WO2019161290A1 - Engineered cas9 systems for eukaryotic genome modification - Google Patents
Engineered cas9 systems for eukaryotic genome modification Download PDFInfo
- Publication number
- WO2019161290A1 WO2019161290A1 PCT/US2019/018335 US2019018335W WO2019161290A1 WO 2019161290 A1 WO2019161290 A1 WO 2019161290A1 US 2019018335 W US2019018335 W US 2019018335W WO 2019161290 A1 WO2019161290 A1 WO 2019161290A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- sequence
- engineered
- cell
- protein
- cas9 protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
- C12N15/102—Mutagenizing nucleic acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases [RNase]; Deoxyribonucleases [DNase]
- C12N9/222—Clustered regularly interspaced short palindromic repeats [CRISPR]-associated [CAS] enzymes
- C12N9/226—Class 2 CAS enzyme complex, e.g. single CAS protein
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/09—Fusion polypeptide containing a localisation/targetting motif containing a nuclear localisation signal
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/10—Fusion polypeptide containing a localisation/targetting motif containing a tag for extracellular membrane crossing, e.g. TAT or VP22
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/85—Fusion polypeptide containing an RNA binding domain
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y301/00—Hydrolases acting on ester bonds (3.1)
- C12Y301/21—Endodeoxyribonucleases producing 5'-phosphomonoesters (3.1.21)
- C12Y301/21001—Deoxyribonuclease I (3.1.21.1)
Definitions
- P18_023PCT_SL.txt is 370,305 bytes in size.
- the present disclosure relates to engineered Cas9 systems, nucleic acids encoding said systems, and methods of using said systems for genome modification.
- CRISPR Regularly Interspaced Short Palindromic Repeats
- Cas CRISPR-associated CRISPR/Cas systems as genome editing tools
- HDR homology- directed repair
- base editors such as dCas9/cytidine deaminase and dCas9/adenosine deaminase often requires a precise DNA binding position, even at the single base pair resolution, to achieve an optimal editing outcome. Therefore, there is a need to develop new CRISPR/Cas systems that use novel PAMs for targeting to increase genome coverage density.
- engineered Cas9 systems comprising engineered Cas9 proteins and engineered guide RNAs, wherein each engineered guide RNA is designed to complex with an engineered Cas9 protein and the engineered guide RNA comprises a 5’ guide sequence designed to hybridize with a target sequence in a double-stranded sequence, wherein the target sequence is 5’ to a protospacer adjacent motif (PAM) and the PAM has a sequence as listed in Table A.
- PAM protospacer adjacent motif
- Another aspect of the present disclosure encompasses a plurality of nucleic acids encoding said engineered Cas9 systems and at least one vector comprising the plurality of said nucleic acids.
- a further aspect includes eukaryotic cells comprising at least one engineered Cas9 system and/or at least one nucleic acid encoding said engineered Cas9 system.
- Still another aspect of the present disclosure encompasses methods for modifying chromosomal sequences in eukaryotic cells.
- the methods comprise introducing into the eukaryotic cell at least one engineered Cas9 system comprising an engineered Cas9 protein and an engineered guide RNA and/or at least one nucleic acid encoding said engineered Cas9 system and, optionally, at least one donor polynucleotide, wherein the at least one engineered guide RNA guides the at least one engineered Cas9 protein to the target site in the chromosomal sequence such that modification of the chromosomal sequence occurs.
- FIG. 1 shows the WebLogo analysis of protospacer adjacent motifs (PAM) required for in vitro target DNA cleavage by Cas9 orthologs. Numbers on the horizontal axis indicate the position of the nucleotide in the PAM sequence.
- PAM protospacer adjacent motifs
- FIG. 2A presents the cleavage efficiency (as the percent of indels) of McaCas9, McaCas9-FIN1 FIB1 fusion (i.e., FIMGN1 at the amino terminus and
- FIMGB1 box A at the carboxyl terminus FIMGB1 box A at the carboxyl terminus
- McaCas9-FIN1 FU G fusion i.e., FIMGN1 at the amino terminus and histone H 1 central globular motif at the carboxyl terminus.
- FIG. 2B presents the cleavage efficiency (as the percent of indels) of PexCas9, PexCas9-FIN1 HB1 fusion (i.e., FIMGN1 at the amino terminus and FIMGB1 box A at the carboxyl terminus), and PexCas9-FIN1 FU G fusion (i.e., FIMGN1 at the amino terminus and histone FH 1 central globular motif at the carboxyl terminus).
- FIG. 2C presents the cleavage efficiency (as the percent of indels) of BsmCas9, BsmCas9-FIN1 FIB1 fusion (i.e., FIMGN1 at the amino terminus and
- FIMGB1 box A at the carboxyl terminus FIMGB1 box A at the carboxyl terminus
- BsmCas9-FIN1 FU G fusion i.e., FIMGN1 at the amino terminus and histone F11 central globular motif at the carboxyl terminus.
- FIG. 2D presents the cleavage efficiency (as the percent of indels) of LrhCas9, LrhCas9-FIN1 FIB1 fusion (i.e., FIMGN1 at the amino terminus and FIMGB1 box A at the carboxyl terminus), and LrhCas9-FIN1 F11 G fusion (i.e., FIMGN1 at the amino terminus and histone F11 central globular motif at the carboxyl terminus).
- the present disclosure provides orthologous Cas9 systems that use alternate PAMs for target DNA binding, thereby increasing genome coverage density.
- some of these alternate PAMs comprise A and/or T residues, and other alternate PAMS are GC-rich.
- the engineered Cas9 systems that utilize these alternate PAMs enable targeted genome editing or genome modification of previously inaccessible genomic loci.
- One aspect of the present disclosure provides engineered Cas9 systems comprising engineered Cas9 proteins and engineered guide RNAs, wherein each engineered guide RNA is designed to complex with a specific engineered Cas9 protein.
- Each engineered guide RNA comprises a 5’ guide sequence designed to hybridize with a target sequence in a double-stranded sequence, wherein the target sequence is 5’ to a protospacer adjacent motif (PAM) and the PAM has a sequence as listed in Table A.
- PAM protospacer adjacent motif
- the engineered Cas9 protein comprises at least one amino acid substitution, insertion, or deletion relative to its wild-type counterpart.
- Cas9 protein is the single effector protein in type II CRISPR systems, which are present in various bacteria.
- the engineered Cas9 protein disclosed herein can be from Acaryochloris sp., Acetohalobium sp., Acidaminococcus sp., Acidithiobacillus sp., Acidothermus sp., Akkermansia sp., Alicyclobacillus sp., Allochromatium sp., Ammonifex sp., Anabaena sp., Arthrospira sp., Bacillus sp., Bifidobacterium sp., Burkholderiales sp.,
- Caldiculosiruptor sp. Campylobacter sp., Candidates sp., Clostridium sp., Corynebacterium sp., Crocosphaera sp., Cyanothece sp., Exiguobacterium sp.,
- Streptococcus sp. Streptomyces sp., Streptosporangium sp., Synechococcus sp., Thermosipho sp., Verrucomicrobia sp., and Wolinella sp.
- the engineered Cas9 protein disclosed herein is from Acidothermus sp., Akkermansia sp., Alicyclobacillus sp., Bacillus sp., Bifidobacterium sp., Burkholderiales sp., Corynebacterium sp., Lactobacillus sp., Mycoplasma sp., Nitratifractor sp., Oenococcus sp., Parasutterella sp., Ralstonia sp., or Wolinella sp.
- the engineered Cas9 protein disclosed herein is from Acidothermus cellulolyticus (Ace), Akkermansia glycaniphila (Agl), Akkermansia muciniphila (Amu), Alicyclobacillus hesperidum (Ahe), Bacillus smithii (Bsm), Bifidobacterium bombi (Bbo), Corynebacterium diphtheria (Cdi), Lactobacillus rhamnosus (Lrh), Mycoplasma canis (Mca), Mycoplasma gallisepticum (Mga),
- Nitratifractor salsuginis Na
- Oenococcus kitaharae Oki
- Wild-type Cas9 proteins comprise two nuclease domains, i.e.,
- Cas9 proteins also comprise REC domains that interact with the guide RNA (e.g., REC1 , REC2) or the RNA/DNA heteroduplex (e.g., REC3), and a domain that interacts with the protospacer-adjacent motif (PAM) (i.e., PAM-interacting domain).
- REC domains that interact with the guide RNA (e.g., REC1 , REC2) or the RNA/DNA heteroduplex (e.g., REC3)
- PAM protospacer-adjacent motif
- the Cas9 protein can be engineered to comprise one or more modifications (i.e., a substitution of at least one amino acid, a deletion of at least one amino acid, an insertion of at least one amino acid) such that the Cas9 protein has altered activity, specificity, and/or stability.
- Cas9 protein can be engineered by one or more mutations and/or deletions to inactivate one or both of the nuclease domains.
- Inactivation of one nuclease domain generates a Cas9 protein that cleaves one strand of a double-stranded sequence (i.e., a Cas9 nickase).
- the RuvC domain can be inactivated by mutations such as D10A, D8A, E762A, and/or D986A
- the HNH domain can be inactivated by mutations such as H840A, H559A, N854A, N856A, and/or N863A (with reference to the numbering system of Streptococcus pyogenes Cas9, SpyCas9).
- Inactivation of both nuclease domains generates a Cas9 protein having no cleavage activity (i.e., a catalytically inactive or dead Cas9).
- the Cas9 protein can also be engineered by one or more amino acid substitutions, deletions, and/or insertions to have improved targeting specificity, improved fidelity, altered PAM specificity, decreased off-target effects, and/or increased stability.
- Non-limiting examples of one or more mutations that improve targeting specificity, improve fidelity, and/or decrease off-target effects include N497A, R661 A, Q695A, K810A, K848A, K855A, Q926A, K1003A, R1060A, and/or D1135E (with reference to the numbering system of SpyCas9).
- the Cas9 protein can be engineered to comprise at least one heterologous domain, i.e., Cas9 is fused to one or more heterologous domains.
- the two or more heterologous domains can be the same or they can be different.
- the one or more heterologous domains can be fused to the N terminal end, the C terminal end, an internal location, or combination thereof.
