6 is D or G, X7 is T or E, X 8 is N, K, or S, and X 9 is N or V (SEQ I D NO:21 );
  • the HCDR3 comprises the amino acid sequence X1 -X2-G-X3-X4-X5-Y-X6-X7-X8, wherein X1 is A or any other amino acid, X2 is Y or a conservative substitution of Y, X 3 is N or any other amino acid, X 4 is Y or a conservative substitution of Y, X5 is W or any other amino acid, Xe is I or any other amino acid, X7 is D or a conservative substitution of D, and Xs is V or any other amino acid (SEQ ID NO:22);
  • the LCDR1 comprises the amino acid sequence K-S-S-X1-S-V-X 2 -N-D-X 3 -A, wherein X1 is Q or E, X 2 is S or a conservative substitution of S, and X 3 is L or a conservative substitution of L(SEQ ID NO:26) ;
  • the LCDR2 comprises the amino acid sequence Y-A-X1-X 2 -R-F-X 3 , wherein X1 is F or any other amino acid, X 2 is H or any other amino acid, and X 3 is S or a conservative substitution of S (SEQ ID NO:27) ; and
  • the LCDR3 comprises the amino acid sequence X1-Q-X 2 -Y-S-X 3 -P-X4-T, wherein Xi is Q or any other amino acid, X 2 is A or any other amino acid, X 3 is T or any other amino acid, and X 4 is Y or any other amino acid (SEQ ID NO:28).
  • the invention provides an anti-PD1 antibody or an antigen-binding portion thereof, wherein the antibody comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein (a) the VH region amino acid sequence comprises HCDR1 of GFTFSSYGMS (SEQ ID NO:33), HCDR2 of VAN I WQDGSTKYVDS VKG (SEQ ID NO:34), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVTNDVA (SEQ ID NO:36), LCDR2 of YAYHRFT (SEQ ID NO:37), and LCDR3 of HQAYSSPYT (SEQ ID NO:38);
  • the VH region amino acid sequence comprises HCDR1 of GFSLSSYGMS (SEQ ID NO:39), HCDR2 of VAVIWQDGSTNYVDSVKG (SEQ ID NO:40), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVTNDVA (SEQ ID NO:36), LCDR2 of YAYHRFT (SEQ ID NO:37), and LCDR3 of HQAYSSPYT (SEQ ID NO:38);
  • the VH region amino acid sequence comprises HCDR1 of GFTFSSYGMS (SEQ ID NO:33), HCDR2 of VANIWQDGSEKYVDSVKG (SEQ ID NO:41 ), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVTNDVA (SEQ ID NO:36), LCDR2 of YAYHRFT (SEQ ID NO:37), and LCDR3 of HQAYSSPYT (SEQ ID NO:38);
  • the VH region amino acid sequence comprises HCDR1 of GFSFSSYGMH (SEQ ID NO:42), HCDR2 of VANIWQDGSTNYVDSVKG (SEQ ID NO:43), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46);
  • the VH region amino acid sequence comprises HCDR1 of GFSFTSYGMS (SEQ ID NO:47), HCDR2 of LAN I WQDGSTN YVDS VKG (SEQ ID NO:48), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46);
  • the VH region amino acid sequence comprises HCDR1 of GFTFSSYGVH (SEQ ID NO:49), HCDR2 of VGVIWQDGSENYVDSVKG (SEQ ID NO:50), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDLA (SEQ ID NO:51 ), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of QQAYSTPYT (SEQ ID NO:52);
  • the VH region amino acid sequence comprises HCDR1 of GFSFSSYGMH (SEQ ID NO:42), HCDR2 of VANIWQDGSTNYVDSVKG (SEQ ID NO:43), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46);
  • the VH region amino acid sequence comprises HCDR1 of GFSFSSYGMH (SEQ ID NO:42), HCDR2 of LANIWQDGSENYVDSVKG (SEQ ID NO:53), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of QQAYSTPYT (SEQ ID NO:52);
  • the VH region amino acid sequence comprises HCDR1 of GFTLSSYGMH (SEQ ID NO: 54), HCDR2 of LAVIWADGSTNYVDSVKG (SEQ ID NO:55), and HCDR3 of AYGNYMYIDV (SEQ ID NO:56); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46);
  • the VH region amino acid sequence comprises HCDR1 of GFTFSSYGMH (SEQ ID NO:57), HCDR2 of VGVIKQDGSENYVDSVKG (SEQ ID NO:58), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46); or
  • the VH region amino acid sequence comprises HCDR1 of GFSFTSYGMH (SEQ ID NO:59), HCDR2 of VGVIWQDGSTNYVDSVKG (SEQ ID NO:60), and HCDR3 of GYGNYWYIDV (SEQ ID NO:61 ); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDLA (SEQ ID NO:51 ), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of QQAYSTPYT (SEQ ID NO:52).
  • an anti-PD1 antibody or an antigen-binding portion thereof wherein the antibody comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein
  • VH region amino acid sequence comprises:
  • VL region amino acid sequence comprises:
  • the invention provides an anti-PD1 antibody or an antigen-binding portion thereof, wherein the antibody comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein (a) the VH region amino acid sequence comprises SEQ ID NO:1 and the VL region amino acid sequence comprises SEQ ID NO:2;
  • VH region amino acid sequence comprises SEQ ID NO:3 and the VL region amino acid sequence comprises SEQ ID NO:4;
  • VH region amino acid sequence comprises SEQ ID NO:5 and the VL region amino acid sequence comprises SEQ ID NO:6;
  • VH region amino acid sequence comprises SEQ ID NO:7 and the VL region amino acid sequence comprises SEQ ID NO:8.
  • an immunoconjugate comprising the antibody molecule or antigen-binding portion thereof as defined herein linked, fused or conjugated to a therapeutic agent.
  • the invention provides a nucleic acid molecule encoding the antibody molecule or antigen-binding portion thereof as defined herein.
  • Also provided is a host cell comprising the nucleic acid molecule or the vector of the invention as defined herein.
  • a method of producing an anti-PD1 antibody and/or an antigen-binding portion thereof comprising culturing the host cell of the invention under conditions that result in expression and/or production of the antibody and/or the antigen binding portion thereof, and isolating the antibody and/or the antigen-binding portion thereof from the host cell or culture.
  • composition comprising the antibody molecule or antigen-binding portion thereof of the invention as defined herein, or the nucleic acid molecule of the invention as defined herein, or the vector of the invention as defined herein.
  • a method for enhancing an immune response in a subject comprising administering an effective amount of the antibody molecule or antigen-binding portion thereof of the invention as defined herein, or the immunoconjugate of the invention as defined herein, or the nucleic acid molecule of the invention as defined herein, or the vector of the invention as defined herein, or the pharmaceutical composition of the invention as defined herein.
  • a method for treating or preventing cancer in a subject comprising administering an effective amount of the antibody molecule or antigen-binding portion thereof of the invention as defined herein, or the immunoconjugate of the invention as defined herein, or the nucleic acid molecule of the invention as defined herein, or the vector of the invention as defined herein, or the pharmaceutical composition of the invention as defined herein.
  • the invention also provides an antibody molecule or antigen binding portion thereof of the invention as defined herein, or the immunoconjugate of the invention as defined herein, or the nucleic acid molecule of the invention as defined herein, or the vector of the invention as defined herein, or the pharmaceutical composition of the invention as defined herein, for use in the treatment of cancer.
  • the invention also provides a method for treating or preventing an infectious disease in a subject, comprising administering an effective amount of the antibody molecule or antigen binding portion thereof as defined herein, or the immunoconjugate as defined here, or the nucleic acid molecule as defined herein, or the vector as defined herein, or the pharmaceutical composition as defined herein.
  • the infectious disease may be selected in all aspects from the group consisting of: viral, bacterial, fungal or parasitic.
  • the infectious disease is human immunodeficiency virus (HIV) infection.
  • the invention also provides a method for treating or preventing an infectious disease in a subject, comprising administering an effective amount of the antibody molecule or antigen binding portion thereof as defined herein, or the immunoconjugate as defined here, or the nucleic acid molecule as defined herein, or the vector as defined herein, or the pharmaceutical composition as defined herein.
  • the invention also provides a method of producing an antibody molecule which specifically binds to human PD1 and optionally also to cynomolgus monkey PD1 , or an antigen-binding portion thereof, comprising the steps of:
  • step (4) producing an antibody molecule which specifically binds to human PD1 and optionally also to cynomolgus monkey PD1 , or an antigen-binding portion thereof from clones selected from step (4).
  • the method may comprise a further step of producing additional clones based on the clones selected in step (4), for example based on further exploratory mutagenesis at specific positions in the CDRs of the clones selected in step (4), to enhance humanization and/or minimise human T cell epitope content and/or improve manufacturing properties in the antibody molecule or antigen-binding portion thereof produced in step (5).
  • FIG. 1A - FIG. 1 B Direct binding ELISA of library-derived anti-PD1 Fabs against human and cyno PD1-Fc proteins and HTRF competition assay.
  • Clones were derived from multiple phage selection branches where phage populations were selected on biotinylated human, or cynomolgus monkey PD1 proteins in each round. Standard selections are numbered RI-RIV.
  • library-derived clones were screened as periplasmically-expressed Fab proteins in ELISA (FIG. 1 A) against both human (huPD1 ) and cyno (cyPD1 ).
  • Fab samples were also tested in parallel for their ability to compete for the binding epitope of mu317 on human PD1 by HTRF (FIG. 1 B).
  • Mean ⁇ SD values in each round are represented in grey bars.
  • FIG. 2A - FIG. 2B Analysis of CDR residue tolerance for mutation to germline.
  • a plot of murine amino acid retention frequencies in the CDRs of the ELISA-positive population of 712 unique scFv clones is shown for VL (SEQ ID NOs: 409-41 1 ) (FIG. 2A) and VH (SEQ ID NOs: 412-414)(FIG. 2B) domains, respectively. Only those residues targeted for human/murine residue mutagenesis are plotted, other than in the HCDR3. CDR residues noted in parentheses on the X-axes were identical to those found in the human germlines used for grafting (IGKV4-1 and IGHV3-7). In both plots the dashed line in grey at 75% represents the cut-off for tolerance of murine residue replacement by human germline.
  • FIG. 3A - FIG. 3B Direct titration ELISA for library-derived lgG1 null clones binding to human and cyno PD1-Fc proteins.
  • Mu317 and library-derived IgGs were titrated (in nM) in a direct binding ELISA against human (FIG. 3A) and cyno (FIG. 3B) PD1 -Fc proteins.
  • FIG. 4A - FIG. 4B Flow cytometric binding to human and cyno PD1 + CHO cells.
  • Mu317, lead library-derived and designer IgGs were examined for specific binding on human (FIG. 4A) and cyno (FIG. 4B) CHO cells expressing human PD1 .
  • Concentration-dependent binding was observed against human PD1 for all clones, with no binding being observed for Isotype control lgG1 . No binding signal was observed for any clone against untransfected CHO cells.
  • FIG. 5 Cell-based PD1/PD-L1 antagonism assay. Analyses of antagonism of human PD1 function at the cell surface, for multiple lead clones in human lgG1 null format, showed that all novel clones exhibited strong, concentration-dependent, antagonistic activity.
  • FIG. 6A - FIG 6C Cell-based PD1/PD-L1 antagonism assay for maximally humanized lead clones MH4, MH8 AND MH12 versus mu317 and hu317.
  • FIG. 7A - FIG. 7H T cell epitope peptide content in lead antibody v-domains.
  • the v- domains of Hu317 and multiple lead antibodies were examined for the presence of Germline (GE), High Affinity Foreign (HAF), Low Affinity Foreign (LAF) and TCED+ T cell receptor epitopes.
  • GE Germline
  • HAF High Affinity Foreign
  • LAF Low Affinity Foreign
  • TCED+ T cell receptor epitopes Both the VH and VL domains of Hu317 were found to contain multiple high-risk human T cell epitopes and few germline epitopes. In all lead clones, the high-risk epitope content was significantly reduced and germline epitope content significantly improved.
  • FIG. 8A- FIG. 8C MLR cell-based PD1/PD-L1 antagonism assay. Effect of anti-PD1 IgGs on IFN-g Production in an Allogeneic MLR assay. Control analyses (FIG. 8A), 3-point analyses for lead clones 09C06, MH4, MH8, MH12 (FIG. 8B), and multi-point analyses for clones MH4, MH8 and Hu317 (FIG. 8C) are shown. In each case, Isotype controls were used (human lgG4, or lgG1 ).
  • FIG. 9 Charge variant profiles of purified IgGs. (1 ) 09C06, (2) MH4, (3) MH8, (4) MH12 and (5) Hu317 are shown. Y axis signals measured in Fluorescence Units.
  • FIG. 10 DSC Thermograms of purified IgGs. (1 ) 09C06, (2) MH4, (3) MH8, (4) MH12 and (5) Hu317 are shown.
  • FIG. 11 Flow cytometric binding of Hu317, lead and control IgGs to HEK293 cells transfected with PD1 or potential off-target binding proteins. Analyses of binding specificity were performed on HEK293 cells transiently transfected with plasmids encoding either human PD1 , human BTN2A1 , human LSAMP, human CD20 or ZS green marker only. Each antibody was used in staining at 2 pg/ml concentration and histograms are indicated per antibody in this figure.
  • an antibody molecule which specifically binds to human PD1 and also to cynomolgus monkey PD1 , or an antigen-binding portion thereof, wherein the antibody molecule or antigen-binding portion comprises a heavy chain variable region with:
  • an HCDR1 having amino acids in sequence in the following order: G-F-T or a conservative substitution of T (for example S)-F or a conservative substitution of F (for example L)-S or a conservative substitution of S (for example T)-S-Y-G or any amino acid (for example W)-M or a conservative substitution of M (for example V)-S or any amino acid (for example H) (SEQ ID NO:20);
  • an HCDR2 having amino acids in sequence in the following order: V or a conservative substitution of V (for example L)-A or a conservative substitution of A (for example G)-V/N-l- W/K-Q/A-D/G-G-S-T/E-N/K/S-Y-N/V-D-S-V-K-G (SEQ ID NO:21 ); and