- the fusion can be direct via a chemical bond, or the linkage can be indirect via one or more linkers.
- the heterologous domain can be a nuclear localization signal, a cell-penetrating domain, a marker domain, a chromatin disrupting domain, an epigenetic modification domain (e.g ., a cytidine deaminase domain, a histone acetyltransferase domain, and the like), a transcriptional regulation domain, an RNA aptamer binding domain, or a non-Cas9 nuclease domain.
- the one or more heterologous domains can be a nuclear localization signal (NLS).
- nuclear localization signals include PKKKRKV (SEQ ID NO:78), PKKKRRV (SEQ ID NO:79),
- KRPAATKKAGQAKKKK (SEQ ID NO:80), YGRKKRRQRRR (SEQ ID NO:81 ),
- RKKRRQRRR (SEQ ID NO:82), PAAKRVKLD (SEQ ID NO:83), RQRRNELKRSP (SEQ ID NO:84), VSRKRPRP (SEQ ID NO:85), PPKKARED (SEQ ID NO:86), PQPKKKPL (SEQ ID NO:87), SALIKKKKKMAP (SEQ ID NO:88), PKQKKRK (SEQ ID NO:89), RKLKKKIKKL (SEQ ID NO:90), REKKKFLKRR (SEQ ID NO:91 ),
- KRKG D EVD GVD EVAKKKS KK (SEQ ID NO:92), RKCLQAGMNLEARKTKK (SEQ ID NO:93), NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO:94), and RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO:95).
- the one or more heterologous domains can be a cell-penetrating domain.
- suitable cell-penetrating domains include, without limit, GRKKRRQRRRPPQPKKKRKV (SEQ ID NO:96),
- PLSSIFSRIGDPPKKKRKV (SEQ ID NO:97), GALFLGWLGAAGSTMGAPKKKRKV (SEQ ID NO:98), GALFLGFLGAAGSTMGAWSQPKKKRKV (SEQ ID NO:99),
- the one or more heterologous domains can be a marker domain.
- Marker domains include fluorescent proteins and purification or epitope tags. Suitable fluorescent proteins include, without limit, green fluorescent proteins (e.g., GFP, eGFP, GFP-2, tagGFP, turboGFP, Emerald, Azami Green,
- Monomeric Azam i Green, CopGFP, AceGFP, ZsGreenl yellow fluorescent proteins (e.g., YFP, EYFP, Citrine, Venus, YPet, PhiYFP, ZsYellowl ), blue fluorescent proteins (e.g., BFP, EBFP, EBFP2, Azurite, mKalamal , GFPuv, Sapphire, T-sapphire), cyan fluorescent proteins ⁇ e.g., ECFP, Cerulean, CyPet, AmCyanl , Midoriishi-Cyan), red fluorescent proteins (e.g., mKate, mKate2, mPlum, DsRed monomer, mCherry, mRFP1 , DsRed-Express, DsRed2, DsRed-Monomer, HcRed-Tandem, HcRedl , AsRed2, eqFP611 , mRasberry, mStraw
- the marker domain can comprise tandem repeats of one or more fluorescent proteins ⁇ e.g., Suntag).
- suitable purification or epitope tags include 6xHis (SEQ ID NO: 134), FLAG ® , HA, GST, Myc, SAM, and the like.
- heterologous fusions which facilitate detection or enrichment of CRISPR complexes include streptavidin (Kipriyanov et al. , Human Antibodies, 1995, 6(3):93-101.), avidin (Airenne et al. , Biomolecular Engineering, 1999, 16(1 -4):87-92), monomeric forms of avidin (Laitinen et al., Journal of Biological
- the one or more heterologous domain can be a chromatin modulating motif (CMM).
- CMMs include nucleosome interacting peptides derived from high mobility group (HMG) proteins (e.g., HMGB1 , HMGB2, HMGB3, HMGN1 , HMGN2, HMGN3a, HMGN3b, HMGN4, and HMGN5 proteins), the central globular domain of histone H1 variants (e.g., histone H1.0, H1.1 , H1.2, H1.3, H1.4, H1.5, H1.6, H1.7, H1.8, H1.9, and H.1.10), or DNA binding domains of chromatin remodeling complexes (e.g., SWI/SNF (SWItch/Sucrose Non-Fermentable), ISWI (Imitation Switch).
- HMG high mobility group
- CHD Chromodomain-Helicase-DNA binding
- Mi-2/NuRD Nucleosome Remodeling and Deacetylase
- INO80 SWR1
- RSC Retriel-Coupled Device
- CMMs can be from humans, animals (/.e., vertebrates and invertebrates), plants, algae, or yeast. Non-limiting examples of specific CMMs are listed in the table below.
- the one or more heterologous domains can be an epigenetic modification domain.
- suitable epigenetic modification domains include those with DNA deamination (e.g ., cytidine deaminase, adenosine deaminase, guanine deaminase), DNA methyltransferase activity (e.g., cytosine methyltransferase), DNA demethylase activity, DNA amination, DNA oxidation activity, DNA helicase activity, histone acetyltransferase (HAT) activity (e.g., HAT domain derived from E1A binding protein p300), histone deacetylase activity, histone methyltransferase activity, histone demethylase activity, histone kinase activity, histone phosphatase activity, histone ubiquitin ligase activity, histone deubiquitinating activity, histone adeny
- DNA deamination e.g .,
- the epigenetic modification domain can comprise cytidine deaminase activity, adenosine deaminase activity, histone acetyltransferase activity, or DNA methyltransferase activity.
- the one or more heterologous domains can be a transcriptional regulation domain (i.e., a transcriptional activation domain or transcriptional repressor domain).
- Suitable transcriptional activation domains include, without limit, herpes simplex virus VP16 domain, VP64 (i.e., four tandem copies of VP16), VP160 (i.e., ten tandem copies of VP16), NFKB p65 activation domain (p65) , Epstein-Barr virus R transactivator (Rta) domain, VPR (i.e., VP64+p65+Rta), p300- dependent transcriptional activation domains, p53 activation domains 1 and 2, heat- shock factor 1 (HSF1 ) activation domains, Smad4 activation domains (SAD), cAMP response element binding protein (CREB) activation domains, E2A activation domains, nuclear factor of activated T-cells (NFAT) activation domains, or combinations thereof.
- Non-limiting examples of suitable transcriptional repressor domains include Kruppel- associated box (KRAB) repressor domains, Mxi repressor domains, inducible cAMP early repressor (ICER) domains, YY1 glycine rich repressor domains, Sp1 -like repressors, E(spl) repressors, IKB repressors, Sin3 repressors, methyl-CpG binding protein 2 (MeCP2) repressors, or combinations thereof.
- KRAB Kruppel- associated box
- Mxi repressor domains inducible cAMP early repressor domains
- YY1 glycine rich repressor domains Sp1 -like repressors
- E(spl) repressors E(spl) repressors
- IKB repressors IKB repressors
- Sin3 repressors Sin3
- the one or more heterologous domains can be an RNA aptamer binding domain (Konermann et ai, Nature, 2015, 517(7536):583- 588; Zalatan et ai, Cell, 2015, 160(1 -2):339-50).
- RNA aptamer protein domains examples include MS2 coat protein (MCP), PP7 bacteriophage coat protein (PCP), Mu bacteriophage Com protein, lambda bacteriophage N22 protein, stem-loop binding protein (SLBP), Fragile X mental retardation syndrome-related protein 1 (FXR1 ), proteins derived from bacteriophage such as AP205, BZ13, f 1 , f2, fd, fr, ID2, JP34/GA, JP501 , JP34, JP500, KU1 , M1 1 , M12, MX1 , NL95, PP7, (
- MCP MS2 coat protein
- PCP PP7 bacteriophage coat protein
- the one or more heterologous domains can be a non-Cas9 nuclease domain.
- Suitable nuclease domains can be obtained from any endonuclease or exonuclease.
- Non-limiting examples of endonucleases from which a nuclease domain can be derived include, but are not limited to, restriction endonucleases and homing endonucleases.
- the nuclease domain can be derived from a type ll-S restriction endonuclease. Type ll-S
- endonucleases cleave DNA at sites that are typically several base pairs away from the recognition/binding site and, as such, have separable binding and cleavage domains. These enzymes generally are monomers that transiently associate to form dimers to cleave each strand of DNA at staggered locations.
- suitable type ll-S endonucleases include Bfil, Bpml, Bsal, Bsgl, BsmBI, Bsml, BspMI, Fokl, Mboll, and Sapl.
- the nuclease domain can be a Fokl nuclease domain or a derivative thereof.
- the type ll-S nuclease domain can be modified to facilitate dimerization of two different nuclease domains.
- the cleavage domain of Fokl can be modified by mutating certain amino acid residues.
- amino acid residues at positions 446, 447, 479, 483, 484, 486, 487, 490, 491 , 496, 498, 499, 500, 531 , 534, 537, and 538 of Fokl nuclease domains are targets for modification.
- the Fokl nuclease domain can comprise a first Fokl half- domain comprising Q486E, I499L, and/or N496D mutations, and a second Fokl half-domain comprising E490K, I538K, and/or FI537R mutations.
- the one or more heterologous domains can be linked directly to the Cas9 protein via one or more chemical bonds (e.g., covalent bonds), or the one or more heterologous domains can be linked indirectly to the Cas9 protein via one or more linkers.
- chemical bonds e.g., covalent bonds
- a linker is a chemical group that connects one or more other chemical groups via at least one covalent bond.
- Suitable linkers include amino acids, peptides, nucleotides, nucleic acids, organic linker molecules (e.g., maleimide derivatives, N-ethoxybenzylimidazole, biphenyl-3, 4', 5-tricarboxylic acid, p- aminobenzyloxycarbonyl, and the like), disulfide linkers, and polymer linkers (e.g.,
- the linker can include one or more spacing groups including, but not limited to alkylene, alkenylene, alkynylene, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, aralkyl, aralkenyl, aralkynyl and the like.
- the linker can be neutral, or carry a positive or negative charge.
- the linker can be cleavable such that the linker's covalent bond that connects the linker to another chemical group can be broken or cleaved under certain conditions, including pH, temperature, salt concentration, light, a catalyst, or an enzyme.
- the linker can be a peptide linker.
- the peptide linker can be a flexible amino acid linker (e.g., comprising small, non-polar or polar amino acids).
- flexible linkers include LEGGGS (SEQ ID NO: 108), TGSG (SEQ ID NO:109), GGSGGGSG (SEQ ID NO:110), (GGGGS)I -4 (SEQ ID NO: 108), TGSG (SEQ ID NO:109), GGSGGGSG (SEQ ID NO:110), (GGGGS)I -4 (SEQ ID NO: 108), TGSG (SEQ ID NO:109), GGSGGGSG (SEQ ID NO:110), (GGGGS)I -4 (SEQ ID
- the peptide linker can be a rigid amino acid linker.
- linkers include (EAAAK)I -4 (SEQ ID NO: 1 13), A(EAAAK)2-sA (SEQ ID NO:114), PAPAP (SEQ ID NO:115), and (AP)e-e (SEQ ID NO:116). Additional examples of suitable linkers are well known in the art and programs to design linkers are readily available (Crasto et al., Protein Eng., 2000, 13(5):309-312).
- the engineered Cas9 proteins can be produced recombinantly in cell-free systems, bacterial cells, or eukaryotic cells and purified using standard purification means.
- the engineered Cas9 proteins are produced in vivo in eukaryotic cells of interest from nucleic acids encoding the engineered Cas9 proteins (see section (II) below).
- the engineered Cas9 protein comprises nuclease or nickase activity
- the engineered Cas9 protein can further comprise at least one nuclear localization signal, cell-penetrating domain, and/or marker domain, as well as at least one chromatin disrupting domain.
- the engineered Cas9 protein is linked to an epigenetic modification domain
- the engineered Cas9 protein can further comprise at least one nuclear localization signal, cell-penetrating domain, and/or marker domain, as well as at least one chromatin disrupting domain.
- the engineered Cas9 protein can further comprise at least one nuclear localization signal, cell-penetrating domain, and/or marker domain, as well as at least one chromatin disrupting domain and/or at least one RNA aptamer binding domain.
- the engineered Cas9 protein is from Bacillus smithii, Lactobacillus rhamnosus, Parasutterella excrementihominis,
- Mycoplasma canis Mycoplasma gallisepticum, Akkermansia glycaniphila, Akkermansia muciniphila, Oenococcus kitaharae, Bifidobacterium bombi, Acidothermus cellulolyticus, Alicyclobacillus hesperidum, Wolinella sued nogenes, Nitratifractor salsuginis, Ralstonia syzygii, or Cory nebacteri urn diphtheria and is linked to at least one NLS.
- the engineered Cas9 protein can have at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30.
- the engineered Cas9 protein can have at least about 95% sequence identity to SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30.
- the engineered Cas9 protein has the amino acid sequence of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30.
- the engineered Cas9 protein can be a Bacillus smithii, Lactobadllus rhamnosus, Parasutterella excrementihominis,
- Mycoplasma canis Mycoplasma gallisepticum, Akkermansia glycaniphila, Akkermansia mudniphila, Oenococcus kitaharae, Bifidobaderium bombi, Acidothermus cellulolyticus, Alicyclobadllus hesperidum, Wolinella sued nogenes, Nitratifractor salsuginis, Ralstonia syzygii, or Cory nebacteri urn diphtheria Cas9 protein linked to at least one chromatin modulating motif (CMM).
- CMM chromatin modulating motif
- the Cas9-CMM fusion protein can further comprise at least one NLS.
- the Cas9-CMM fusion protein can have at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to SEQ ID NO: 117, 118, 119, 1200, 121 , 122,
- the Cas9-CMM fusion protein can have at least about 95% sequence identity to SEQ ID NO: 117, 118, 119, 120, 121 , 122, 123, or 124. In specific iterations, the Cas9-CMM fusion protein has the amino acid sequence of SEQ ID NO:117, 118, 119, 120, 121 , 122, 123, or 124.
- the engineered guide RNAs is designed to complex with a specific engineered Cas9 protein.
- a guide RNA comprises (i) a CRISPR RNA (crRNA) that contains a guide sequence at the 5’ end that hybridizes with a target sequence and (ii) a transacting crRNA (tracrRNA) sequence that recruits the Cas9 protein.
- the crRNA guide sequence of each guide RNA is different (i.e., is sequence specific).
- the tracrRNA sequence is generally the same in guide RNAs designed to complex with a Cas9 protein from a particular bacterial species.
- the crRNA guide sequence is designed to hybridize with a target sequence (i.e., protospacer) in a double-stranded sequence.
- a target sequence i.e., protospacer
- the complementarity between the crRNA and the target sequence is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99%. In specific embodiments, the complementarity is complete (i.e., 100%).
- the length of the crRNA guide sequence can range from about 15 nucleotides to about 25 nucleotides. For example, the crRNA guide sequence can be about 15, 16, 17, 18, 19, 20, 21 , 22,
- the crRNA is about 19, 20, or 21 nucleotides in length. In one embodiment, the crRNA guide sequence has a length of 20 nucleotides.
- the guide RNA comprises repeat sequence that forms at least one stem loop structure, which interacts with the Cas9 protein, and 3’ sequence that remains single-stranded.
- the length of each loop and stem can vary.
- the loop can range from about 3 to about 10 nucleotides in length
- the stem can range from about 6 to about 20 base pairs in length.
- the stem can comprise one or more bulges of 1 to about 10 nucleotides.
- the length of the single-stranded 3’ region can vary.
- the tracrRNA sequence in the engineered guide RNA generally is based upon the coding sequence of wild type tracrRNA in the bacterial species of interest.
- the wild- type sequence can be modified to facilitate secondary structure formation, increased secondary structure stability, facilitate expression in eukaryotic cells, and so forth.
- one or more nucleotide changes can be introduced into the guide RNA coding sequence (see Example 3, below).
- the tracrRNA sequence can range in length from about 50 nucleotides to about 300 nucleotides.
- the tracrRNA can range in length from about 50 to about 90 nucleotides, from about 90 to about 1 10 nucleotides, from about 1 10 to about 130 nucleotides, from about 130 to about 150 nucleotides, from about 150 to about 170 nucleotides, from about 170 to about 200 nucleotides, from about 200 to about 250 nucleotides, or from about 250 to about 300 nucleotides.
- the engineered guide RNA is a single molecule (/.e. , a single guide RNA or sgRNA), wherein the crRNA sequence is linked to the tracrRNA sequence.
- the engineered guide RNA can be two separate molecules.
- a first molecule comprising the crRNA that contains 3’ sequence (comprising from about 6 to about 20 nucleotides) that is capable of base pairing with the 5’ end of a second molecule, wherein the second molecule comprises the tracrRNA that contains 5’ sequence (comprising from about 6 to about 20 nucleotides) that is capable of base pairing with the 3’ end of the first molecule.
- the tracrRNA sequence of the engineered guide RNA can be modified to comprise one or more aptamer sequences (Konermann et al., Nature, 2015, 517(7536):583-588; Zalatan et al., Cell, 2015, 160(1 -2):339-50).
- Suitable aptamer sequences include those that bind adaptor proteins chosen from MCP, PCP, Com, SLBP, FXR1 , AP205, BZ13, f1 , f2, fd, fr, ID2, JP34/GA, JP501 , JP34, JP500, KU1 , M1 1 , M12, MX1 , NL95, PP7, (
- the length of the aptamer sequence can vary.
- the guide RNA can further comprise at least one detectable label.
- the detectable label can be a fluorophore (e.g., FAM, TMR, Cy3, Cy5, Texas Red, Oregon Green, Alexa Fluors, Flalo tags, or suitable fluorescent dye), a detection tag (e.g., biotin, digoxigenin, and the like), quantum dots, or gold particles.
- the guide RNA can comprise standard ribonucleotides and/or modified ribonucleotides. In some embodiment, the guide RNA can comprise standard or modified deoxyribonucleotides. In embodiments in which the guide RNA is enzymatically synthesized (/.e., in vivo or in vitro), the guide RNA generally comprises standard ribonucleotides. In embodiments in which the guide RNA is chemically synthesized, the guide RNA can comprise standard or modified ribonucleotides and/or deoxyribonucleotides.
- Modified ribonucleotides and/or deoxyribonucleotides include base modifications (e.g ., pseudouridine, 2-thiouridine, N6-methyladenosine, and the like) and/or sugar modifications (e.g., 2’-0-methy, 2’-fluoro, 2’-amino, locked nucleic acid (LNA), and so forth).
- the backbone of the guide RNA can also be modified to comprise phosphorothioate linkages, boranophosphate linkages, or peptide nucleic acids.
- the engineered guide RNA has at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to SEQ ID NO:31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, or 45.
- the engineered Cas9 guide RNA has the sequence of SEQ ID NO:31 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, or 45.
- the PAM sequences preferred by the engineered Cas9 systems were identified in vitro using a library of degenerate PAMS (see Example 1 and FIG. 1), and confirmed by sequencing after genome editing experiments (see Example 2).
- the PAM for each of the engineered Cas9 system disclosed herein is presented in Table A, below.
- a further aspect of the present disclosure provides nucleic acids encoding the engineered Cas9 systems described above in section (I).
- the systems can be encoded by single nucleic acids or multiple nucleic acids.
- the nucleic acids can be DNA or RNA, linear or circular, single-stranded or double-stranded.
- the RNA or DNA can be codon optimized for efficient translation into protein in the eukaryotic cell of interest. Codon optimization programs are available as freeware or from commercial sources.
- nucleic acid encodes a protein having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to the amino acid sequence of SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, or 30.
- the nucleic acid encoding the engineered Cas9 protein can have at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to the DNA sequence of SEQ ID NO: 1 , 3, 5, 7, 9, 11 , 13, 15, 17, 19, 21 , 23, 25, 27, or 29.
- the DNA encoding the engineered Cas9 protein has the DNA sequence of SEQ ID NO: 1 , 3, 5, 7, 9, 11 , 13, 15, 17, 19, 21 , 23, 25, 27, or 29.
- the nucleic acid encodes a protein having at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% sequence identity to the amino acid sequence of SEQ ID NO:117, 118, 119, 120, 121 , 122, 123, or 124.