  • an HCDR3 having amino acids in sequence in the following order: A or any amino acid (for example D/E/G/H/l/K/L/H/Q/S/V/W)-Y or a conservative substitution of Y (for example F/W)- G-N or any amino acid (for example A/E/F/G/H/l/Q/R/S/T/V/W/Y)-Y or a conservative substitution of Y (for example V/W)-W or any amino acid (for example F/H/M/P/Q/S/V)-Y-l or any amino acid (for example L/M/S/T/V/Y)-D or a conservative substitution of D (for example E)-V or any amino acid (for example A/E/F/G/H/l/K/L/M/R/S/T/W/Y) (SEQ ID NO:22).
  • an anti-PD1 antibody or antigen-binding portion provided herein specifically binds to a PD1 protein comprising or consisting of SEQ ID NO:16 or SEQ ID NO:17.
  • an anti-PD1 antibody or antigen-binding portion provided herein specifically binds to a PD1 protein having an amino acid sequence that is at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% identical to SEQ ID NO:16 or SEQ ID NO:17.
  • the HCDR1 of the antibody molecule or antigen-binding portion may exclude the sequences GFSLTSYGVH (SEQ ID NO:23; Mu317 murine/humanized antibody HCDR1 disclosed in WO2015/035606 A1 ; US2015/079109A1 ),
  • VIWAGGSTNYNSALMS SEQ ID NO:24; Mu317 murine/humanized antibody HCDR2 disclosed in WO2015/035606 A1 ; US2015/079109A1
  • the HCDR3 of the antibody molecule or antigen-binding portion may exclude the sequence AYGNYWYIDV (SEQ ID NO:25; Mu317 murine/humanized antibody HCDR3 disclosed in WO2015/035606 A1 ; US2015/079109A1 ).
  • the antibody molecule or antigen-binding portion thereof according to the invention may further comprise a light chain variable region with:
  • an LCDR1 having amino acids in sequence in the following order: K-S-S-Q/E-S-V-S or a conservative substitution of S (such as G/T)-N-D-L or a conservative substitution of L (such as V)-A (SEQ ID NO:26);
  • an LCDR2 having amino acids in sequence in the following order: Y-A-F or any amino acid (for example S/Y)-H or any amino acid (for example P/T)-R-F-S or a conservative substitution of S (such as A/T) (SEQ ID NO:27); and an LCDR3 having amino acids in sequence in the following order: Q or any amino acid (for example H)-Q-A or any amino acid (for example S)-Y-S-T or any amino acid (for example, N/S)-P-Y or any amino acid (for example W)-T (SEQ ID NO:28).
  • the LCDR1 of the antibody molecule or antigen-binding portion may exclude the sequence KASQSVSNDVA / KSSQEVSNDVA (SEQ ID NO:29 / SEQ ID NO:30; Mu317 murine/humanized antibody LCDR1 disclosed in WO2015/035606 A1 ; US2015/079109A1 ), and/or the LCDR2 of the antibody molecule or antigen-binding portion may exclude the sequence YAFHRFT (SEQ ID NO:31 ; Mu317 murine/humanized antibody LCDR2 disclosed in WO2015/035606 A1 ; US2015/079109A1 ) and/or the LCDR3 of the antibody molecule or antigen-binding portion may exclude the sequence HQAYSSPYT (SEQ ID NO:32; Mu317 murine/humanized antibody LCDR3 disclosed in WO2015/035606 A1 ; US2015/079109A1 ).
  • an anti-PD1 antibody or an antigen-binding portion thereof wherein the antibody comprises a heavy chain variable (VH) region comprising HCDR1 , HCDR2, and HCDR3 and a light chain variable (VL) region comprising LCDR1 , LCDR2, and LCDR3, wherein
  • VH heavy chain variable
  • VL light chain variable
  • the HCDR1 comprises the amino acid sequence G-F-X1 -X2-X3-S-Y-X4-X5-X6, wherein X 1 is T or a conservative substitution of T (for example, S), X 2 is F or a conservative substitution of F (for example, L), X 3 is S or a conservative substitution of S (for example, T), X 4 is G or any other amino acid (for example, W), X 5 is M or a conservative substitution of M (for example, V), and Xe is S or any other amino acid (for example, H) (SEQ ID NO:20);
  • the HCDR2 comprises the amino acid sequence X1 -X2-X3-I-X4-X5-X6-G-S-X7-X8- Y-Xg-D-S-V-K-G, wherein X1 is V or a conservative substitution of V (for example, L), X2 is A or a conservative substitution of A (for example, G), X 3 is V or N, X4 is W or K, X 5 is Q or A, Xe is D or G, X7 is T or E, X 8 is N, K, or S, and Xg is N or V (SEQ I D NO:21 );
  • the HCDR3 comprises the amino acid sequence X1 -X2-G-X3-X4-X5-Y-X6-X7-X8, wherein X 1 is A or any other amino acid (for example, D, E, G, H, I, K, L, H, Q, S, V, or W), X2 is Y or a conservative substitution of Y (for example, F or W), X 3 is N or any other amino acid (for example, A, E, F, G, H, I, Q, R, S, T, V, W, or Y), X 4 is Y or a conservative substitution of Y (for example, V or W), X 5 is W or any other amino acid (for example, F, H, M, P, Q, S, or V), X 6 is I or any other amino acid (for example, L, M, S, T, V, or Y), X 7 is D or a conservative substitution of D (for example, E), and Xs is V or any other amino acid (
  • the LCDR2 comprises the amino acid sequence Y-A-XI -X 2 -R-F-X 3 , wherein Xi is F or any other amino acid (for example, S), X 2 is H or any other amino acid (for example, P or T), and X 3 is S or a conservative substitution of S (for example, A or T) (SEQ ID NO:27); and
  • the LCDR3 comprises the amino acid sequence XI -Q-X 2 -Y-S-X 3 -P-X 4 -T, wherein Xi is Q or any other amino acid (for example, H), X 2 is A or any other amino acid (for example, S), X 3 is T or any other amino acid (for example, N or S), and X 4 is Y or any other amino acid (for example, W) (SEQ ID NO:28).
  • an anti-PD1 antibody or an antigen-binding portion thereof wherein the antibody comprises a heavy chain variable (VH) region comprising, in amino-terminal to carboxyl-terminal order, FR1 -HCDR1 -FR2-HCDR2-FR3-HCDR3-FR4 and a light chain variable (VL) region comprising, in amino-terminal to carboxyl-terminal order, FR1 -LCDR1 -FR2-LCDR2-FR3-LCDR3-FR4, wherein the HCDR1 is SEQ ID NO:20, the HCDR2 is SEQ ID NO:32, the HCDR3 is SEQ ID NO:33, the LCDR1 is SEQ ID NO:26, the LCDR2 is SEQ ID NO:27 and the LCDR3 is SEQ ID NO:28, wherein the heavy chain FR1 , FR2, FR3 and FR4 amino acid sequences are the heavy chain FR1 , FR2, FR3 and FR4 amino acid sequence
  • the present inventors have succeeded for the first time in generating a number of optimized anti-PD1 antibody molecules using CDR sequences derived from the murine anti-PD1 antibody Mu317 disclosed in WO2015/035606 A1 ; US2015/079109A1 .
  • Refining of the optimized antibody molecules as described herein has provided improved variable domain stability, high expression yields, and/or reduced immunogenicity potential without compromising binding specificity to both human PD1 as well as cynomolgus monkey PD1 (to facilitate maximally accurate primate toxicology and pk studies) and pharmacological potency in PD1 antagonism assays.
  • optimized anti-PD1 antibody molecules of the present invention do not necessarily have the maximum number of human germline substitutions at corresponding murine CDR or other (such as framework) amino acid positions.
  • “maximally humanized” antibody molecules are not necessary“maximally optimized” in terms of anti-PD1 binding characteristics and/or other desirable features.
  • the present invention encompasses modifications to the amino acid sequence of the antibody molecule or antigen-binding portion thereof as defined herein.
  • the invention includes antibody molecules and corresponding antigen-binding portions thereof comprising functionally equivalent variable regions and CDRs which do not significantly affect their properties as well as variants which have enhanced or decreased activity and/or affinity.
  • the amino acid sequence may be mutated to obtain an antibody with the desired binding affinity to PD1 . Insertions which include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues, are envisaged.
  • terminal insertions include an antibody molecule with an N-terminal methionyl residue or the antibody molecule fused to an epitope tag.
  • Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody of an enzyme or a polypeptide which increases the half-life of the antibody in the blood circulation.
  • the antibody molecule or antigen-binding portion of the invention may include glycosylated and nonglycosylated polypeptides, as well as polypeptides with other post-translational modifications, such as, for example, glycosylation with different sugars, acetylation, and phosphorylation.
  • the antibody molecule or antigen-binding portion of the invention may be mutated to alter such post-translational modifications, for example by adding, removing or replacing one or more amino acid residues to form or remove a glycosylation site.
  • the antibody molecule or antigen-binding portion of the invention may be modified for example by amino acid substitution to remove potential proteolytic sites in the antibody.
  • the FICDR1 may have the amino acid sequence: G-F-T-F-S-S-Y-G-M/V-S/H (SEQ ID NO:62);
  • the HCDR2 may have the amino acid sequence: V-A-V/N-l-W/K-Q-D-G-S-E/T-N/K-Y-V/N-D-S-V-K-G (SEQ ID NO:63);
  • the HCDR3 may have the amino acid sequence: A/D/E/G/H/l/K/L/H/Q/S/V/W-Y/F/W-G- N/A/E/F/G/H/l/Q/R/S/T/V/W/Y-Y/V/W-W/F/H/M/P/Q/S/V-Y-l/L/M/S/T/V/Y-D/E- V/A/E/F/G/H/l/Q/
  • the HCDR1 may have the amino acid sequence: G-F-T-F-S-S-Y-G-M-S/H (SEQ ID NO:65); the HCDR2 may have the amino acid sequence: V-A-V/N-l-W-Q-D-G-S- E/T-N/K-Y-V-D-S-V-K-G (SEQ ID NO:66); and the HCDR3 may have the amino acid sequence: A/G-Y-G-N-Y-W/M-Y-l-D-R/V (SEQ ID NO:67).
  • the LCDR1 may have the amino acid sequence: K-S-S-Q/E-S-V-S/G/T-N-D-L/V-A (SEQ ID NO:68); the LCDR2 may have the amino acid sequence Y-A-F/S/Y-H/P/T-R-F-S/T (SEQ ID NO:69); and the LCDR3 may have the amino acid sequence: Q/H-Q-A/S-Y-S-T/N/S-P-Y-T (SEQ ID NO:70).
  • the LCDR1 may have the amino acid sequence: K-S-S-Q-S-V-S/G/T-N-D-L/V- A (SEQ ID NO:71 ); the LCDR2 may have the amino acid sequence Y-A-S/Y-H-R-F-S/T (SEQ ID NO:72); and the LCDR3 may have the amino acid sequence: Q/H-Q-A-Y-S-T/S-P-Y-T (SEQ ID NO:73).
  • the antibody molecule or antigen-binding portion may comprise:
  • GFSFTSYGMS (SEQ ID NO:47; HCDR1 ), LAN I WQDGSTN YVDS VKG (SEQ ID NO:48; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVSNDVA (SEQ ID NO:44; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and HQAYSTPYT (SEQ ID NO:46; LCDR3) [Clone 20C07]; or
  • GFTFSSYGVH (SEQ ID NO:49; HCDR1 ), VGVIWQDGSENYVDSVKG (SEQ ID NO:50; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVSNDLA (SEQ ID NO:51 ; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and QQAYSTPYT (SEQ ID NO:52; LCDR3) [Clone 1 1 C08];
  • GFSFSSYGMH (SEQ ID NO:42; HCDR1 ), VAN I WQDGSTN YVDS VKG (SEQ ID NO:43; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVSNDVA (SEQ ID NO:44; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and HQAYSTPYT (SEQ ID NO:46; LCDR3) [Clone 09C06];
  • GFSFSSYGMH (SEQ ID NO:42; HCDR1 ), LANIWQDGSENYVDSVKG (SEQ ID NO:53; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVSNDVA (SEQ ID NO:44; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and QQAYSTPYT (SEQ ID NO:52; LCDR3) [Clone 17A12];
  • GFTFSSYGMH (SEQ ID NO:57; HCDR1 ), VGVIKQDGSENYVDSVKG (SEQ ID NO:58; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVSNDVA (SEQ ID NO:44; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and HQAYSTPYT (SEQ ID NO:46; LCDR3) [Clone 17G08];
  • GFSFTSYGMH (SEQ ID NO:59; HCDR1 ), VGVIWQDGSTNYVDSVKG (SEQ ID NO:60; HCDR2), GYGNYWYIDV (SEQ ID NO:61 ; HCDR3), KSSQSVSNDLA (SEQ ID NO:51 ; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and QQAYSTPYT (SEQ ID NO:52; LCDR3) [Clone 15D07];
  • GFSLSSYGMS (SEQ ID NO:39; HCDR1 ), VAVIWQDGSTNYVDSVKG (SEQ ID NO:40; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVGNDVA (SEQ ID NO:74; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and QQAYSSPYT (SEQ ID NO:75; LCDR3) [Clone MH1 ];
  • GFSLSSYGMS (SEQ ID NO:39; HCDR1 ), VAVIWQDGSTNYVDSVKG (SEQ ID NO:40; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDLA (SEQ ID NO:76; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and QQAYSSPYT (SEQ ID NO:75; LCDR3) [Clone MH2];
  • GFSLSSYGMS (SEQ ID NO:39; HCDR1 ), VAVIWQDGSTNYVDSVKG (SEQ ID NO:40; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVGNDLA (SEQ ID NO:77; LCDR1 ), YAYHRFS (SEQ ID NO:78; LCDR2) and QQAYSSPYT (SEQ ID NO:75; LCDR3) [Clone MH3];
  • GFSLSSYGMS (SEQ ID NO:39; HCDR1 ), VAVIWQDGSTNYVDSVKG (SEQ ID NO:40; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDVA (SEQ ID NO:36; LCDR1 ), YAYHRFT (SEQ ID NO:37; LCDR2) and HQAYSSPYT (SEQ ID NO:38; LCDR3) [Clone MH4];
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VAN I WQDGSTKYVDS VKG (SEQ ID NO:34; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVGNDVA (SEQ ID NO:74; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and QQAYSSPYT (SEQ ID NO:75; LCDR3) [Clone MH5];
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VAN I WQDGSTKYVDS VKG (SEQ ID NO:34; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDLA (SEQ ID NO:76; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and QQAYSSPYT (SEQ ID NO:75; LCDR3) [Clone MH6];
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VAN I WQDGSTKYVDS VKG (SEQ ID NO:34; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVGNDLA (SEQ ID NO:77; LCDR1 ), YAYHRFS (SEQ ID NO:78; LCDR2) and QQAYSSPYT (SEQ ID NO:75; LCDR3) [Clone MH7];
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VAN I WQDGSTKYVDS VKG (SEQ ID NO:34; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDVA (SEQ ID NO:36; LCDR1 ), YAYHRFT (SEQ ID NO:37; LCDR2) and HQAYSSPYT (SEQ ID NO:38; LCDR3) [Clone MH8];
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VANIWQDGSEKYVDSVKG (SEQ ID NO:41 ; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVGNDVA (SEQ ID NO:74; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and QQAYSSPYT (SEQ ID NO:75; LCDR3) [Clone MH9];
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VANIWQDGSEKYVDSVKG (SEQ ID NO:41 ; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDLA (SEQ ID NO:76; LCDR1 ), YASHRFT (SEQ ID NO:45; LCDR2) and QQAYSSPYT (SEQ ID NO:75; LCDR3) [Clone MH10];
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VANIWQDGSEKYVDSVKG (SEQ ID NO:41 ; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVGNDLA (SEQ ID NO:77; LCDR1 ), YAYHRFS (SEQ ID NO:78; LCDR2) and QQAYSSPYT (SEQ ID NO:75; LCDR3) [Clone MH1 1 ];
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VANIWQDGSEKYVDSVKG (SEQ ID NO:41 ; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDVA (SEQ ID NO:36; LCDR1 ), YAYHRFT (SEQ ID NO:37; LCDR2) and HQAYSSPYT (SEQ ID NO:38; LCDR3) [Clone M H 12] ; (t) the amino acid sequences