- the nucleic acid encoding the engineered Cas9 protein can be RNA.
- the RNA can be enzymatically synthesized in vitro.
- DNA encoding the engineered Cas9 protein can be operably linked to a promoter sequence that is recognized by a phage RNA polymerase for in vitro RNA synthesis.
- the promoter sequence can be a T7, T3, or SP6 promoter sequence or a variation of a T7, T3, or SP6 promoter sequence.
- the DNA encoding the engineered protein can be part of a vector, as detailed below.
- the in vitro- transcribed RNA can be purified, capped, and/or polyadenylated.
- the RNA encoding the engineered Cas9 protein can be part of a self- replicating RNA (Yoshioka et al., Cell Stem Cell, 2013, 13:246-254).
- the self- replicating RNA can be derived from a noninfectious, self-replicating Venezuelan equine encephalitis (VEE) virus RNA replicon, which is a positive-sense, single-stranded RNA that is capable of self-replicating for a limited number of cell divisions, and which can be modified to code proteins of interest (Yoshioka et al., Cell Stem Cell, 2013, 13:246-254).
- VEE Venezuelan equine encephalitis
- the nucleic acid encoding the engineered Cas9 protein can be DNA.
- the DNA coding sequence can be operably linked to at least one promoter control sequence for expression in the cell of interest.
- the DNA coding sequence can be operably linked to a promoter sequence for expression of the engineered Cas9 protein in bacterial (e.g., E. coli) cells or eukaryotic (e.g., yeast, insect, or mammalian) cells.
- Suitable bacterial promoters include, without limit, T7 promoters, lac operon promoters, trp promoters, tac promoters (which are hybrids of trp and lac promoters), variations of any of the foregoing, and combinations of any of the foregoing.
- suitable eukaryotic promoters include constitutive, regulated, or cell- or tissue-specific promoters.
- Suitable eukaryotic constitutive promoter control sequences include, but are not limited to, cytomegalovirus immediate early promoter (CMV), simian virus (SV40) promoter, adenovirus major late promoter, Rous sarcoma virus (RSV) promoter, mouse mammary tumor virus (MMTV) promoter, phosphoglycerate kinase (PGK) promoter, elongation factor (EDI )-alpha promoter, ubiquitin promoters, actin promoters, tubulin promoters, immunoglobulin promoters, fragments thereof, or combinations of any of the foregoing.
- CMV cytomegalovirus immediate early promoter
- SV40 simian virus
- RSV Rous sarcoma virus
- MMTV mouse mammary tumor virus
- PGK phosphoglycerate kinase
- EDI elongation factor-alpha promoter
- actin promoters actin promoters
- tissue-specific promoters include B29 promoter, CD14 promoter, CD43 promoter, CD45 promoter, CD68 promoter, desmin promoter, elastase-1 promoter, endoglin promoter, fibronectin promoter, Flt-1 promoter, GFAP promoter, GPIIb promoter, ICAM-2 promoter, INF-b promoter, Mb promoter, Nphsl promoter, OG-2 promoter, SP-B promoter, SYN1 promoter, and WASP promoter.
- the promoter sequence can be wild type or it can be modified for more efficient or efficacious expression.
- the DNA coding sequence also can be linked to a polyadenylation signal (e.g., SV40 polyA signal, bovine growth hormone (BGFI) polyA signal, etc.) and/or at least one transcriptional termination sequence.
- a polyadenylation signal e.g., SV40 polyA signal, bovine growth hormone (BGFI) polyA signal, etc.
- BGFI bovine growth hormone
- the engineered Cas9 protein can be purified from the bacterial or eukaryotic cells.
- the engineered guide RNA can be encoded by DNA.
- the DNA encoding the engineered guide RNA can be operably linked to a promoter sequence that is recognized by a phage RNA polymerase for in vitro RNA synthesis.
- the promoter sequence can be a T7, T3, or SP6 promoter sequence or a variation of a T7, T3, or SP6 promoter sequence.
- the DNA encoding the engineered guide RNA can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III) for expression in eukaryotic cells of interest.
- RNA polymerase III Poly III
- the nucleic acid encoding the engineered Cas9 protein can be present in a vector.
- the vector can further comprise nucleic acid encoding the engineered guide RNA.
- Suitable vectors include plasmid vectors, viral vectors, and self-replicating RNA (Yoshioka et al., Cell Stem Cell, 2013, 13:246-254).
- the nucleic acid encoding the complex or fusion protein can be present in a plasmid vector.
- Non-limiting examples of suitable plasmid vectors include pUC, pBR322, pET, pBluescript, and variants thereof.
- the nucleic acid encoding the complex or fusion protein can be part of a viral vector (e.g., lentiviral vectors, adeno-associated viral vectors, adenoviral vectors, and so forth).
- the plasmid or viral vector can comprise additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., antibiotic resistance genes), origins of replication, and the like.
- Another aspect of the present disclosure comprises eukaryotic cells comprising at least one engineered Cas9 system as detailed above in section (I) and/or at least one nucleic acid encoding and engineered Cas9 protein and/or engineered guide RNA as detailed above in section (II).
- the eukaryotic cell can be a human cell, a non-human mammalian cell, a non-mammalian vertebrate cell, an invertebrate cell, a plant cell, or a single cell eukaryotic organism. Examples of suitable eukaryotic cells are detailed below in section (IV)(c).
- the eukaryotic cell can be in vitro, ex vivo, or in vivo.
- a further aspect of the present disclosure encompasses methods for modifying a chromosomal sequence in eukaryotic cells.
- the methods comprise introducing into the eukaryotic cell of interest at least one engineered Cas9 system as detailed above in section (I) and/or at least one nucleic acid encoding said engineered Cas9 system as detailed above in section (II).
- the chromosomal sequence modification can comprise a substitution of at least one nucleotide, a deletion of at least one nucleotide, an insertion of at least one nucleotide.
- the method comprises introducing into the eukaryotic cell one engineered Cas9 system comprising nuclease activity or two engineered Cas9 systems comprising nickase activity and no donor polynucleotide, such that the engineered Cas9 system or systems introduce a double-stranded break in the target site in the chromosomal sequence and repair of the double-stranded break by cellular DNA repair processes introduces at least one nucleotide change (i.e., indel), thereby inactivating the chromosomal sequence (i.e., gene knock-out).
- the engineered Cas9 system or systems introduce a double-stranded break in the target site in the chromosomal sequence and repair of the double-stranded break by cellular DNA repair processes introduces at least one nucleotide change (i.e., indel), thereby inactivating the chromosomal sequence (i.e., gene knock-out).
- the method comprises introducing into the eukaryotic cell one engineered Cas9 system comprising nuclease activity or two engineered Cas9 systems comprising nickase activity, as well as the donor polynucleotide, such that the engineered Cas9 system or systems introduce a double-stranded break in the target site in the
- chromosomal sequence and repair of the double-stranded break by cellular DNA repair processes leads to insertion or exchange of sequence in the donor polynucleotide into the target site in the chromosomal sequence (i.e., gene correction or gene knock-in).
- the chromosomal sequence modification can comprise a conversion of at least one nucleotide in or near the target site, a modification of at least one nucleotide in or near the target site, a modification of at least one histone protein in or near the target site, and/or a change in transcription in or near the target site in the chromosomal sequence.
- the method comprises introducing into the eukaryotic cell at least one engineered Cas9 system and/or nucleic acid encoding said system (and optional donor polynucleotide).
- the at least one system and/or nucleic acid/donor polynucleotide can be introduced into the cell of interest by a variety of means.
- the cell can be transfected with the appropriate molecules (i.e., protein, DNA, and/or RNA).
- suitable transfection methods include nucleofection (or electroporation), calcium phosphate-mediated transfection, cationic polymer transfection (e.g., DEAE-dextran or polyethylenimine), viral
- Transfection methods are well known in the art (see, e.g.,“Current Protocols in Molecular Biology” Ausubel et al., John Wiley & Sons, New York, 2003 or“Molecular Cloning: A Laboratory Manual” Sambrook & Russell, Cold Spring Harbor Press, Cold Spring Harbor, NY, 3rd edition, 2001 ). In other words, “Current Protocols in Molecular Biology” Ausubel et al., John Wiley & Sons, New York, 2003 or“Molecular Cloning: A Laboratory Manual” Sambrook & Russell, Cold Spring Harbor Press, Cold Spring Harbor, NY, 3rd edition, 2001 ). In other publications.
- the molecules can be introduced into the cell by microinjection.
- the molecules can be injected into the cytoplasm or nuclei of the cells of interest.
- the amount of each molecule introduced into the cell can vary, but those skilled in the art are familiar with means for determining the appropriate amount.
- the engineered Cas9 system (or its encoding nucleic acid) and the donor polynucleotide can be introduced at the same time.
- the cell is maintained under conditions appropriate for cell growth and/or maintenance. Suitable cell culture conditions are well known in the art and are described, for example, in Santiago et al., Proc. Natl. Acad. Sci. USA, 2008, 105:5809-5814; Moehle et al. Proc. Natl. Acad. Sci. USA, 2007, 104:3055-3060; Urnov et al., Nature, 2005, 435:646-651 ; and Lombardo et al., Nat. Biotechnol., 2007, 25:1298-1306.
- Routine optimization may be used, in all cases, to determine the best techniques for a particular cell type.
- the method can further comprise introducing at least one donor polynucleotide into the cell.
- the donor polynucleotide can be single-stranded or double-stranded, linear or circular, and/or RNA or DNA.
- the donor polynucleotide can be a vector, e.g., a plasmid vector.
- the donor polynucleotide comprises at least one donor sequence.
- the donor sequence of the donor polynucleotide can be a modified version of an endogenous or native chromosomal sequence.
- the donor sequence can be essentially identical to a portion of the chromosomal sequence at or near the sequence targeted by the engineered Cas9 system, but which comprises at least one nucleotide change.
- the sequence at the targeted chromosomal location comprises at least one nucleotide change.
- the change can be an insertion of one or more nucleotides, a deletion of one or more nucleotides, a substitution of one or more nucleotides, or combinations thereof.
- the cell can produce a modified gene product from the targeted chromosomal sequence.