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VAN I WQDGSTKYVDS VKG (SEQ ID NO:34; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDLA (SEQ ID NO:76; LCDR1 ), YAYHRFT (SEQ ID NO:37; LCDR2) and HQAYSSPYT (SEQ ID NO:38; LCDR3) [Clone MH13];
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VAN I WQDGSTKYVDS VKG (SEQ ID NO:34; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDLA (SEQ ID NO:76; LCDR1 ), YAYHRFS (SEQ ID NO:78; LCDR2) and HQAYSSPYT (SEQ ID NO:38; LCDR3) [Clone MH 14] ;
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VAN I WQDGSTKYVDS VKG (SEQ ID NO:34; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDLA (SEQ ID NO:76; LCDR1 ), YASHRFS (SEQ ID NO:79; LCDR2) and HQAYSSPYT (SEQ ID NO:38; LCDR3) [Clone MH15];
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VANIWQDGSEKYVDSVKG (SEQ ID NO:41 ; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDLA (SEQ ID NO:76; LCDR1 ), YAYHRFT (SEQ ID NO:37; LCDR2) and HQAYSSPYT (SEQ ID NO:38; LCDR3) [Clone M H 16] ;
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VANIWQDGSEKYVDSVKG (SEQ ID NO:41 ; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDLA (SEQ ID NO:76; LCDR1 ), YAYHRFS (SEQ ID NO:78; LCDR2) and HQAYSSPYT (SEQ ID NO:38; LCDR3) [Clone MH 17] ;
  • GFTFSSYGMS (SEQ ID NO:33; HCDR1 ), VANIWQDGSEKYVDSVKG (SEQ ID NO:41 ; HCDR2), AYGNYWYIDR (SEQ ID NO:35; HCDR3), KSSQSVTNDLA (SEQ ID NO:76; LCDR1 ), YASHRFS (SEQ ID NO:79; LCDR2) and HQAYSSPYT (SEQ ID NO:38; LCDR3) [Clone MH18];
  • the invention provides an anti-PD1 antibody or an antigen-binding portion thereof, wherein the antibody comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein
  • VH heavy chain variable
  • VL light chain variable
  • VH region amino acid sequence comprises HCDR1 of GFTFSSYGMS (SEQ ID NO: 1
  • VL region amino acid sequence comprises LCDR1 of KSSQSVTNDVA (SEQ ID NO:36), LCDR2 of YAYHRFT (SEQ ID NO:37), and LCDR3 of HQAYSSPYT (SEQ ID NO:38);
  • the VH region amino acid sequence comprises HCDR1 of GFSLSSYGMS (SEQ ID NO:39), HCDR2 of VAVIWQDGSTNYVDSVKG (SEQ ID NO:40), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVTNDVA (SEQ ID NO:36), LCDR2 of YAYHRFT (SEQ ID NO:37), and LCDR3 of HQAYSSPYT (SEQ ID NO:38);
  • the VH region amino acid sequence comprises HCDR1 of GFTFSSYGMS (SEQ ID NO:33), HCDR2 of VANIWQDGSEKYVDSVKG (SEQ ID NO:41 ), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVTNDVA (SEQ ID NO:36), LCDR2 of YAYHRFT (SEQ ID NO:37), and LCDR3 of HQAYSSPYT (SEQ ID NO:38);
  • the VH region amino acid sequence comprises HCDR1 of GFSFSSYGMH (SEQ ID NO:42), HCDR2 of VANIWQDGSTNYVDSVKG (SEQ ID NO:43), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46);
  • the VH region amino acid sequence comprises HCDR1 of GFSFTSYGMS (SEQ ID NO:47), HCDR2 of LAN I WQDGSTN YVDS VKG (SEQ ID NO:48), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46);
  • the VH region amino acid sequence comprises HCDR1 of GFTFSSYGVH (SEQ ID NO:49), HCDR2 of VGVIWQDGSENYVDSVKG (SEQ ID NO:50), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDLA (SEQ ID NO:51 ), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of QQAYSTPYT (SEQ ID NO:52);
  • the VH region amino acid sequence comprises HCDR1 of GFSFSSYGMH (SEQ ID NO:42), HCDR2 of VANIWQDGSTNYVDSVKG (SEQ ID NO:43), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46);
  • the VH region amino acid sequence comprises HCDR1 of GFSFSSYGMH (SEQ ID NO:42), HCDR2 of LANIWQDGSENYVDSVKG (SEQ ID NO:53), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of QQAYSTPYT (SEQ ID NO:52); (i) the VH region amino acid sequence comprises HCDR1 of GFTLSSYGMH (SEQ ID NO:54), HCDR2 of LAVIWADGSTNYVDSVKG (SEQ ID NO:55), and HCDR3 of AYGNYMYIDV (SEQ ID NO:56); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT
  • the VH region amino acid sequence comprises HCDR1 of GFTFSSYGMH (SEQ ID NO:57), HCDR2 of VGVIKQDGSENYVDSVKG (SEQ ID NO:58), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46); or
  • the VH region amino acid sequence comprises HCDR1 of GFSFTSYGMH (SEQ ID NO:59), HCDR2 of VGVIWQDGSTNYVDSVKG (SEQ ID NO:60), and HCDR3 of GYGNYWYIDV (SEQ ID NO:61 ); and the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDLA (SEQ ID NO:51 ), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of QQAYSTPYT (SEQ ID NO:52).
  • anti-PD1 antibody or an antigen-binding portion thereof wherein the antibody comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein the VH region comprises any one of the VH region amino acid sequences in Table 9 and the VL region comprises any one of the VL region amino acid sequences in Table 9.
  • VH heavy chain variable
  • VL light chain variable
  • the invention provides an anti-PD1 antibody or an antigen-binding portion thereof, wherein the antibody comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein
  • VH heavy chain variable
  • VL light chain variable
  • VH region amino acid sequence comprises SEQ ID NO:1 and the VL region amino acid sequence comprises SEQ ID NO:2;
  • VH region amino acid sequence comprises SEQ ID NO:3 and the VL region amino acid sequence comprises SEQ ID NO:4;
  • VH region amino acid sequence comprises SEQ ID NO:5 and the VL region amino acid sequence comprises SEQ ID NO:6;
  • VH region amino acid sequence comprises SEQ ID NO:7 and the VL region amino acid sequence comprises SEQ ID NO:8.
  • an anti-PD1 antibody or an antigen-binding portion thereof wherein the antibody comprises a heavy chain variable (VH) region and a light chain variable (VL) region, wherein (a) the VH region amino acid sequence is at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% identical to SEQ ID NO:1 and the VL region amino acid sequence is at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% identical to SEQ ID NO:2;
  • the VH region amino acid sequence is at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% identical to SEQ ID NO:3 and the VL region amino acid sequence is at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% identical to SEQ ID NO:4;
  • the VH region amino acid sequence is at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% identical to SEQ ID NO:5 and the VL region amino acid sequence is at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% identical to SEQ ID NO:6; or
  • the VH region amino acid sequence is at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% identical to SEQ ID NO:7 and the VL region amino acid sequence is at least about 90%, at least about 91 %, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 98% or at least about 99% identical to SEQ ID NO:8.
  • the CDR amino acid sequences of an anti-PD1 antibody are 100% identical to the CDR amino acid sequences in the recited sequences while the FR amino acid sequences are less than 100% identical to the FR amino acid sequences in the recited sequences.
  • the antibody molecule or antigen-binding portion as defined herein may cross-compete for binding to PD1 with an antibody or antigen-binding portion thereof comprising the sets of CDRs disclosed herein.
  • the invention provides an anti-PD1 antibody or an antigen-binding portion thereof, wherein the antibody or antigen-binding portion cross- competes for binding to PD1 with the antibody or antigen-binding portion comprising the sets of CDRs disclosed herein; and (a) comprises fully germline human framework amino acid sequences; and/or (b) binds specifically to human PD1 and cynomolgus PD1 ; and/or (c) does not comprise an oxidation site in the LCDR2; and/or (d) comprises a human germline peptide sequence with high MHC class II binding affinity (e.g., VKGRFTISR (SEQ ID NO:81 )) in the HCDR2/framework 3 region of the VH domain; and/or (e) does not comprise a human T cell epi
  • a KD value of an antibody or antigen-binding portion may be determined by Biacore analysis.
  • an EC50 value of an antibody or antigen-binding portion may be determined by flow cytometric staining of PD-1 expressing cells (e.g., CHO cells).
  • cross-compete means the ability of an antibody or portion thereof to interfere with the binding directly or indirectly through allosteric modulation of the anti-PD1 antibodies of the invention to the target PD1 (e.g., human PD1 ).
  • target PD1 e.g., human PD1
  • the extent to which an antibody or portion thereof is able to interfere with the binding of another to the target, and therefore whether it can be said to cross-block or cross-compete according to the invention can be determined using competition binding assays.
  • a binding competition assay is Homogeneous Time Resolved Fluorescence (HTRF).
  • One particularly suitable quantitative cross-competition assay uses a FACS- or an AlphaScreen- based approach to measure competition between the labelled (e.g. His tagged, biotinylated or radioactive labelled) antibody or portion thereof and the other antibody or portion thereof in terms of their binding to the target.
  • a cross-competing antibody or portion thereof is, for example, one which will bind to the target in the cross-competition assay such that, during the assay and in the presence of a second antibody or portion thereof, the recorded displacement of the immunoglobulin single variable domain or polypeptide according to the invention is up to 100% (e.g. in a FACS based competition assay) of the maximum theoretical displacement (e.g. displacement by cold (e.g.
  • cross-competing antibodies or portions thereof have a recorded displacement that is between 10% and 100%, or between 50% and 100%.
  • the antibody molecule or antigen-binding portion as defined herein may comprise one or more substitutions, deletions and/or insertions which remove a post-translational modification (PTM) site, for example a glycosylation site (N-linked or O-linked), a deamination site, a phosphorylation site or an isomerisation/fragmentation site.
  • PTM post-translational modification
  • PTM More than 350 types of PTM are known. Key forms of PTM include phosphorylation, glycosylation ( N - and O-linked), sumoylation, palmitoylation, acetylation, sulfation, myristoylation, prenylation and methylation (of K and R residues).
  • Statistical methods to identify putative amino acid sites responsible for specific PTMs are well known in the art (see Zhou et al., 2016, Nature Protocols 1 : 1318-1321 ). Removal of such a site for example by substitution, deletion and/or insertion and then optionally testing (experimentally and/or theoretically) for (a) binding activity and/or (b) loss of the PTM is contemplated.
  • the Mu317 murine LCDR2 (as defined herein, i.e. the amino acid sequence YAFHRFT (SEQ ID NO:31 )) has been identified to have a putative oxidation site at residue 3 (F). Removal of this site at equivalent positions in an LCDR2 of the invention, for example by conservative or non-conservative substitution (such as to S or Y), is envisaged (as for example in clones 09C06 and other clones in Tables 3 and 4).
  • the antibody molecule or antigen-binding portion thereof may be human, humanized or chimeric.
  • the antibody molecule or antigen-binding portion thereof may comprise one or more human variable domain framework scaffolds into which the CDRs have been inserted.
  • the VH region, the VL region, or both the VH and the VL region may comprise one or more human framework region amino acid sequences.
  • the antibody molecule or antigen-binding portion thereof may comprise an IGHV3-7 human germline scaffold into which the corresponding HCDR sequences have been inserted.
  • the antibody molecule or antigen-binding portion thereof may comprise a VH region that comprises an IGHV3-7 human germline scaffold amino acid sequence into which a set of corresponding HCDR1 , HCDR2 and HCDR3 amino acid sequences have been inserted.
  • the antibody molecule or antigen-binding portion thereof may comprise an IGKV4-1 human germline scaffold into which the corresponding LCDR sequences have been inserted.
  • the antibody molecule or antigen-binding portion thereof may comprise a VL region that comprises an IGKV4-1 human germline scaffold amino acid sequence into which a set of corresponding LCDR1 , LCDR2 and LCDR3 amino acid sequences have been inserted.
  • the antibody molecule or antigen-binding portion thereof may comprise an IGHV3-7 human germline scaffold into which the corresponding HCDR sequences have been inserted and an IGKV4-1 human germline scaffold into which the corresponding LCDR sequences have been inserted.
  • the antibody molecule or antigen-binding portion thereof may comprise a VH region that comprises an IGHV3-7 human germline scaffold amino acid sequence into which a set of corresponding HCDR1 , HCDR2 and HCDR3 amino acid sequences have been inserted and a VL region that comprises an IGKV4-1 human germline scaffold amino acid sequence into which a set of corresponding LCDR1 , LCDR2 and LCDR3 amino acid sequences have been inserted.
  • the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 amino acid sequences may be the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 amino acid sequences of any one of the clones in Table 4 (with all six CDR sequences being from the same clone).
  • the antibody molecule or antigen-binding portion thereof may comprise an immunoglobulin constant region.
  • the immunoglobulin constant region is lgG1 , lgG2, lgG3, lgG4, lgA1 or lgA2.
  • the immunoglobulin constant region is lgG1 , lgG2, lgG3, lgG4, lgA1 or lgA2.
  • the antibody molecule or antigen-binding portion thereof may comprise an immunologically inert constant region.
  • an anti-PD1 antibody or antigen-binding portion thereof may comprise an immunoglobulin constant region comprising a wild-type human lgG1 constant region, a human lgG1 constant region comprising the amino acid substitutions L234A, L235A and G237A or a human lgG1 constant region comprising the amino acid substitutions L234A, L235A, G237A and P331 S.
  • an anti-PD1 antibody or antigen-binding portion thereof may comprise an immunoglobulin constant region comprising a wild-type human lgG2 constant region or a wild-type human lgG4 constant region.
  • an anti-PD1 antibody may comprise an immunoglobulin constant region comprising any one of the amino acid sequences in Table 10.
  • the Fc region sequences in Table 10 begin at the CH1 domain.
  • an anti-PD1 antibody may comprise an immunoglobulin constant region comprising an amino acid sequence of an Fc region of human lgG4, human lgG4(S228P), human lgG2, human lgG1 , human lgG1 -3M or human lgG1 -4M.
  • the human lgG4(S228P) Fc region comprises the following substitution compared to the wild- type human lgG4 Fc region: S228P.
  • the human lgG1 -3M Fc region comprises the following substitutions compared to the wild-type human lgG1 Fc region: L234A, L235A and G237A
  • the human lgG1 -4M Fc region comprises the following substitutions compared to the wild-type human lgG1 Fc region: L234A, L235A, G237A and P331 S.
  • a position of an amino acid residue in a constant region of an immunoglobulin molecule is numbered according to EU nomenclature (Ward et al., 1995 Therap. Immunol. 2:77-94).
  • an immunoglobulin constant region may comprise an RDELT (SEQ ID NO:18) motif or an REEM (SEQ ID NO:19) motif (underlined in Table 18).
  • the REEM (SEQ ID NO:19) allotype is found in a smaller human population than the RDELT (SEQ ID NO:18) allotype.
  • an anti-PD1 antibody may comprise an immunoglobulin constant region comprising any one of SEQ ID NOS:9-15.
  • an anti-PD1 antibody may comprise the six CDR amino acid sequences of any one of the clones in Table 4 and any one of the Fc region amino acid sequences in Table 10.
  • an anti-PD1 antibody may comprise an immunoglobulin heavy chain constant region comprising any one of the Fc region amino acid sequences in Table 10 and an immunoglobulin light chain constant region that is a kappa light chain constant region or a lambda light chain constant region.
  • an anti-PD1 antibody or an antigen-binding portion thereof wherein the antibody comprises a heavy chain variable (VH) region, a light chain variable (VL) region and a heavy chain constant region, wherein
  • the VH region amino acid sequence comprises HCDR1 of GFTFSSYGMS (SEQ ID NO:33), HCDR2 of VANIWQDGSTKYVDSVKG (SEQ ID NO:34), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35);
  • the VL region amino acid sequence comprises LCDR1 of KSSQSVTNDVA (SEQ ID NO:36), LCDR2 of YAYHRFT (SEQ ID NO:37), and LCDR3 of HQAYSSPYT (SEQ ID NO:38); and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15;
  • the VH region amino acid sequence comprises HCDR1 of GFSLSSYGMS (SEQ ID NO:39), HCDR2 of VAVIWQDGSTNYVDSVKG (SEQ ID NO:40), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35);
  • the VL region amino acid sequence comprises LCDR1 of KSSQSVTNDVA (SEQ ID NO:36), LCDR2 of YAYHRFT (SEQ ID NO:37), and LCDR3 of HQAYSSPYT (SEQ ID NO:38); and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15;
  • the VH region amino acid sequence comprises HCDR1 of GFTFSSYGMS (SEQ ID NO:33), HCDR2 of VANIWQDGSEKYVDSVKG (SEQ ID NO:41 ), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35);
  • the VL region amino acid sequence comprises LCDR1 of KSSQSVTNDVA (SEQ ID NO:36), LCDR2 of YAYHRFT (SEQ ID NO:37), and LCDR3 of HQAYSSPYT (SEQ ID NO:38); and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15;
  • the VH region amino acid sequence comprises HCDR1 of GFSFSSYGMH (SEQ ID NO:42), HCDR2 of VANIWQDGSTNYVDSVKG (SEQ ID NO:43), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35);
  • the VL region amino acid sequence comprises LCDR1 of KSSQ
  • the VH region amino acid sequence comprises HCDR1 of GFSFTSYGMS (SEQ ID NO:47), HCDR2 of LAN I WQDGSTN YVDS VKG (SEQ ID NO:48), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35);
  • the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46); and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15;
  • the VH region amino acid sequence comprises HCDR1 of GFTFSSYGVH (SEQ ID NO:49), HCDR2 of VGVIWQDGSENYVDSVKG (SEQ ID NO:50), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35);
  • the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDLA (SEQ ID NO:51 ), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of QQAYSTPYT (SEQ ID NO:52); and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15;
  • the VH region amino acid sequence comprises HCDR1 of GFSFSSYGMH (SEQ ID NO:42), HCDR2 of VANIWQDGSTNYVDSVKG (SEQ ID NO:43), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35);
  • the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46); and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15;
  • the VH region amino acid sequence comprises HCDR1 of GFSFSSYGMH (SEQ ID NO:42), HCDR2 of LANIWQDGSENYVDSVKG (SEQ ID NO:53), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35);
  • the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of QQAYSTPYT (SEQ ID NO:52); and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15;
  • the VH region amino acid sequence comprises HCDR1 of GFTLSSYGMH (SEQ ID NO:54), HCDR2 of LAVIWADGSTNYVDSVKG (SEQ ID NO:55), and HCDR3 of AYGNYMYIDV (SEQ ID NO:56);
  • the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDVA (SEQ ID NO:44), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of HQAYSTPYT (SEQ ID NO:46); and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15;
  • the VH region amino acid sequence comprises HCDR1 of GFTFSSYGMH (SEQ ID NO:57), HCDR2 of VGVIKQDGSENYVDSVKG (SEQ ID NO:58), and HCDR3 of AYGNYWYIDR (SEQ ID NO:35);
  • the VL region amino acid sequence comprises LCDR1 of KSSQSVSN
  • the VH region amino acid sequence comprises HCDR1 of GFSFTSYGMH (SEQ ID NO:59), HCDR2 of VGVIWQDGSTNYVDSVKG (SEQ ID NO:60), and HCDR3 of GYGNYWYIDV (SEQ ID NO:61 );
  • the VL region amino acid sequence comprises LCDR1 of KSSQSVSNDLA (SEQ ID NO:51 ), LCDR2 of YASHRFT (SEQ ID NO:45), and LCDR3 of QQAYSTPYT (SEQ ID NO:52); and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15.
  • an anti-PD1 antibody or an antigen-binding portion thereof wherein the antibody comprises a heavy chain variable (VH) region, a light chain variable (VL) region and a heavy chain constant region, wherein
  • the VH region amino acid sequence comprises or consists of SEQ ID NO:1 ;
  • the VL region amino acid sequence comprises or consists of SEQ ID NO:2;
  • the heavy chain constant region comprises a wild-type human lgG4 constant region, a human lgG4 constant region comprising the amino acid substitution S228P, a wild-type human lgG2 constant region; a wild-type human lgG1 constant region or a human lgG1 constant region comprising the amino acid substitutions L234A, L235A and G237A;
  • the VH region amino acid sequence comprises or consists of SEQ ID NO:3; the VL region amino acid sequence comprises or consists of SEQ ID NO:4; and the heavy chain constant region comprises a wild-type human lgG4 constant region, a human lgG4 constant region comprising the amino acid substitution S228P, a wild-type human lgG2 constant region; a wild-type human lgG1 constant region or a human lgG1 constant region comprising the amino acid substitutions L234A, L235A and G237A;
  • the VH region amino acid sequence comprises or consists of SEQ ID NO:5; the VL region amino acid sequence comprises or consists of SEQ ID NO:6; and the heavy chain constant region comprises a wild-type human lgG4 constant region, a human lgG4 constant region comprising the amino acid substitution S228P, a wild-type human lgG2 constant region; a wild-type human lgG1 constant region or a human lgG1 constant region comprising the amino acid substitutions L234A, L235A and G237A;or
  • the VH region amino acid sequence comprises or consists of SEQ ID NO:7; the VL region amino acid sequence comprises or consists of SEQ ID NO:8; and the heavy chain constant region comprises a wild-type human lgG4 constant region, a human lgG4 constant region comprising the amino acid substitution S228P, a wild-type human lgG2 constant region; a wild-type human lgG1 constant region or a human lgG1 constant region comprising the amino acid substitutions L234A, L235A and G237A.
  • an anti-PD1 antibody or an antigen-binding portion thereof wherein the antibody comprises a heavy chain variable (VH) region, a light chain variable (VL) region and a heavy chain constant region, wherein
  • VH region amino acid sequence comprises or consists of SEQ ID NO:1 ;
  • VL region amino acid sequence comprises or consists of SEQ ID NO:2;
  • the heavy chain constant region comprises any one of SEQ ID NOS: 9-15;
  • VH region amino acid sequence comprises or consists of SEQ ID NO:3;
  • VL region amino acid sequence comprises or consists of SEQ ID NO:4;
  • the heavy chain constant region comprises any one of SEQ ID NOS: 9-15;
  • the VH region amino acid sequence comprises or consists of SEQ ID NO:5; the VL region amino acid sequence comprises or consists of SEQ ID NO:6; and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15; or
  • the VH region amino acid sequence comprises or consists of SEQ ID NO:7; the VL region amino acid sequence comprises or consists of SEQ ID NO:8; and the heavy chain constant region comprises any one of SEQ ID NOS: 9-15.
  • an anti-PD1 antibody may be immune effector null. In some aspects, an anti-PD1 antibody or an antigen-binding portion thereof does not induce immune effector function and, optionally, suppresses immune effector function. In some aspects, an anti- PD1 antibody may lack measurable binding to human FcyRI, FcyRIla, FcyRIIIa and FcyRIIIb receptors but maintain binding to human FcyRIIb receptor and optionally maintain binding to human FcRn receptor. FcyRI, FcyRIla, FcyRIIIa and FcyRIIIb are examples of activating receptors. FcyRIIb is an example of an inhibitory receptor. FcRn is an example of a recycling receptor.
  • binding affinity of an anti-PD1 antibody or an antigen-binding portion thereof for human Fc receptors may be measured by BIACORE ® analysis.
  • Homogeneous Time Resolved Fluorescence can be used to study binding of an anti-PD1 antibody to human Fc receptors.
  • human lgG1 wild type
  • antibodies with engineered Fc fragments are used in titration competition.
  • PD1 -positive cells may be mixed with human white blood cells and anti-PD1 antibodies, and cell killing by CDC, ADCC and/or ADCP may be measured.
  • an anti-PD1 antibody comprising an amino acid sequence of an Fc region of human lgG1 -3M is effector null. In some aspects, an anti-PD1 antibody comprising an amino acid sequence of an Fc region of human lgG1 -3M (see Table 10) is not effector null.
  • the antibody molecule or antigen-binding portion thereof may be a Fab fragment, a F(ab)2 fragment, an Fv fragment, a tetrameric antibody, a tetravalent antibody, a multispecific antibody (for example, a bivalent antibody), a domain-specific antibody, a single domain antibody, a monoclonal antibody or a fusion protein.
  • an antibody may be a bispecific antibody that binds specifically to a first antigen and a second antigen, wherein the first antigen is PD1 and the second antigen is not PD1 .
  • Antibody molecules and methods for their construction and use are described, in for example Holliger & Fludson (2005, Nature Biotechnol. 23(9): 1 126-1 136).
  • an immunoconjugate comprising the antibody molecule or antigen-binding portion thereof of the invention as defined herein linked a therapeutic agent.
  • Suitable therapeutic agents include cytotoxins, radioisotopes, chemotherapeutic agents, immunomodulatory agents, anti-angiogenic agents, antiproliferative agents, pro- apoptotic agents, and cytostatic and cytolytic enzymes (for example RNAses).
  • Further therapeutic agents include a therapeutic nucleic acid, such as a gene encoding an immunomodulatory agent, an anti-angiogenic agent, an anti-proliferative agent, or a pro- apoptotic agent.
  • Suitable therapeutic agents for use in immunoconjugates include the taxanes, maytansines, CC-1065 and the duocarmycins, the calicheamicins and other enediynes, and the auristatins. Other examples include the anti-folates, vinca alkaloids, and the anthracyclines. Plant toxins, other bioactive proteins, enzymes (i.e., ADEPT), radioisotopes, photosensitizers may also be used in immunoconjugates. In addition, conjugates can be made using secondary carriers as the cytotoxic agent, such as liposomes or polymers, Suitable cytotoxins include an agent that inhibits or prevents the function of cells and/or results in destruction of cells.
  • Representative cytotoxins include antibiotics, inhibitors of tubulin polymerization, alkylating agents that bind to and disrupt DNA, and agents that disrupt protein synthesis or the function of essential cellular proteins such as protein kinases, phosphatases, topoisomerases, enzymes, and cyclins.
  • cytotoxins include, but are not limited to, doxorubicin, daunorubicin, idarubicin, aclarubicin, zorubicin, mitoxantrone, epirubicin, carubicin, nogalamycin, menogaril, pitarubicin, valrubicin, cytarabine, gemcitabine, trifluridine, ancitabine, enocitabine, azacitidine, doxifluhdine, pentostatin, broxuhdine, capecitabine, cladhbine, decitabine, floxuhdine, fludarabine, gougerotin, puromycin, tegafur, tiazofuhn, adhamycin, cisplatin, carboplatin, cyclophosphamide, dacarbazine, vinblastine, vincristine, mitoxantrone, bleomycin, mechlorethamine, prednisone, proc
  • Suitable immunomodulatory agents include anti-hormones that block hormone action on tumors and immunosuppressive agents that suppress cytokine production, down-regulate self-antigen expression, or mask MHC antigens.
  • nucleic acid molecule encoding the antibody molecule or antigen-binding portion thereof of the invention as defined herein.
  • a nucleic acid molecule may encode (a) the VH region amino acid sequence; (b) the VL region amino acid sequence; or (c) both the VH and the VL region amino acid sequences of an anti-PD1 antibody or an antigen-binding portion thereof described herein.
  • the nucleic acid molecule as defined herein may be isolated.
  • the vector may be an expression vector.
  • a host cell comprising the nucleic acid molecule or the vector of the invention as defined herein.
  • the host cell may be a recombinant host cell.
  • a method of producing an anti-PD1 antibody and/or an antigen-binding portion thereof comprising culturing the host cell of the invention under conditions that result in expression and/or production of the antibody and/or the antigen binding portion thereof, and isolating the antibody and/or the antigen-binding portion thereof from the host cell or culture.