- the donor sequence of the donor polynucleotide can be an exogenous sequence.
- an“exogenous” sequence refers to a sequence that is not native to the cell, or a sequence whose native location is in a different location in the genome of the cell.
- the exogenous sequence can comprise protein coding sequence, which can be operably linked to an exogenous promoter control sequence such that, upon integration into the genome, the cell is able to express the protein coded by the integrated sequence.
- the exogenous sequence can be integrated into the chromosomal sequence such that its expression is regulated by an endogenous promoter control sequence.
- the exogenous sequence can be a transcriptional control sequence, another expression control sequence, an RNA coding sequence, and so forth.
- integration of an exogenous sequence into a chromosomal sequence is termed a“knock in.”
- the length of the donor sequence can and will vary.
- the donor sequence can vary in length from several nucleotides to hundreds of nucleotides to hundreds of thousands of nucleotides.
- the donor sequence in the donor polynucleotide is flanked by an upstream sequence and a downstream sequence, which have substantial sequence identity to sequences located upstream and downstream, respectively, of the sequence targeted by the engineered Cas9 system. Because of these sequence similarities, the upstream and downstream sequences of the donor polynucleotide permit homologous recombination between the donor polynucleotide and the targeted chromosomal sequence such that the donor sequence can be integrated into (or exchanged with) the chromosomal sequence.
- the upstream sequence refers to a nucleic acid sequence that shares substantial sequence identity with a chromosomal sequence upstream of the sequence targeted by the engineered Cas9 system.
- the downstream sequence refers to a nucleic acid sequence that shares substantial sequence identity with a chromosomal sequence downstream of the sequence targeted by the engineered Cas9 system.
- the phrase“substantial sequence identity” refers to sequences having at least about 75% sequence identity.
- the upstream and downstream sequences in the donor polynucleotide can have about 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity with sequence upstream or downstream to the target sequence.
- the upstream and downstream sequences in the donor polynucleotide can have about 95% or 100% sequence identity with chromosomal sequences upstream or downstream to the sequence targeted by the engineered Cas9 system.
- the upstream sequence shares substantial sequence identity with a chromosomal sequence located immediately upstream of the sequence targeted by the engineered Cas9 system. In other embodiments, the upstream sequence shares substantial sequence identity with a chromosomal sequence that is located within about one hundred (100) nucleotides upstream from the target sequence. Thus, for example, the upstream sequence can share substantial sequence identity with a chromosomal sequence that is located about 1 to about 20, about 21 to about 40, about 41 to about 60, about 61 to about 80, or about 81 to about 100 nucleotides upstream from the target sequence. In some embodiments, the
- downstream sequence shares substantial sequence identity with a chromosomal sequence located immediately downstream of the sequence targeted by the engineered Cas9 system.
- the downstream sequence shares substantial sequence identity with a chromosomal sequence that is located within about one hundred (100) nucleotides downstream from the target sequence.
- the downstream sequence can share substantial sequence identity with a chromosomal sequence that is located about 1 to about 20, about 21 to about 40, about 41 to about 60, about 61 to about 80, or about 81 to about 100 nucleotides downstream from the target sequence.
- Each upstream or downstream sequence can range in length from about 20 nucleotides to about 5000 nucleotides. In some embodiments, upstream and downstream sequences can comprise about 50, 100, 200, 300, 400, 500, 600, 700,
- upstream and downstream sequences can range in length from about 50 to about 1500 nucleotides.
- the cell can be a human cell, a non-human mammalian cell, a non-mammalian vertebrate cell, an invertebrate cell, an insect cell, a plant cell, a yeast cell, or a single cell eukaryotic organism.
- the cell can be a one cell embryo.
- a non-human mammalian embryo including rat, hamster, rodent, rabbit, feline, canine, ovine, porcine, bovine, equine, and primate embryos.
- the cell can be a stem cell such as embryonic stem cells, ES-like stem cells, fetal stem cells, adult stem cells, and the like.
- the stem cell is not a human embryonic stem cell.
- the stem cells may include those made by the techniques disclosed in W02003/046141 , which is incorporated herein in its entirety, or Chung et al. (Cell Stem Cell, 2008, 2:113-117).
- the cell can be in vitro (i.e., in culture), ex vivo (/. e. , within tissue isolated from an organism), or in vivo ⁇ i.e., within an organism).
- the cell is a mammalian cell or mammalian cell line.
- the cell is a human cell or human cell line.
- Non-limiting examples of suitable mammalian cells or cell lines include human embryonic kidney cells (FIEK293, FIEK293T); human cervical carcinoma cells (FIELA); human lung cells (W138); human liver cells (Flep G2); human U2-OS osteosarcoma cells, human A549 cells, human A-431 cells, and human K562 cells; Chinese hamster ovary (CFIO) cells, baby hamster kidney (BHK) cells; mouse myeloma NS0 cells, mouse embryonic fibroblast 3T3 cells (NIH3T3), mouse B lymphoma A20 cells; mouse melanoma B16 cells; mouse myoblast C2C12 cells; mouse myeloma SP2/0 cells; mouse embryonic mesenchymal C3H-10T1/2 cells; mouse carcinoma CT26 cells, mouse prostate DuCuP cells; mouse breast EMT6 cells; mouse hepatoma Hepa1 c1 c7 cells; mouse myeloma J5582 cells; mouse
- compositions and methods disclosed herein can be used in a variety of therapeutic, diagnostic, industrial, and research applications.
- the present disclosure can be used to modify any chromosomal sequence of interest in a cell, animal, or plant in order to model and/or study the function of genes, study genetic or epigenetic conditions of interest, or study
- transgenic organisms can be created that model diseases or disorders, wherein the expression of one or more nucleic acid sequences associated with a disease or disorder is altered.
- the disease model can be used to study the effects of mutations on the organism, study the development and/or progression of the disease, study the effect of a pharmaceutically active compound on the disease, and/or assess the efficacy of a potential gene therapy strategy.
- compositions and methods can be used to perform efficient and cost effective functional genomic screens, which can be used to study the function of genes involved in a particular biological process and how any alteration in gene expression can affect the biological process, or to perform saturating or deep scanning mutagenesis of genomic loci in conjunction with a cellular phenotype.
- Saturating or deep scanning mutagenesis can be used to determine critical minimal features and discrete vulnerabilities of functional elements required for gene expression, drug resistance, and reversal of disease, for example.
- compositions and methods disclosed herein can be used for diagnostic tests to establish the presence of a disease or disorder and/or for use in determining treatment options.
- diagnostic tests include detection of specific mutations in cancer cells (e.g., specific mutation in EGFR, HER2, and the like), detection of specific mutations associated with particular diseases (e.g ., trinucleotide repeats, mutations in b-globin associated with sickle cell disease, specific SNPs, etc.), detection of hepatitis, detection of viruses (e.g., Zika), and so forth.
- compositions and methods disclosed herein can be used to correct genetic mutations associated with a particular disease or disorder such as, e.g., correct globin gene mutations associated with sickle cell disease or thalassemia, correct mutations in the adenosine deaminase gene associated with severe combined immune deficiency (SCID), reduce the expression of HTT, the disease-causing gene of Huntington’s disease, or correct mutations in the rhodopsin gene for the treatment of retinitis pigmentosa.
- SCID severe combined immune deficiency
- compositions and methods disclosed herein can be used to generate crop plants with improved traits or increased resistance to environmental stresses.
- the present disclosure can also be used to generate farm animal with improved traits or production animals.
- pigs have many features that make them attractive as biomedical models, especially in regenerative medicine or xenotransplantation.
- the terms“complementary” or“complementarity” refer to the association of double-stranded nucleic acids by base pairing through specific hydrogen bonds.
- the base paring may be standard Watson-Crick base pairing (e.g., 5’-A G T C-3’ pairs with the complementary sequence 3’-T C A G-5’).
- the base pairing also may be Hoogsteen or reversed Hoogsteen hydrogen bonding.
- Complementarity is typically measured with respect to a duplex region and thus, excludes overhangs, for example.
- Complementarity between two strands of the duplex region may be partial and expressed as a percentage (e.g., 70%), if only some (e.g., 70%) of the bases are complementary. The bases that are not complementary are “mismatched.” Complementarity may also be complete (/. e. , 100%), if all the bases in the duplex region are complementary.
- CRISPR/Cas system or“Cas9 system” refers to a complex comprising a Cas9 protein (/.e., nuclease, nickase, or catalytically dead protein) and a guide RNA.
- endogenous sequence refers to a chromosomal sequence that is native to the cell.
- exogenous refers to a sequence that is not native to the cell, or a chromosomal sequence whose native location in the genome of the cell is in a different chromosomal location.
- A“gene,” as used herein, refers to a DNA region (including exons and introns) encoding a gene product, as well as all DNA regions which regulate the production of the gene product, whether or not such regulatory sequences are adjacent to coding and/or transcribed sequences. Accordingly, a gene includes, but is not necessarily limited to, promoter sequences, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites, and locus control regions.
- heterologous refers to an entity that is not endogenous or native to the cell of interest.
- a heterologous protein refers to a protein that is derived from or was originally derived from an exogenous source, such as an exogenously introduced nucleic acid sequence. In some instances, the heterologous protein is not normally produced by the cell of interest.
- nickase refers to an enzyme that cleaves one strand of a double-stranded nucleic acid sequence (i.e., nicks a double-stranded sequence).
- a nuclease with double strand cleavage activity can be modified by mutation and/or deletion to function as a nickase and cleave only one strand of a double- stranded sequence.
- nuclease refers to an enzyme that cleaves both strands of a double-stranded nucleic acid sequence.
- nucleic acid and“polynucleotide” refer to a
- deoxyribonucleotide or ribonucleotide polymer in linear or circular conformation, and in either single- or double-stranded form.
- these terms are not to be construed as limiting with respect to the length of a polymer.
- the terms can encompass known analogs of natural nucleotides, as well as nucleotides that are modified in the base, sugar and/or phosphate moieties (e.g., phosphorothioate backbones).
- an analog of a particular nucleotide has the same base-pairing specificity; i.e., an analog of A will base-pair with T.