  • composition comprising the antibody molecule or antigen-binding portion thereof of the invention as defined herein, or the nucleic acid molecule of the invention as defined herein, or the vector of the invention as defined herein.
  • a method for enhancing an immune response in a subject comprising administering to the subject an effective amount of the antibody molecule or antigen-binding portion thereof of the invention as defined herein, or the immunoconjugate of the invention as defined herein, or the nucleic acid molecule of the invention as defined herein, or the vector of the invention as defined herein, or the pharmaceutical composition of the invention as defined herein.
  • a method for treating or preventing cancer in a subject comprising administering to the subject an effective amount of the antibody molecule or antigen-binding portion thereof of the invention as defined herein, or the immunoconjugate of the invention as defined herein, or the nucleic acid molecule of the invention as defined herein, or the vector of the invention as defined herein, or the pharmaceutical composition of the invention as defined herein.
  • the cancer may be pancreatic cancer, melanoma, breast cancer, lung cancer, bronchial cancer, colorectal cancer, prostate cancer, stomach cancer, ovarian cancer, urinary bladder cancer, brain or central nervous system cancer, peripheral nervous system cancer, esophageal cancer, cervical cancer, uterine or endometrial cancer, cancer of the oral cavity or pharynx, liver cancer, kidney cancer, testicular cancer, biliary tract cancer, small bowel or appendix cancer, salivary gland cancer, thyroid gland cancer, adrenal gland cancer, osteosarcoma, chondrosarcoma, or cancer of hematological tissues.
  • the invention also provides an antibody molecule or antigen-binding portion thereof of the invention as defined herein, or the immunoconjugate of the invention as defined herein, or the nucleic acid molecule of the invention as defined herein, or the vector of the invention as defined herein, or the pharmaceutical composition of the invention as defined herein, for use in the treatment of cancer.
  • the invention provides the antibody molecule, or antigen-binding portion thereof, or the immunoconjugate, or the nucleic acid molecule, or the vector for use, or the method of treatment of the invention as defined herein, for separate, sequential or simultaneous use in a combination combined with a second therapeutic agent, for example an anti-cancer agent.
  • a second therapeutic agent for example an anti-cancer agent.
  • the invention also provides a method for treating or preventing an infectious or immune disease in a subject, comprising administering to the subject an effective amount of the antibody molecule or antigen-binding portion thereof as defined herein, or the immunoconjugate as defined here, or the nucleic acid molecule as defined herein, or the vector as defined herein, or the pharmaceutical composition as defined herein.
  • the invention provides an anti-PD1 antibody or an antigen-binding portion thereof comprising the amino acid sequences disclosed herein for use in therapy.
  • the pharmaceutical composition of the invention may comprise a pharmaceutically acceptable excipient, carrier, or diluent.
  • a pharmaceutically acceptable excipient may be a compound or a combination of compounds entering into a pharmaceutical composition which does not provoke secondary reactions and which allows, for example, facilitation of the administration of the anti-PD1 antibody molecule, an increase in its lifespan and/or in its efficacy in the body or an increase in its solubility in solution.
  • These pharmaceutically acceptable vehicles are well known and will be adapted by the person skilled in the art as a function of the mode of administration of the anti-PD1 antibody molecule.
  • the anti-PD1 antibody molecule may be provided in a lyophilised form for reconstitution prior to administration.
  • lyophilised antibody molecules may be re-constituted in sterile water and mixed with saline prior to administration to an individual.
  • the anti-PD1 antibody molecules will usually be administered in the form of a pharmaceutical composition, which may comprise at least one component in addition to the antibody molecule.
  • pharmaceutical compositions may comprise, in addition to the anti-PD1 antibody molecule, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the anti-PD1 antibody molecule.
  • a pharmaceutically acceptable excipient such materials should be non-toxic and should not interfere with the efficacy of the anti-PD1 antibody molecule.
  • the precise nature of the carrier or other material will depend on the route of administration, which may be by bolus, infusion, injection or any other suitable route, as discussed below.
  • parenteral for example sub-cutaneous or intra-venous administration, e.g.
  • the pharmaceutical composition comprising the anti-PD1 antibody molecule may be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • isotonic vehicles such as Sodium Chloride Injection, Ringe’s Injection, Lactated Ringer’s Injection.
  • buffers such as phosphate, citrate and other organic acids
  • antioxidants such as ascorbic acid and methionine
  • preservatives such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3’-pentanol; and m-cresol); low molecular weight polypeptides; proteins, such as serum albumin, gelatin or immunoglobulins; hydrophilic polymers, such as polyvinylpyrrolidone; amino acids, such as glycine, glutamine, asparagines, histidine, arginine, or ly
  • a pharmaceutical composition comprising an anti-PD1 antibody molecule may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
  • An anti-PD1 antibody molecule as described herein may be used in a method of treatment of the human or animal body, including prophylactic or preventative treatment (e.g. treatment before the onset of a condition in an individual to reduce the risk of the condition occurring in the individual; delay its onset; or reduce its severity after onset).
  • the method of treatment may comprise administering the anti-PD1 antibody molecule to an individual in need thereof.
  • Administration is normally in a“therapeutically effective amount”, this being sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom.
  • the actual amount administered, and rate and time-course of administration will depend on the nature and severity of what is being treated, the particular mammal being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the composition, the method of administration, the scheduling of administration and other factors known to medical practitioners. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors and may depend on the severity of the symptoms and/or progression of a disease being treated. Appropriate doses of antibody molecules are well known in the art (Ledermann J.A.
  • a therapeutically effective amount or suitable dose of an antibody molecule may be determined by comparing its in vitro activity and in vivo activity in an animal model. Methods for extrapolation of effective dosages in mice and other test animals to humans are known. The precise dose will depend upon a number of factors, including whether the antibody is for prevention or for treatment, the size and location of the area to be treated, the precise nature of the antibody (e.g. whole antibody, fragment) and the nature of any detectable label or other molecule attached to the antibody.
  • a typical antibody dose will be in the range 100 pg to 1 g for systemic applications, and 1 pg to 1 mg for topical applications.
  • An initial higher loading dose, followed by one or more lower doses, may be administered.
  • the antibody will be a whole antibody, e.g. the lgG1 or lgG4 isotype.
  • This is a dose for a single treatment of an adult patient, which may be proportionally adjusted for children and infants, and also adjusted for other antibody formats in proportion to molecular weight. Treatments may be repeated at daily, twice-weekly, weekly or monthly intervals, at the discretion of the physician.
  • the treatment schedule for an individual may be dependent on the pharmocokinetic and pharmacodynamic properties of the antibody composition, the route of administration and the nature of the condition being treated.
  • Treatment may be periodic, and the period between administrations may be about two weeks or more, e.g. about three weeks or more, about four weeks or more, about once a month or more, about five weeks or more, or about six weeks or more. For example, treatment may be every two to four weeks or every four to eight weeks. Treatment may be given before, and/or after surgery, and/or may be administered or applied directly at the anatomical site of surgical treatment or invasive procedure. Suitable formulations and routes of administration are described above.
  • anti-PD1 antibody molecules as described herein may be administered as sub-cutaneous injections.
  • Sub-cutaneous injections may be administered using an auto-injector, for example for long term prophylaxis/treatment.
  • the therapeutic effect of the anti-PD1 antibody molecule may persist for several half-lives, depending on the dose.
  • the therapeutic effect of a single dose of the anti-PD1 antibody molecule may persist in an individual for 1 month or more, 2 months or more, 3 months or more, 4 months or more, 5 months or more, or 6 months or more.
  • the invention also provides a method of producing an antibody molecule which specifically binds to human PD1 and optionally also to cynomolgus monkey PD1 , or an antigen-binding portion thereof, comprising the steps of:
  • step (4) producing an antibody molecule which specifically binds to human PD1 and optionally also to cynomolgus monkey PD1 , or an antigen-binding portion thereof from clones selected from step (4).
  • the method may comprise a further step of producing additional clones based on the clones selected in step (4), for example based on further exploratory mutagenesis at specific positions in the CDRs of the clones selected in step (4), to enhance humanization and/or minimise human T cell epitope content and/or improve manufacturing properties in the antibody molecule or antigen-binding portion thereof produced in step (5).
  • PD1 refers to Programmed Cell Death Protein 1 and variants thereof that retain at least part of the biological activity of PD1 .
  • PD1 includes all species of native sequence PD1 , including human, rat, mouse and chicken.
  • the term “PD1” is used to include variants, isoforms and species homologs of human PD1 .
  • Antibodies of the invention may cross-react with PD1 from species other than human, in particular PD1 from cynomolgus monkey ( Macaca fascicularis). Examples of human and cynomolgus PD1 amino acid sequences are provided in Table 1 1 .
  • the antibodies may be completely specific for human PD1 and may not exhibit non-human cross-reactivity.
  • an“antagonist” as used in the context of the antibody of the invention or an “anti-PD1 antagonist antibody” refers to an antibody which is able to bind to PD1 and inhibit PD1 biological activity and/or downstream pathway(s) mediated by PD1 signalling.
  • An anti-PD1 antagonist antibody encompasses antibodies that can block, antagonize, suppress or reduce (including significantly) PD1 biological activity, including downstream pathways mediated by PD1 signalling, such as receptor binding and/or elicitation of a cellular response to PD1 .
  • anti- PD1 antagonist antibody encompass all the terms, titles, and functional states and characteristics whereby PD1 itself, and PD1 biological activity (including but not limited to its ability to suppress the activation of anti-tumour cell activity of T cells), or the consequences of the activity or biological activity, are substantially nullified, decreased, or neutralized in any meaningful degree.
  • PD1 “specifically binds”“specifically interacts”,“preferentially binds”,“binds” or“interacts” with PD1 if it binds with greater affinity, avidity, more readily and/or with greater duration than it binds to other receptors.
  • An“antibody molecule” is an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
  • the term“antibody molecule” encompasses not only intact polyclonal or monoclonal antibodies, but also any antigen binding fragment (for example, an“antigen-binding portion”) or single chain thereof, fusion proteins comprising an antibody, and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site including, for example without limitation, scFv, single domain antibodies (for example, shark and camelid antibodies), maxibodies, minibodies, intrabodies, diabodies, triabodies, tetrabodies, v-NAR and bis-scFv.
  • an“antibody molecule” encompasses an antibody of any class, such as IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
  • immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), for example lgG1 , lgG2, lgG3, lgG4, lgA1 and lgA2.
  • the heavy-chain constant regions that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
  • the subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
  • antibody molecule refers to one or more fragments of an intact antibody that retain the ability to specifically bind to PD1 .
  • Antigen binding functions of an antibody molecule can be performed by fragments of an intact antibody. Examples of binding fragments encompassed within the term“antigen binding portion” of an antibody molecule include Fab; Fab'; F(ab')2; an Fd fragment consisting of the VH and CH1 domains; an Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a single domain antibody (dAb) fragment, and an isolated complementarity determining region (CDR).
  • the term“Fc region” is used to define a C-terminal region of an immunoglobulin heavy chain.
  • The“Fc region” may be a native sequence Fc region or a variant Fc region.
  • the human IgG heavy chain Fc region is usually defined to stretch from an amino acid residue at position Cys226, or from Pro230, to the carboxyl-terminus thereof.
  • the numbering of the residues in the Fc region is that of the EU index as in Kabat.
  • the Fc region of an immunoglobulin generally comprises two constant domains, CH2 and CH3. As is known in the art, an Fc region can be present in dimer or monomeric form.
  • variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
  • variable regions of the heavy and light chain each consist of four framework regions (FRs) connected by three complementarity determining regions (CDRs) also known as hypervariable regions, contribute to the formation of the antigen binding site of antibodies.
  • FRs framework regions
  • CDRs complementarity determining regions
  • FRs from antibodies which contain CDR sequences in the same canonical class are preferred.
  • the CDR definitions used in the present application combine the domains used in the many disparate, often conflicting schemes that have been created in the field, which are based on the combination of immunoglobulin repertoire analyses and structural analyses of antibodies in isolation and in their co-crystals with antigens (see review by Swindells etal., 2016, abYsis: Integrated Antibody Sequence and Structure-Management, Analysis, and Prediction. J Mol Biol. [PMID: 27561707; Epub 22 August 2016]).
  • the CDR definition used herein incorporates the lessons of all such prior insights and includes all appropriate loop positions required to sample the full residue landscape that potentially mediates target binding complementarity.
  • Table 1 shows the amino acid sequences of the Mu317 murine anti-PD1 antibody CDRs as defined herein (a“Unified” scheme), in comparison to well-known alternative systems for defining the same CDRs.
  • a“conservative substitution” refers to replacement of an amino acid with another amino acid which does not significantly deleteriously change the functional activity.
  • a preferred example of a“conservative substitution” is the replacement of one amino acid with another amino acid which has a value > 0 in the following BLOSUM 62 substitution matrix (see Henikoff & Henikoff, 1992, PNAS 89: 10915-10919):
  • “monoclonal antibody” refers to an antibody, or antigen-binding portion thereof, that is derived from a single copy or clone, including for example any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
  • a monoclonal antibody of the invention exists in a homogeneous or substantially homogeneous population.
  • A“humanized” antibody molecule refers to a form of non-human (for example, murine) antibody molecules, or antigen-binding portion thereof, that are chimeric immunoglobulins, immunoglobulin chains, or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen- binding subsequences of antibodies) that contain minimal sequence derived from non- human immunoglobulin.
  • Humanized antibodies may be human immunoglobulins (recipient antibody) in which residues from a CDR of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, or rabbit having the desired specificity, affinity, and capacity.
  • Human antibody or fully human antibody refers to an antibody molecule, or antigen-binding portion thereof, derived from transgenic mice carrying human antibody genes or from human cells.
  • chimeric antibody is intended to refer to an antibody molecule, or antigen-binding portion thereof, in which the variable region sequences are derived from one species and the constant region sequences are derived from another species, such as an antibody molecule in which the variable region sequences are derived from a mouse antibody and the constant region sequences are derived from a human antibody.
  • Antibody-drug conjugate and“immunoconjugate” refer to an antibody molecule, or antigen binding portion thereof, including antibody derivatives that binds to PD1 and is conjugated to cytotoxic, cytostatic and/or therapeutic agents.
  • Antibody molecules of the invention can be produced using techniques well known in the art, for example recombinant technologies, phage display technologies, synthetic technologies or combinations of such technologies or other technologies readily known in the art.
  • isolated molecule (where the molecule is, for example, a polypeptide, a polynucleotide, or an antibody) is a molecule that by virtue of its origin or source of derivation (1 ) is not associated with naturally associated components that accompany it in its native state, (2) is substantially free of other molecules from the same species (3) is expressed by a cell from a different species, or (4) does not occur in nature.
  • a molecule that is chemically synthesized, or expressed in a cellular system different from the cell from which it naturally originates will be“isolated” from its naturally associated components.
  • a molecule also may be rendered substantially free of naturally associated components by isolation, using purification techniques well known in the art.
  • Molecule purity or homogeneity may be assayed by a number of means well known in the art.
  • the purity of a polypeptide sample may be assayed using polyacrylamide gel electrophoresis and staining of the gel to visualize the polypeptide using techniques well known in the art.
  • higher resolution may be provided by using HPLC or other means well known in the art for purification.
  • epitope refers to that portion of a molecule capable of being recognized by and bound by an antibody molecule, or antigen-binding portion thereof, at one or more of the antibody molecule's antigen-binding regions.
  • Epitopes can consist of defined regions of primary secondary or tertiary protein structure and includes combinations of secondary structural units or structural domains of the target recognised by the antigen binding regions of the antibody, or antigen-binding portion thereof.
  • Epitopes can likewise consist of a defined chemically active surface grouping of molecules such as amino acids or sugar side chains and have specific three-dimensional structural characteristics as well as specific charge characteristics.
  • antigenic epitope is defined as a portion of a polypeptide to which an antibody molecule can specifically bind as determined by any method well known in the art, for example, by conventional immunoassays, antibody competitive binding assays or by x-ray crystallography or related structural determination methods (for example NMR).
  • KD binding affinity
  • the KD is the ratio of the rate of dissociation, also called the“off-rate (k off )”, to the association rate, or“on-rate (k on )”.
  • KD equals k 0ft / k on and is expressed as a molar concentration (M). It follows that the smaller the KD, the stronger the affinity of binding. Therefore, a KD of 1 mM indicates weak binding affinity compared to a KD of 1 nM.
  • KD values for antibodies can be determined using methods well established in the art. One method for determining the KD of an antibody is by using surface plasmon resonance (SPR), typically using a biosensor system such as a Biacore ® system.
  • SPR surface plasmon resonance
  • potency is a measurement of biological activity and may be designated as IC50, or effective concentration of an antibody or antibody drug conjugate to the antigen PD1 to inhibit 50% of activity measured in a PD1 activity assay as described herein.
  • an effective amount or“therapeutically effective amount” as used herein refers to an amount necessary (at dosages and for periods of time and for the means of administration) to achieve the desired therapeutic result.
  • An effective amount is at least the minimal amount, but less than a toxic amount, of an active agent which is necessary to impart therapeutic benefit to a subject.
  • the term“inhibit” or“neutralize” as used herein with respect to bioactivity of an antibody molecule of the invention means the ability of the antibody to substantially antagonize, prohibit, prevent, restrain, slow, disrupt, eliminate, stop, reduce or reverse for example progression or severity of that which is being inhibited including, but not limited to, a biological activity or binding interaction of the antibody molecule to PD1 .
  • A“host cell” includes an individual cell or cell culture that can be or has been a recipient for vector(s) for incorporation of polynucleotide inserts.
  • Host cells include progeny of a single host cell, and the progeny may not necessarily be completely identical (in morphology or in genomic DNA complement) to the original parent cell due to natural, accidental, or deliberate mutation.
  • a host cell includes cells transfected in vivo with a polynucleotide(s) of this invention.
  • vector means a construct, which is capable of delivering, and, preferably, expressing, one or more gene(s) or sequence(s) of interest in a host cell.
  • vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
  • treating means reversing, alleviating, inhibiting the progress of, delaying the progression of, delaying the onset of, or preventing the disorder or condition to which such term applies, or one or more symptoms of such disorder or condition.
  • treatment refers to the act of treating as defined above.
  • the term“treating” also includes adjuvant and neoadjuvant treatment of a subject.
  • treatment includes reference to curative, palliative and prophylactic treatment.
  • references herein to“treatment” also include references to curative, palliative and prophylactic treatment.
  • the present invention encompasses not only the entire group listed as a whole, but each member of the group individually and all possible subgroups of the main group, but also the main group absent one or more of the group members.
  • the present invention also envisages the explicit exclusion of one or more of any of the group members in the claimed invention.
  • all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. In case of conflict, the present specification, including definitions, will control.
  • the PD1 Fab library was assembled by mass oligo synthesis and PCR.
  • the amplified Fab repertoire was then cloned via restriction-ligation into a phagemid vector, transformed into E.coli TG-1 cells, and the phage repertoire rescued essentially as previously described in detail (Finlay et al., 201 1 , Methods Mol Biol 681 : 383-401 ).
  • Phage selections were performed by coating streptavidin magnetic microbeads with biotinylated PD1 target protein (either human or cyno), washing the beads thrice with PBS and resuspending in PBS pFI7.4 plus 5% skim milk protein. These beads were coated at 100 nM target protein in round 1 of selection, followed by reduced antigen concentrations in three successive rounds. In each round, phage were eluted using trypsin before re-infection into TG1 cells.
  • E. coli TG1 cells in logarhythmic growth phase were induced with isopropyl 1 -thio-3-D-galactopyranoside.
  • Periplasmic extracts containing soluble Fab were generated by a freeze/thaw cycle: BacteriaL cell pellets were frozen at -20 °C for overnight and then thawed at room temperature and resuspended in PBS pH 7.4. The supernatants containing the soluble Fab were collected after shaking at room temperature and centrifugation.
  • Mammalian codon-optimized synthetic genes encoding the heavy and light chain variable domains of the lead panel anti-PD1 antibodies plus the Mu317 and hu317 were cloned into mammalian expression vectors comprising effector function null human lgG1 (‘IgGI nuM’; human lgG1 containing L234A, L235A, G237A mutations in the lower hinge that abrogate normal immunoglobulin FcyR interactions) and human CK domains, respectively.
  • IgGI nuM effector function null human lgG1
  • Co transfection of heavy and light chain containing vector in mammalian expression system was performed, followed by protein A-based purification of the IgG, quantification and QC on denaturing and non-denaturing SDS-PAGE.
  • the Fabs were detected using mouse anti-c-myc antibody followed by donkey anti-mouse IgG conjugated to horseradish peroxidase.
  • the IgGs were detected using the mouse anti human IgG conjugated to horseradish peroxidase. Binding signals were visualized with 3,3',5,5'-Tetramethylbenzidine Substrate Solution (TMB) and the absorbance measured at 450 nm.
  • TMB 3,3',5,5'-Tetramethylbenzidine Substrate Solution
  • the AlphaScreen assay (Perkin Elmer) was performed in a 25 mI final volume in 384-well white microtiter plates (Greiner).
  • the reaction buffer contained 1 xPBS pH 7.3 (Oxoid, Cat. nr. BR0014G ) and 0.05 % (v/v) Tween® 20 (Sigma, Cat. nr. P9416).
  • Purified IgG samples were titrated in three fold serial dilutions starting at 500 nM final concentration and incubated with biotinylated human PD1 -His/AviTag at 0.6 nM final concentration for 20 minutes at room temperature.
  • IgGs Purified IgGs were tested in FACs for binding to CHO-K1 stable cell lines expressing human (Genscript, Cat. nr. M00529), and cyno (Genscript, Cat. nr. M00572) PD1 , and CHO-K1 wild- type cells.
  • the IgG samples were titrated in three-fold serial dilutions starting at 500 nM to 0.98 nM. Binding of IgGs was detected with a mouse anti-human IgG conjugated to FITC.
  • Results were analyzed by examining the Mean Fluorescence Intensity (MFI) of 10000 cells per sample in the BL-1 channel detector of a flow cytometer (AttuneTM NxT Acoustic Focusing Cytometer, Invitrogen/ ThermoFisher Scientific).
  • MFI Mean Fluorescence Intensity
  • the EC50 values were calculated using the MFI values in GraphPad Prism software (GraphPad Software, La Jolla, CA) and 4 parameters.
  • the PD1/PD-L1 blockade cell-based bioassay (Promega), was used to measure the potency of antibodies in blocking the PD1 /PD-L1 interaction.
  • PD-L1 aAPC/CHO-K1 cells were thawed and transferred into cell recovery medium (90% Ham’s F12/10% FBS).
  • the cell suspension was dispensed to each of the inner 60 wells of two 96- well, white, flat-bottom assay plates, at 100 mI per well. Cell recovery medium was added to each of the outside wells and the assay plates and incubated overnight at 37 °C/5% C02.
  • the sample IgGs were diluted 4-fold in assay buffer (99% RPMI 1640/1 % FBS) from 300 nM to 0,04 nM and 40 mI per dilution added to the assay plates containing the PD-L1 aAPC/CHO-K1 cells.
  • Positive inhibition controls included the human PD1 Antibody AF1086 (R&D systems), mu317 in lgG1 null form and a pembrolizumab mab analogue in lgG1 null form.
  • an irrelevant IgG was included.