- nucleotide refers to deoxyribonucleotides
- nucleotides may be standard nucleotides (i.e., adenosine, guanosine, cytidine, thymidine, and uridine), nucleotide isomers, or nucleotide analogs.
- a nucleotide analog refers to a nucleotide having a modified purine or pyrimidine base or a modified ribose moiety.
- a nucleotide analog may be a naturally occurring nucleotide (e.g., inosine, pseudouridine, etc.) or a non-naturally occurring nucleotide.
- Non-limiting examples of modifications on the sugar or base moieties of a nucleotide include the addition (or removal) of acetyl groups, amino groups, carboxyl groups, carboxymethyl groups, hydroxyl groups, methyl groups, phosphoryl groups, and thiol groups, as well as the substitution of the carbon and nitrogen atoms of the bases with other atoms (e.g., 7-deaza purines).
- Nucleotide analogs also include dideoxy nucleotides, 2’-0-methyl nucleotides, locked nucleic acids (LNA), peptide nucleic acids (PNA), and morpholinos.
- polypeptide and“protein” are used interchangeably to refer to a polymer of amino acid residues.
- target sequence “target chromosomal sequence,” and “target site” are used interchangeably to refer to the specific sequence in chromosomal DNA to which the engineered Cas9 system is targeted, and the site at which the engineered Cas9 system modifies the DNA or protein(s) associated with the DNA.
- nucleic acid and amino acid sequence identity are known in the art. Typically, such techniques include determining the nucleotide sequence of the mRNA for a gene and/or determining the amino acid sequence encoded thereby, and comparing these sequences to a second nucleotide or amino acid sequence. Genomic sequences can also be determined and compared in this fashion. In general, identity refers to an exact nucleotide-to-nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively. Two or more sequences (polynucleotide or amino acid) can be compared by determining their percent identity.
- the percent identity of two sequences is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100.
- An approximate alignment for nucleic acid sequences is provided by the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482- 489 (1981 ). This algorithm can be applied to amino acid sequences by using the scoring matrix developed by Dayhoff, Atlas of Protein Sequences and Structure, M. O. Dayhoff ed., 5 suppl. 3:353-358, National Biomedical Research Foundation,
- Bifidobacterium bombi Acidothermus cellulolyticus, Alicyclobacillus hesperidum, Wolinella succinogenes, Nitratifractor salsuginis, Ralstonia syzygii, and
- Corynebacterium diphtheria were codon optimized for expression in human cells and tagged with a SV40 large T antigen nuclear localization (NLS) on the C terminus (SEQ ID NOs:1 -30; see Table 6 below).
- the expression of each ortholog was driven by a human cytomegalovirus (CMV) immediate early enhancer and promoter.
- CRISPR RNA (crRNA) and putative trans-activating crRNA (tracrRNA) for each ortholog were joined together to form a single guide RNA (sgRNA) (SEQ ID NOs:31 -45; see Table 6 below).
- sgRNA single guide RNA
- the expression of each sgRNA was driven by a human U6 promoter.
- transcribed sgRNA was prepared from a T7 promoter tagged PCR template as a supplement for in vitro digestion.
- Human K562 cells were transfected with Cas9 encoding plasmid and sgRNA expression plasmid by nucleofection. Each transfection consisted of 2 million cells, 5 pg of Cas9 encoding plasmid DNA, and 3 pg of sgRNA expression plasmid DNA.
- Cells were harvested approximately 24 hr post transfection, washed with ice cold PBS buffer, and lysed with 150 pL of lysis solution (20 mM HEPES, pH 7.5; 100 mM KCI; 5 mM MgCI2, 1 mM DTT, 5% glycerol, 0.1 % Triton X-100, 1x Protease inhibitor ) with constant agitation for 30 minutes in a 4 °C cold room. Supernatant was prepared by removing residual cellular debris with centrifugation at 16,000 x g for 2 minutes at 4 °C and used as a source of Cas9 RNP for in vitro digestion of a plasmid DNA PAM library.
- lysis solution (20 mM HEPES, pH 7.5; 100 mM KCI; 5 mM MgCI2, 1 mM DTT, 5% glycerol, 0.1 % Triton X-100, 1x Protease inhibitor ) with constant agitation for 30 minutes
- the library contained 4 8 degenerate PAMs, each immediately preceded by a protospacer with the following configuration: 5’- GTACAAACGGCAGAAGCTGGNNNNNNNN-3’ (SEQ ID NO:46).
- Each in vitro digestion consisted of 10 pL of cell lysate supernatant, 2 pL of 5x digestion buffer (100 mM HEPES, pH 7.5; 500 mM KCI; 25 mM MgCI 2 ; 5 mM DTT; 25% glycerol), 800 ng of PAM library DNA, and 20 pmol of in vitro transcribed sgRNA supplement in a 20 pL reaction volume. Reaction was maintained at 37 °C for 30 minutes and then purified with PCR purification kit.
- Illumina NextSeq sequencing libraries were prepared from digested products and subjected to deep sequencing. Deep sequencing data were analyzed using a Weblogo program to deduce the PAM requirement for each Cas9 ortholog.
- Results are summarized in FIG. 1.
- the results revealed several Cas9 orthologs that use A and/or T containing PAMs for in vitro target DNA cleavage. These Cas9 orthologs could provide a means to target AT rich genomic sites.
- the results also revealed several Cas9 orthologs that use a PAM suitable for targeting GC rich genomic sites. These Cas9 orthologs could provide alternative targeting schemes to SpyCas9 in GC rich genomic sites to increase targeting resolution and specificity.
- Example 2 Genome modification using Bacillus smithii Cas9 (BsmCas9) and Lactobacillus rhamnosus Cas9 (LrhCas9)
- the small BsmCas9 (1095 aa) (SEQ ID NO: 2) and the LrhCas9 (SEQ ID NO: 4) use a 5’-NNNNCAAA-3’ PAM and a 5’-NGAAA-3’ PAM for target DNA binding, respectively.
- These novel PAM usages provide a means to target AT rich genomic sites.
- human K562 cells (1 x10 6 ) were nucleofected with 5 pg of Cas9 encoding plasmid DNA and 3 pg of sgRNA expression plasmid DNA.
- Targeted genomic sites include the human tyrosine-protein phosphatase non-receptor type 2 ( PTN2 ) locus, the human empty spiracles homeobox 1 ( EMX1 ) locus, the human programmed cell death 1 ligand 1 ( PD1L1 ) locus, the human AAVS1 safe harbor locus, the human cytochrome p450 oxidoreductase ( POR ) locus, and the human nuclear receptor subfamily 1 group I member 3 ⁇ CAR) locus.
- Genomic DNA was prepared using a DNA extraction solution (QuickExtractTM) three days post transfection and targeted genomic regions were each PCR amplified (JumpStart TagTM ReadyMixTM). The PCR primers are listed in Table 1 .
- Amplification was carried out using the following condition: 1 cycle of 98 °C for 2 minutes for initial denaturation; 34 cycles of 98 °C for 15 seconds, 62 °C for 30 seconds, and 72 °C for 45 seconds; 1 cycle of 72 °C for 5 minutes; and hold at 4 °C.
- PCR products were digested with Cel-1 nuclease and resolved on a 10% acrylamide gel. Targeted mutation rates were measured using ImageJ and expressed as percent insertions and/or deletions (% Indel). Results are summarized in Table 2.
- Example 3 Improvement of Parasutterella excrementihominis Cas9 (PexCas9) by fusion with chromatin modulating motifs
- Parasutterella excrementihominis Cas9 (PexCas9-NLS) (SEQ ID NO:6) was modified by fusion with a human HMGN1 peptide (SEQ ID NO:72) on the N terminus using a TGSG linker (SEQ ID NO: 109) and with either a human HMGB1 box A peptide (PexCas9-HN1 HB1 fusion; SEQ ID NO: 1 17) or a human histone H1 central globular domain peptide (PexCas9-HN1 H1 G; SEQ ID NO: 1 18) on the C terminus using a LEGGGS linker (SEQ ID NQ: 108).
- Human K562 cells (1 x 10 6 ) were transfected with plasmid DNA encoding PexCas9-NLS, PexCas9-HN1 HB1 fusion, or PexCas9-HN1 G fusion in molar equivalent amounts (5 and 5.4 pg, respectively) and 3 pg of sgRNA plasmid for targeting a genomic site in the human cytochrome p450 oxidoreductase ( POR ) locus.
- Genomic DNA was prepared using DNA extraction solution (QuickExtractTM) three days post transfection and the targeted genomic region was PCR amplified using the forward primer 5’- CTCCCCTGCTTCTTGTCGTAT-3’ (SEQ ID NO:55) and the reverse primer 5’- ACAGGTCGTGGACACTCACA -3’ (SEQ ID NO:56). Amplification was carried out with the following condition: 1 cycle of 98 °C for 2 minutes for initial denaturation; 34 cycles of 98 °C for 15 seconds, 62 °C for 30 seconds, and 72 °C for 45 seconds; 1 cycle of 72 °C for 5 minutes; and hold at 4 °C. PCR products were digested with Cel-1 nuclease and resolved on a 10% acrylamide gel. Targeted mutation rates were measured using ImageJ and expressed as percent insertions and/or deletions (% Indel). Results are summarized in Table 4. The results demonstrate that Cas9 fusion with at least one chromatin modulating motif enhances its gene editing efficiency on
- the wild type crRNA coding sequence of McaCas9 contains four consecutive thymidine residues in the repeat region, and three of the four thymidine residues are predicted to pair with three adenosine residues in the putative tracrRNA sequence when the crRNA and tracrRNA are joined together to form a sgRNA.
- Human RNA polymerase (Pol) III is known to use four or more consecutive thymidine residues on the coding RNA strand as a transcription termination signal.
- a T to C mutation and a corresponding A to G mutation were introduced into the sgRNA scaffold to form a modified sgRNA scaffold with the following sequence: 5’ ⁇
- Human K562 cells (1x 10 6 ) were transfected with 5.5 pg of plasmid DNA encoding a McaCas9 fusion protein, which contains a HMGN1 peptide on the N terminus and a histone H1 globular domain peptide on the C terminus, and 3 pg of sgRNA plasmid DNA encoding the control sgRNA scaffold or the modified sgRNA scaffold.