  • PD1 Effector Cells were then thawed in assay buffer (99% RPM1 1640/1 % FBS) and the cell suspension added to the wells of the assay plates containing the PD-L1 aAPC/CHO-K1 cells and the IgG titration samples.
  • the assay plates were incubated for six hours in a 37 °C/5 % C02 incubator, allowed to equilibrate to ambient temperature for 5-10 minutes, then 80 mI of Bio-GloTM Reagent (Promega) was added. Assay plates were incubated at ambient temperature for a further 5-30 minutes and luminescence signals subsequently measured at 10, 20 and 30 minutes.
  • Mo-DCs monocyte- derived dendritic cells
  • MACs magnetic- activated cell sorting
  • Miltenyi differentiation medium
  • the Tm of test articles was analysed using a MicroCal PEAQ-DSC (Malvern Instruments, Malvern, UK) running version 1 .22 software. The samples were heated at a rate of 200 °C/hour over a range of 20-1 10 °C. Thermal data was normalised based on protein concentration. The Tm of the protein was determined from the heating scan data.
  • test articles in PBS were treated with 0.5 % H202 at room temperature for 2 hours and then stored at - 80 °C prior to SEC, HIC and RP analysis (intact antibodies and subunits) on a Dionex Ultimate 3000RS HPLC system (ThermoFisher Scientific, Hemel Hempstead, UK), as detailed below.
  • DTT was added to a final concentration of 0.33 M and samples were incubated for 1 hour at room temperature and immediately analysed by RP.
  • RP analysis of intact antibodies and subunits - Chromatographic separation was performed using a PLRP-S 1000, 5 pm, 2.1 mm x 50 mm column (Agilent Technologies, Stockport, UK) connected to a Dionex Ultimate 3000RS HPLC system (ThermoFisher Scientific, Hemel Hempstead, UK).
  • the method consisted of a linear gradient from 75% buffer A (0.075% TFA, 7.5% acetonitrile in H20) to 50% buffer B (0.075% TFA, 7.5% H20 in acetonitrile) for mAbs 1 -4, or 90% buffer B for mAb 5, over 24 minutes.
  • the flow rate was 0.5 mL/minute and the temperature was maintained at 70°C throughout the analysis. Detection was carried out by UV absorption at 280 nm.
  • HIC Analysis - Chromatographic separation was performed using a TSKgel Butyl-NPR 4.6 mm x 35 mm HIC column (TOSOH Bioscience Ltd., Reading, UK) connected to a Dionex Ultimate 3000RS HPLC system (ThermoFisher Scientific, Hemel Hempstead, UK).
  • the method consisted of a linear gradient from 60% Buffer A (100 mM sodium phosphate pH 7.0, 2 M ammonium sulphate) to 90% Buffer B (100 mM sodium phosphate pH 7.0) over 9 minutes. The flow rate was 1 .2 mL/minute. Detection was carried out by UV absorption at 280 nm.
  • Antibody v-domain specificity testing human receptor array analyses
  • Human cell membrane receptor proteome arrays were performed at Retrogenix Ltd. Primary screens: 2 pg/ml of each antibody was screened for binding against fixed HEK293 cells/slides expressing 5528 human plasma membrane and tethered secreted proteins individually. All transfection efficiencies exceeded the minimum threshold. Antibody binding was detected using AF647 fluorescent secondary anti-human lgG1 antibody. Primary hits (duplicate spots) were identified by analysing fluorescence (AF647 and ZsGreenl ) on ImageQuant. Confirmation/specificitv screens: Expression vectors encoding ZsGreenl only, or ZsGreenl and CD20, PD1 , BTN2A1 , or LSAMP were transfected into human HEK293 cells.
  • Each live transfectant was incubated with 2 pg/ml of each of the test antibodies, the positive control antibody Rituximab, or no primary antibody. Cells were washed, and incubated with the same AF647 anti-human IgG Fc detection antibody as used in the cell microarray screens. Cells were again washed, and analysed by flow cytometry using an Accuri flow cytometer (BD). A 7AAD live/dead dye was used to exclude dead cells, and ZsGreenl -positive cells (i.e. transfected cells) were selected for analyses.
  • BD Accuri flow cytometer
  • the CDRs of an agonistic murine anti-PD1 IgG Mu317 were initially introduced to human germline immunoglobulin v-domain framework sequence scaffolds using CDR grafting.
  • the CDR-grafted IGHV3-7/IGKV4-1 v-domain sequences were combined into a Fab phage display format and a mutagenesis library cassette was generated by oligo synthesis and assembly.
  • Two separate Fab libraries were initially constructed that sampled mutational diversity in either the heavy or light chain v-domain sequences in combination with the cognate paired grafted v-domain.
  • Both VH and VL libraries were separately ligated into a phage display vector and transformed into E. coli via electroporation to generate 3.15 x 10 9 and 2.27 x 10 9 independent clones, respectively. Library build quality was verified by sequencing 96 clones per library.
  • Antibodies to PD1 were analysed for concentration-dependent binding at the cell surface via flow cytometry. Initial analyses were performed on CHO cells stably-transfected with human or cyno PD1 . These analyses showed that lead library-derived and designer clones exhibit concentration-dependent binding to membrane-presented human or cyno PD1 (Fig. 4A, 4B) with potencies similar to, or improved over, the hu317. No binding signals were observed for any clone, even at the highest concentrations, on untransfected CHO cells.
  • sequences were used to interrogate the TCEDTM by BLAST search in order to identify any high sequence homology between peptides (T cell epitopes) from unrelated proteins/antibodies that stimulated T cell responses in previous in vitro T cell epitope mapping studies performed at Abzena Ltd.
  • Germline Epitope 9mer peptides are unlikely to have immunogenic potential due to T cell tolerance, as validated by previous studies with a wide range of germline peptides. Importantly, such germline v- domain epitopes (aided further by similar sequences that are found in the human antibody constant regions) also compete for MHC Class II occupancy at the membrane of antigen presenting cells, reducing the risk of foreign peptide presentation being sufficient to achieve the‘activation threshold’ required for T cell stimulation. High GE content is therefore a beneficial quality in clinical development of an antibody therapeutic.
  • VKGRFTISR VKGRFTISR
  • mutation of the HCDR1 sequence from‘GFSLTSYGVH’ (SEQ ID NO:82) to the sequence‘GFTFSSYGMH’ (SEQ ID NO:57) not only ablated the LAF sequence‘LTSYGVHWI’ (SEQ ID NO:83) which spans the HCDR1 and framework 2 regions of Hu317, but also rendered this CDR fully germline identity to the human v-genes IGHV3-33 and IGHV3-30-5.
  • HCDR1 sequence ‘GFTFSSYGMS’ (SEQ ID NO:33) (found in clones 20C07 and all designer clones MH1 -MH18, Table 4) also ablated the LAF sequence‘LTSYGVHWI’ (SEQ ID NO:83). Both humanized CDR1 sequences encoded a GE peptide sequence
  • ‘YGM(H/S)WVRQA’ (SEQ ID NO:84) that was not found in either Hu317 or the library- derived clone 1 1 C08, due to the presence of the residue valine in their HCDRI s at position 9 (e.g. GFSLTSYGVH (SEQ ID NO:82)).
  • ‘LEWVGVIWQ’ (SEQ ID NO:88) was found in the VH domain of clone 1 1 C08, which overlaps with the‘LEWIGVIYA’ (SEQ ID NO:86) HAF from Hu317, while the LAF peptide ‘IGVIYADGS’ (SEQ ID NO:87) was ablated.
  • the‘LEWIGVIYA’ (SEQ ID NO:86) HAF from Hu317 was partially ablated, by mutation to the LAF peptide
  • the aim of this study was to characterise the potency of lead PD-1 targeted antibodies in an human allogeneic MLR, by measurement of IFN-g in the culture supernatants.
  • Fig. 8A the cytokine levels demonstrated that a Nivolumab analog significantly increased IFN-g levels compared to isotype control human lgG4. Isotype showed no difference compared to cells only, and the single cell conditions showed little to no measurable cytokine.
  • clones 09C06, MH4, MH8 and MH12 were examined for activity in the assay.
  • the four test antibodies were used at three concentrations (0.1 , 1 and 10pg/mL) and compared to the appropriate isotype control, human-lgG1 .
  • All four test antibodies significantly increased IFN-g production within the cell culture supernatants in a dose- dependent manner (Fig. 8B).
  • the data shows that all four test antibodies provided could enhance IFN-g production in an allogeneic MLR when compared to hlgG1 .
  • clones Hu317, MH4 and MH8 were tested in the assay across a wide concentration range (Fig. 8C). This analysis demonstrated that both clones MH4 and MH8 retained fully overlapping concentration-dependent activity with Hu317 in a relevant human ex-vivo potency assay.
  • Heterogeneity analysis is used widely in the characterisation of monoclonal antibodies because it provides important information about product quality and uniformity. Heterogeneity can be caused by enzymatic post-translational modifications such as glycosylation, lysine truncation, oxidation or deamidation. Heterogeneity in IgGs is a manufacturing risk and can cause increased complexity in bioprocessing protocols.
  • the Protein Charge Variant Assay allows identification of basic and acidic protein variants relative to the dominant product peak.
  • the microfluidics chip technology resolves protein charge variants after fluorescent labelling.
  • the charge variant profiles for 09C06, MH4, MH8 MH12 and hu317 IgGs are depicted in Figure 9. All of mAbs 09C06, MH4, MH8 and MH12 display a highly homogeneous profile, with the main isoform comprising 77.4-82.8% of the total protein (Table 6). In contrast, however, Hu317 showed an unexpectedly more complex profile with 4 distinct peaks, a higher percentage of basic isoforms (23.1 %) and with the main isoform representing ⁇ 69% of total.
  • a protein’s DSC profile provides information about its total structural stability, via its thermal stability, but can also represent a structural‘fingerprint’ for assessing structural modifications.
  • the thermogram of an intact antibody could present two or three peaks, with the largest peak containing the contribution from the Fab fragment. Usually the first transition covers the unfolding of the CH2 domain, while the last one would include the unfolding of the CH3 domain.
  • the Fab unfolding could occur at a distinct temperature compared to the unfolding of CH2 and CH3 domains, but it is also possible that the Fab fragment unfolding‘buries’ the unfolding of either CH2 or CH3 domains, resulting in peak overlap.
  • the CH2 and CH3 domains should have comparable Tm, while the Fab’s Tm will vary from antibody to antibody.
  • All five IgGs tested (09C06, MH4, MH8, MH12 and Hu317) were fully compatible with DSC analysis and gave good resolution data (Fig. 10), presenting comparable sample homogeneity and cooperativity.
  • Figure 10A (09C06 IgG)
  • the first transition represents CFI2 domain unfolding
  • the second transition represents the unfolding of the Fab fragment
  • the third transition represents CFI3 domain unfolding.
  • the major Fab transition is lower, overlapping with the CFI2 domain (Fig. 10B-D).
  • Oxidation of exposed amino acid residues, such as tryptophan and methionine is a common degradation pathway for mAbs, altering their structural integrity with potential impact on their biological activity and heterogeneity.
  • forced oxidation using 0.5% FI202 for 2 hours at room temperature was applied to IgGs 09C06, MFI4, MFI8, MFI12 and Hu317.
  • SEC Size Exclusion
  • RP Reverse Phase
  • HIC Hydrophobic Interaction
  • HIC analysis - H202 treatment induced only a minor (0.4-0.6) minutes decrease in the retention on HIC for all 5 test articles, implying limited oxidation of exposed amino acids (Table 8).
  • clones MH4, MH8 and MH12 also exhibited very limited signals, with strongest signal for PD1 , but also had 2 potential new binding specificities: BNT2A1 (accession number NM 007049) and LSAMP (BC033803).
  • MH12 was the only clone to show any binding signal to BNT2A1 .
  • the plasmids encoding for CD20, PD1 , BTN2A1 , LSAMP, and ZS green only were used to perform transient transfection of the human cell line HEK293.
  • Transfected cells were then stained using Hu317, MH4, MH8, MH12 and Rituximab IgGs.
  • Rituximab and secondary only controls showed the expected strong, specific staining of PD1 -transfected cells but not ZS green-transfected (Fig. 1 1 ).
  • Hu317 IgG showed no binding to any cells other than PD1 -transfected cells, confirming the findings of the chip analyses, where this IgG was fully PD1 selective.
  • Rituximab positive control exhibited strong, specific staining of CD20-transfected cells and the negative control (secondary labelled antibody only) exhibited no binding to any cells (Fig. 1 1 ).
  • only clones MH8 and MH12 exhibited clear binding signal on both PD1 and LSAMP, but no binding of BTN2A1 , both in histogram analysis (Fig.
  • LSAMP is a cell surface receptor whose expression has been shown to be upregulated in specific tumour types such as Acute Myeloid Leukaemia (Coccaro, N. et al. Cancer Genetics 2015, 208(10):517-522) and may therefore be of value in co-targeting along with PD1 .
  • IgGs show high integrity before and after forced oxidation with 0.5% H202, measured by Size Exclusion (SEC), Reverse Phase (RP) and Hydrophobic Interaction (HIC)
  • DIVMTQSPDSLAVSLGERATINCKSSQSVTNDVAWYQQKPGQPPKLLINYAYHRFTGVPD RFSGSGYGTDFTLTISSLQAEDVAVYYCHQAYSTPYTFGQGTKLEIK (SEQ ID NO: 4)
  • VLFRPGSVRGINGSISLAVPLWLLAASLLCLLSKC SEQ ID NO: 415)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Animal Behavior & Ethology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/EP2019/055927 2018-03-08 2019-03-08 Pd1 binding agents Ceased WO2019170898A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
AU2019229676A AU2019229676A1 (en) 2018-03-08 2019-03-08 PD1 binding agents
SG11202008246VA SG11202008246VA (en) 2018-03-08 2019-03-08 Pd1 binding agents
CA3092174A CA3092174A1 (en) 2018-03-08 2019-03-08 Pd1 binding agents
EP19710389.8A EP3762419A1 (en) 2018-03-08 2019-03-08 Pd1 binding agents
JP2020542228A JP2021515541A (ja) 2018-03-08 2019-03-08 Pd1結合剤
CN201980017416.5A CN111819199A (zh) 2018-03-08 2019-03-08 Pd1结合剂
US16/912,023 US10858435B2 (en) 2018-03-08 2020-06-25 PD1 binding agents
IL277135A IL277135A (en) 2018-03-08 2020-09-03 Pd1 binding agent
US16/952,678 US20210101981A1 (en) 2018-03-08 2020-11-19 Pd1 binding agents