- Genomic DNA was prepared using a DNA extraction solution (QuickExtractTM) three days post transfection and the targeted genomic region was PCR amplified using the forward primer 5’- CTCCCCTGCTTCTTGTCGTAT-3’ (SEQ ID NO:55) and the reverse primer 5’- ACAGGTCGTGGACACTCACA -3’ (SEQ ID NO:56). Amplification was carried out with the following condition: 1 cycle of 98 °C for 2 minutes for initial denaturation; 34 cycles of 98 °C for 15 seconds, 62 °C for 30 seconds, and 72 °C for 45 seconds; 1 cycle of 72 °C for 5 minutes; and hold at 4 °C.
- PCR products were digested with Cel-1 nuclease and resolved on a 10% acrylamide gel. Targeted mutation rates were measured using ImageJ and expressed as percent insertions and/or deletions (% Indel). Results are summarized in Table 5. The results demonstrate that the activity of a Cas9 ortholog in mammalian cells can be enhanced by modifying its sgRNA scaffold.
- Additional Cas9-CMM fusion proteins were prepared by linking McaCas9-NLS, BsmCas9-NLS, and LrhCas9-NLS proteins with HMGN1 (HN1 ) at the amino terminus and either HMGB1 box A (HB1 ) or histone H1 central globular motif (H1 G) at the carboxyl terminus to yield McaCas9-HN 1 HB1 (SEQ ID NO: 123),
- McaCas9-HN1 H1 G (SEQ ID NO: 124), BsmCas9-HN1 HB1 (SEQ ID NO: 1 19), Bsm- HN1 H1 G (SEQ ID NQ: 120), Lrh-HN1 HB1 (SEQ ID NO: 121 ), LrhCas9-HN 1 H1 G (SEQ ID NO: 122).
- the nuclease activity of these fusions and the PexCas9-CMM fusions described above in Example 3 were compared to the activity of the corresponding engineered Cas9 protein essentially as described above in Examples 2 and 3.
- Table 6 presents the target site (/.e. , protospacer + PAM, which is shown in bold with the determinate nucleotides underlined) in specific loci for each Cas9 nuclease.
- FIGS. 2A- D The percent of indels under each condition are plotted in FIGS. 2A- D. Both the HN1 HB1 and HN1 H1 G combinations significantly enhanced the four Cas9 orthologs on at least one site. Based on the fold change magnitude, the CMM fusion modification provided the largest enhancement on McaCas9, increasing its activity by at least five-fold on the two sites tested (FIG. 2A). CMM fusion provided more than two- fold enhancement on PexCas9 (FIG. 2B). BsmCas9 activity was enhanced by more than three-fold on one site, but there was only 20% increase on the second site and no effect on the third site (FIG. 2C).
- Table 7 presents the human codon optimized DNA and protein sequences of engineered Cas9/NLS proteins (SEQ ID NOS:1 -30, wherein the NLS sequence is underlined) and the DNA sequences of engineered sgRNAs (SEQ ID NOS:31 -45; the N residues at the 5’ end indicate the programmable target sequence). Also presented at the Cas9-CMM fusions (SEQ ID NOS: 117-124).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- General Engineering & Computer Science (AREA)
- Biotechnology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Medicinal Chemistry (AREA)
- Crystallography & Structural Chemistry (AREA)
- Cell Biology (AREA)
- Mycology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Enzymes And Modification Thereof (AREA)
- Peptides Or Proteins (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| IL274528A IL274528B2 (en) | 2018-02-15 | 2019-02-15 | Engineered Cas9 systems for eukaryotic genome modification |
| BR112020010479-5A BR112020010479A2 (pt) | 2018-02-15 | 2019-02-15 | sistemas cas9 geneticamente modificados para modificação de genoma eucariótico |
| KR1020207026571A KR102465067B1 (ko) | 2018-02-15 | 2019-02-15 | 진핵 게놈 변형을 위한 조작된 cas9 시스템 |
| AU2019222568A AU2019222568B2 (en) | 2018-02-15 | 2019-02-15 | Engineered Cas9 systems for eukaryotic genome modification |
| EP19714890.1A EP3752607A1 (en) | 2018-02-15 | 2019-02-15 | Engineered cas9 systems for eukaryotic genome modification |
| KR1020227002190A KR102494449B1 (ko) | 2018-02-15 | 2019-02-15 | 진핵 게놈 변형을 위한 조작된 cas9 시스템 |
| JP2020531575A JP7109547B2 (ja) | 2018-02-15 | 2019-02-15 | 真核ゲノム修飾のための操作されたCas9システム |
| SG11202007382TA SG11202007382TA (en) | 2018-02-15 | 2019-02-15 | Engineered cas9 systems for eukaryotic genome modification |
| CN201980013625.2A CN111902536B (zh) | 2018-02-15 | 2019-02-15 | 用于真核基因组修饰的改造的cas9系统 |
| IL321024A IL321024A (en) | 2018-02-15 | 2019-02-15 | Engineered CAS9 Systems For Eukaryotic Genome Modification |
| KR1020237003098A KR102684890B1 (ko) | 2018-02-15 | 2019-02-15 | 진핵 게놈 변형을 위한 조작된 cas9 시스템 |
| CA3084020A CA3084020C (en) | 2018-02-15 | 2019-02-15 | Modified CAS9 systems to alter the genome of eukaryotes |
| AU2022200130A AU2022200130B2 (en) | 2018-02-15 | 2022-01-11 | Engineered Cas9 systems for eukaryotic genome modification |
| JP2022083820A JP7559005B2 (ja) | 2018-02-15 | 2022-05-23 | 真核ゲノム修飾のための操作されたCas9システム |
| AU2024202158A AU2024202158A1 (en) | 2018-02-15 | 2024-04-04 | Engineered cas9 systems for eukaryotic genome modification |
| JP2024114477A JP2024161376A (ja) | 2018-02-15 | 2024-07-18 | 真核ゲノム修飾のための操作されたCas9システム |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862631304P | 2018-02-15 | 2018-02-15 | |
| US62/631,304 | 2018-02-15 | ||
| US201862720525P | 2018-08-21 | 2018-08-21 | |
| US62/720,525 | 2018-08-21 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019161290A1 true WO2019161290A1 (en) | 2019-08-22 |
Family
ID=65995829
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/018335 Ceased WO2019161290A1 (en) | 2018-02-15 | 2019-02-15 | Engineered cas9 systems for eukaryotic genome modification |
Country Status (11)
| Country | Link |
|---|---|
| US (2) | US10767193B2 (https=) |
| EP (1) | EP3752607A1 (https=) |
| JP (3) | JP7109547B2 (https=) |
| KR (3) | KR102465067B1 (https=) |
| CN (1) | CN111902536B (https=) |
| AU (3) | AU2019222568B2 (https=) |
| BR (1) | BR112020010479A2 (https=) |
| CA (2) | CA3084020C (https=) |
| IL (2) | IL321024A (https=) |
| SG (1) | SG11202007382TA (https=) |
| WO (1) | WO2019161290A1 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021202568A1 (en) * | 2020-03-31 | 2021-10-07 | Metagenomi Ip Technologies, Llc | Class ii, type ii crispr systems |
| JP2023549339A (ja) * | 2020-11-06 | 2023-11-24 | ペアワイズ・プランツ・サーヴィシズ,インコーポレイテッド | 対立遺伝子の、rnaによりコードされるdna置換のための組成物および方法 |
| US12024727B2 (en) | 2019-02-14 | 2024-07-02 | Metagenomi, Inc. | Enzymes with RuvC domains |
| EP4230737A4 (en) * | 2020-09-21 | 2024-07-24 | Korea University Research and Business Foundation | NOVEL IMPROVED BASIC EDITING OR REVISION FUSION PROTEIN AND USE THEREOF |
| US12410449B2 (en) | 2021-11-24 | 2025-09-09 | Metagenomi, Inc. | Endonuclease systems |
| US12435323B2 (en) | 2021-08-27 | 2025-10-07 | Metagenomi, Inc. | Enzymes with RUVC domains |
Families Citing this family (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3204496A1 (en) | 2014-10-10 | 2017-08-16 | Editas Medicine, Inc. | Compositions and methods for promoting homology directed repair |
| US11111492B2 (en) * | 2017-03-06 | 2021-09-07 | Florida State University Research Foundation, Inc. | Genome engineering methods using a cytosine-specific Cas9 |
| KR20210045360A (ko) | 2018-05-16 | 2021-04-26 | 신테고 코포레이션 | 가이드 rna 설계 및 사용을 위한 방법 및 시스템 |
| EP3823633A4 (en) | 2018-06-29 | 2023-05-03 | Editas Medicine, Inc. | SYNTHETIC LEAD MOLECULES, COMPOSITIONS AND METHODS RELATED THERETO |
| CA3129835A1 (en) | 2019-02-15 | 2020-08-20 | Sigma-Aldrich Co. Llc | Crispr/cas fusion proteins and systems |
| CA3130789A1 (en) | 2019-03-07 | 2020-09-10 | The Regents Of The University Of California | Crispr-cas effector polypeptides and methods of use thereof |
| WO2021127209A1 (en) | 2019-12-17 | 2021-06-24 | Sigma-Aldrich Co. Llc | Genome editing in bacteroides |
| GB2594339B (en) * | 2020-02-14 | 2023-02-08 | Metagenomi Inc | Enzymes with RUVC domains |
| CA3163463A1 (en) * | 2020-03-11 | 2021-09-16 | Fuqiang Chen | High fidelity spcas9 nucleases for genome modification |
| CN112159801B (zh) * | 2020-07-13 | 2022-11-15 | 复旦大学 | SlugCas9-HF蛋白、含有SlugCas9-HF蛋白的基因编辑系统及应用 |