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
GB1803746.5 2018-03-08
GBGB1803746.5A GB201803746D0 (en) 2018-03-08 2018-03-08 PD1 binding agents
GB1813405.6 2018-08-16
GBGB1813405.6A GB201813405D0 (en) 2018-03-08 2018-08-16 PD1 binding agents

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US16/912,023 Continuation US10858435B2 (en) 2018-03-08 2020-06-25 PD1 binding agents

Publications (1)

Publication Number Publication Date
WO2019170898A1 true WO2019170898A1 (en) 2019-09-12

Family

ID=61972796

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2019/055927 Ceased WO2019170898A1 (en) 2018-03-08 2019-03-08 Pd1 binding agents

Country Status (10)

Country Link
US (2) US10858435B2 (https=)
EP (1) EP3762419A1 (https=)
JP (1) JP2021515541A (https=)
CN (1) CN111819199A (https=)
AU (1) AU2019229676A1 (https=)
CA (1) CA3092174A1 (https=)
GB (2) GB201803746D0 (https=)
IL (1) IL277135A (https=)
SG (1) SG11202008246VA (https=)
WO (1) WO2019170898A1 (https=)

Cited By (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10858434B2 (en) 2018-03-08 2020-12-08 Ultrahuman Eight Limited PD1 binding agents
US12312405B2 (en) 2020-05-26 2025-05-27 Boehringer Ingelheim International Gmbh Anti-PD-1 antibodies
US12479920B2 (en) 2019-10-11 2025-11-25 Ottimo Pharma Limited PD1 and VEGFR2 dual-binding agents

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EA034666B1 (ru) 2013-09-13 2020-03-04 Бейджин Свитзерланд Гмбх Антитело против pd-1 и его применение для лечения рака или вирусной инфекции и фрагмент антитела
TWI726608B (zh) 2014-07-03 2021-05-01 英屬開曼群島商百濟神州有限公司 抗pd-l1抗體及其作為治療及診斷之用途
US10864203B2 (en) 2016-07-05 2020-12-15 Beigene, Ltd. Combination of a PD-1 antagonist and a RAF inhibitor for treating cancer
PT3500299T (pt) 2016-08-19 2024-02-21 Beigene Switzerland Gmbh Combinação de zanubrutinib com um anticorpo anti-cd20 ou anti-pd-1 para utilização no tratamento do cancro
EP3573989A4 (en) 2017-01-25 2020-11-18 Beigene, Ltd. CRYSTALLINE FORMS OF (S) -7- (1- (BUT-2-YNOYL) PIPERIDIN-4-YL) -2- (4-PHENOXYPHENYL) -4, 5, 6, 7-TETRAHY DROPYRAZOLO [1, 5-A ] PYRIMIDINE-3-CARBOXAMIDE, PREPARATION AND ASSOCIATED USES
TW202515616A (zh) 2017-06-26 2025-04-16 英屬開曼群島商百濟神州有限公司 抗pd-1抗體或其抗原結合片段在製備治療用於患有肝細胞癌(hcc)之藥物的用途
CN111801334B (zh) 2017-11-29 2023-06-09 百济神州瑞士有限责任公司 使用包含btk抑制剂的组合治疗惰性或侵袭性b-细胞淋巴瘤
AU2020366257B2 (en) * 2019-10-15 2025-01-23 Diverse Biotech, Inc. Conjugate molecules

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006121168A1 (en) * 2005-05-09 2006-11-16 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics
US8735553B1 (en) * 2013-09-13 2014-05-27 Beigene, Ltd. Anti-PD1 antibodies and their use as therapeutics and diagnostics
EP3081576A1 (en) * 2013-12-12 2016-10-19 Shanghai Hengrui Pharmaceutical Co. Ltd. Pd-1 antibody, antigen-binding fragment thereof, and medical application thereof
WO2017055404A1 (en) * 2015-10-02 2017-04-06 F. Hoffmann-La Roche Ag Bispecific antibodies specific for pd1 and tim3

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB201803745D0 (en) 2018-03-08 2018-04-25 Ultrahuman Eight Ltd PD1 binding agents

Patent Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006121168A1 (en) * 2005-05-09 2006-11-16 Ono Pharmaceutical Co., Ltd. Human monoclonal antibodies to programmed death 1(pd-1) and methods for treating cancer using anti-pd-1 antibodies alone or in combination with other immunotherapeutics
US8735553B1 (en) * 2013-09-13 2014-05-27 Beigene, Ltd. Anti-PD1 antibodies and their use as therapeutics and diagnostics
US20150079109A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-PD1 Antibodies and their Use as Therapeutics and Diagnostics
WO2015035606A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-pd1 antibodies and their use as therapeutics and diagnostics
EP3081576A1 (en) * 2013-12-12 2016-10-19 Shanghai Hengrui Pharmaceutical Co. Ltd. Pd-1 antibody, antigen-binding fragment thereof, and medical application thereof
WO2017055404A1 (en) * 2015-10-02 2017-04-06 F. Hoffmann-La Roche Ag Bispecific antibodies specific for pd1 and tim3

Non-Patent Citations (13)

* Cited by examiner, † Cited by third party
Title
BAGSHAWE K.D. ET AL., ANTIBODY, IMMUNOCONJUGATES AND RADIOPHARMACEUTICALS, vol. 4, 1991, pages 915 - 922
COCCARO, N. ET AL., CANCER GENETICS, vol. 208, no. 10, 2015, pages 517 - 522
FINLAY ET AL., METHODS MOL BIOL, vol. 681, 2011, pages 383 - 401
FINLAY WILLIAM J J ET AL: "Anti-PD1 'SHR-1210' aberrantly targets pro-angiogenic receptors and this polyspecificity can be ablated by paratope refinement.", MABS 01 2019, vol. 11, no. 1, January 2019 (2019-01-01), pages 26 - 44, XP002791570, ISSN: 1942-0870 *
HENIKOFF; HENIKOFF, PNAS, vol. 89, 1992, pages 10915 - 10919
HOLLIGER; HUDSON, NATURE BIOTECHNOL., vol. 23, no. 9, 2005, pages 1126 - 1136
LEDERMANN J.A. ET AL., INT. J. CANCER, vol. 47, 1991, pages 659 - 664
NELSON ET AL., NAT REV DRUG DISCOV, vol. 9, 2010, pages 767 - 774
PHYSICIAN'S DESK REFERENCE, 2003
SWINDELLS ET AL.: "abYsis: Integrated Antibody Sequence and Structure-Management", ANALYSIS, AND PREDICTION. J MOL BIOL., 2016
TOWNSEND ET AL., PNAS, vol. 112, 2015, pages 15354 - 15359
WARD ET AL., THERAP. IMMUNOL., vol. 2, 1995, pages 77 - 94
ZHOU ET AL., NATURE PROTOCOLS, vol. 1, 2016, pages 1318 - 1321

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10858434B2 (en) 2018-03-08 2020-12-08 Ultrahuman Eight Limited PD1 binding agents
US11851460B2 (en) 2018-03-08 2023-12-26 Ultrahuman Eight Limited PD1 binding agents
US12479920B2 (en) 2019-10-11 2025-11-25 Ottimo Pharma Limited PD1 and VEGFR2 dual-binding agents
US12312405B2 (en) 2020-05-26 2025-05-27 Boehringer Ingelheim International Gmbh Anti-PD-1 antibodies

Also Published As

Publication number Publication date
US20200332006A1 (en) 2020-10-22
JP2021515541A (ja) 2021-06-24
IL277135A (en) 2020-10-29
GB201803746D0 (en) 2018-04-25
US20210101981A1 (en) 2021-04-08
CN111819199A (zh) 2020-10-23
SG11202008246VA (en) 2020-09-29
US10858435B2 (en) 2020-12-08
CA3092174A1 (en) 2019-09-12
EP3762419A1 (en) 2021-01-13
AU2019229676A1 (en) 2020-08-20
GB201813405D0 (en) 2018-10-03

Similar Documents

Publication Publication Date Title
US12173067B2 (en) C-KIT antibodies and method for treating cancer with such
US10858435B2 (en) PD1 binding agents
EP3774886A1 (en) Cd47 binding agents
US12415861B2 (en) Anti C-MET antibodies
US11851460B2 (en) PD1 binding agents
AU2020365021A1 (en) PD1 and VEGFR2 dual-binding agents
EP3765156A1 (en) De-immunised anti-erbb3 antibodies
US11655300B2 (en) Colony stimulating factor 1 receptor (CSF1R) antibodies and immunoconjugates thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19710389

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2020542228

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019229676

Country of ref document: AU

Date of ref document: 20190308

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3092174

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2019710389

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2019710389

Country of ref document: EP

Effective date: 20201008

WWW Wipo information: withdrawn in national office

Ref document number: 277135

Country of ref document: IL