| CN113717960B (zh) * | 2021-08-27 | 2023-07-18 | 电子科技大学 | 一种新Cas9蛋白、CRISPR-Cas9基因组定向编辑载体及基因组编辑方法 |
| CN114657181B (zh) * | 2022-04-01 | 2023-08-25 | 安徽大学 | 一种靶向H1.4的sgRNA以及H1.4基因编辑方法 |
| CN119948064A (zh) * | 2022-09-23 | 2025-05-06 | 庄伟哲 | 靶向整合素 αIIbβ3的含组织纤维溶酶原活化剂或其变异体的融合蛋白质及其应用 |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003046141A2 (en) | 2001-11-26 | 2003-06-05 | Advanced Cell Technology, Inc. | Methods for making and using reprogrammed human somatic cell nuclei and autologous and isogenic human stem cells |
| WO2016054326A1 (en) * | 2014-10-01 | 2016-04-07 | The General Hospital Corporation | Methods for increasing efficiency of nuclease-induced homology-directed repair |
| US20170314015A1 (en) * | 2014-03-26 | 2017-11-02 | Editas Medicine, Inc. | Crispr/cas-related methods and compositions for treating sickle cell disease |
| WO2019025984A1 (en) * | 2017-07-31 | 2019-02-07 | Reflection Biotechnologies Limited | CELLULAR MODELS AND THERAPIES FOR OCULAR DISEASES |
Family Cites Families (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3241902B1 (en) * | 2012-05-25 | 2018-02-28 | The Regents of The University of California | Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription |
| EP3363902B1 (en) * | 2012-12-06 | 2019-11-27 | Sigma Aldrich Co. LLC | Crispr-based genome modification and regulation |
| AU2013359262C1 (en) * | 2012-12-12 | 2021-05-13 | Massachusetts Institute Of Technology | CRISPR-Cas component systems, methods and compositions for sequence manipulation |
| EP3004370B1 (en) | 2013-06-05 | 2024-08-21 | Duke University | Rna-guided gene editing and gene regulation |
| US9074199B1 (en) * | 2013-11-19 | 2015-07-07 | President And Fellows Of Harvard College | Mutant Cas9 proteins |
| JP2017503514A (ja) * | 2014-01-24 | 2017-02-02 | ノースカロライナ ステート ユニバーシティーNorth Carolina State University | Cas9ターゲッティングをガイドする配列に関する方法および組成物 |
| EP3633032A3 (en) * | 2014-08-28 | 2020-07-29 | North Carolina State University | Novel cas9 proteins and guiding features for dna targeting and genome editing |
| LT3604527T (lt) | 2016-06-02 | 2021-06-25 | Sigma-Aldrich Co., Llc | Programuojamų, dnr surišančių baltymų panaudojimas tiksliniam genomo modifikavimui pagerinti |
| US10017760B2 (en) | 2016-06-24 | 2018-07-10 | Inscripta, Inc. | Methods for generating barcoded combinatorial libraries |
| JP7305534B2 (ja) | 2016-07-06 | 2023-07-10 | バーテックス ファーマシューティカルズ インコーポレイテッド | 疼痛関連障害を処置するための物質及び方法 |
| JP7182545B2 (ja) * | 2016-12-14 | 2022-12-02 | ヴァーヘニンゲン ユニヴェルシテット | 熱安定性cas9ヌクレアーゼ |
| KR102523217B1 (ko) * | 2017-07-11 | 2023-04-20 | 시그마-알드리치 컴퍼니., 엘엘씨 | 표적된 게놈 변형을 개선하기 위한 뉴클레오솜 상호작용 단백질 도메인 사용 |
-
2019
- 2019-02-15 CN CN201980013625.2A patent/CN111902536B/zh active Active
- 2019-02-15 KR KR1020207026571A patent/KR102465067B1/ko active Active
- 2019-02-15 KR KR1020227002190A patent/KR102494449B1/ko active Active
- 2019-02-15 CA CA3084020A patent/CA3084020C/en active Active
- 2019-02-15 WO PCT/US2019/018335 patent/WO2019161290A1/en not_active Ceased
- 2019-02-15 SG SG11202007382TA patent/SG11202007382TA/en unknown
- 2019-02-15 CA CA3281020A patent/CA3281020A1/en active Pending
- 2019-02-15 BR BR112020010479-5A patent/BR112020010479A2/pt unknown
- 2019-02-15 IL IL321024A patent/IL321024A/en unknown
- 2019-02-15 US US16/277,823 patent/US10767193B2/en active Active
- 2019-02-15 AU AU2019222568A patent/AU2019222568B2/en active Active
- 2019-02-15 JP JP2020531575A patent/JP7109547B2/ja active Active
- 2019-02-15 EP EP19714890.1A patent/EP3752607A1/en active Pending
- 2019-02-15 KR KR1020237003098A patent/KR102684890B1/ko active Active
- 2019-02-15 IL IL274528A patent/IL274528B2/en unknown
-
2020
- 2020-07-30 US US16/943,813 patent/US12297449B2/en active Active
-
2022
- 2022-01-11 AU AU2022200130A patent/AU2022200130B2/en active Active
- 2022-05-23 JP JP2022083820A patent/JP7559005B2/ja active Active
-
2024
- 2024-04-04 AU AU2024202158A patent/AU2024202158A1/en active Pending
- 2024-07-18 JP JP2024114477A patent/JP2024161376A/ja active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2003046141A2 (en) | 2001-11-26 | 2003-06-05 | Advanced Cell Technology, Inc. | Methods for making and using reprogrammed human somatic cell nuclei and autologous and isogenic human stem cells |
| US20170314015A1 (en) * | 2014-03-26 | 2017-11-02 | Editas Medicine, Inc. | Crispr/cas-related methods and compositions for treating sickle cell disease |
| WO2016054326A1 (en) * | 2014-10-01 | 2016-04-07 | The General Hospital Corporation | Methods for increasing efficiency of nuclease-induced homology-directed repair |
| WO2019025984A1 (en) * | 2017-07-31 | 2019-02-07 | Reflection Biotechnologies Limited | CELLULAR MODELS AND THERAPIES FOR OCULAR DISEASES |
Non-Patent Citations (27)
| Title |
|---|
| "Current Protocols in Molecular Biology", 2003, JOHN WILEY & SONS |
| "The Cambridge Dictionary of Science and Technology", 1988 |
| "The Glossary of Genetics", 1991, SPRINGER VERLAG |
| AIRENNE ET AL., BIOMOLECULAR ENGINEERING, vol. 16, no. 1-4, 1999, pages 87 - 92 |
| ALIREZA EDRAKI ET AL: "A Compact, High-Accuracy Cas9 with a Dinucleotide PAM for In Vivo Genome Editing", MOLECULAR CELL, vol. 73, no. 4, 20 December 2018 (2018-12-20), AMSTERDAM, NL, pages 714 - 726.e4, XP055585186, ISSN: 1097-2765, DOI: 10.1016/j.molcel.2018.12.003 * |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 2003, JOHN WILEY & SONS |
| BENJAMIN P. KLEINSTIVER ET AL: "Engineered CRISPR-Cas9 nucleases with altered PAM specificities", NATURE, vol. 523, no. 7561, 22 June 2015 (2015-06-22), London, pages 481 - 485, XP055293257, ISSN: 0028-0836, DOI: 10.1038/nature14592 * |
| CHUNG ET AL., CELL STEM CELL, vol. 2, 2008, pages 113 - 117 |
| CRASTO ET AL., PROTEIN ENG., vol. 13, no. 5, 2000, pages 309 - 312 |
| CULL ET AL., METHODS IN ENZYMOLOGY, vol. 326, 2000, pages 430 - 440 |
| DAYHOFF: "Atlas of Protein Sequences and Structure", vol. 5, pages: 353 - 358 |
| GRIBSKOV: "National Biomedical Research Foundation", NUCL. ACIDS RES., vol. 14, no. 6, 1986, pages 6745 - 6763 |
| HALE; MARHAM, THE HARPER COLLINS DICTIONARY OF BIOLOGY, 1991 |
| KIPRIYANOV ET AL., HUMAN ANTIBODIES, vol. 6, no. 3, 1995, pages 93 - 101 |
| KONERMANN ET AL., NATURE, vol. 517, no. 7536, 2015, pages 583 - 588 |
| LAITINEN ET AL., JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 278, no. 6, 2003, pages 4010 - 4014 |
| LOMBARDO ET AL., NAT. BIOTECHNOL., vol. 25, 2007, pages 1298 - 1306 |
| MOEHLE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 104, 2007, pages 3055 - 3060 |
| PRASHANT MALI ET AL: "Cas9 as a versatile tool for engineering biology", NIH PUBLIC ACCESS AUTHOR MANUSCRIPTS, vol. 10, no. 10, 1 October 2013 (2013-10-01), pages 1 - 16, XP055553170, DOI: 10.1038/nmeth.2649 * |
| SAMBROOK; RUSSELL: "Molecular Cloning: A Laboratory Manual", 2001, COLD SPRING HARBOR PRESS |
| SANTIAGO ET AL., PROC. NATL. ACAD. SCI. USA, vol. 105, 2008, pages 5809 - 5814 |
| See also references of EP3752607A1 |
| SINGLETON ET AL.: "Dictionary of Microbiology and Molecular Biology", 1994 |
| SMITH; WATERMAN, ADVANCES IN APPLIED MATHEMATICS, vol. 2, 1981, pages 482 - 489 |
| URNOV ET AL., NATURE, vol. 435, 2005, pages 646 - 651 |
| YOSHIOKA ET AL., CELL STEM CELL, vol. 13, 2013, pages 246 - 254 |
| ZALATAN ET AL., CELL, vol. 160, no. 1-2, 2015, pages 339 - 50 |
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12024727B2 (en) | 2019-02-14 | 2024-07-02 | Metagenomi, Inc. | Enzymes with RuvC domains |
| WO2021202568A1 (en) * | 2020-03-31 | 2021-10-07 | Metagenomi Ip Technologies, Llc | Class ii, type ii crispr systems |
| GB2608292A (en) * | 2020-03-31 | 2022-12-28 | Metagenomi Inc | Class II, type II CRISPR systems |
| CN116096877A (zh) * | 2020-03-31 | 2023-05-09 | 宏基因组学公司 | Ii类ii型crispr系统 |
| GB2608292B (en) * | 2020-03-31 | 2024-02-14 | Metagenomi Inc | Class II, type II CRISPR systems |
| US11946039B2 (en) | 2020-03-31 | 2024-04-02 | Metagenomi, Inc. | Class II, type II CRISPR systems |
| EP4230737A4 (en) * | 2020-09-21 | 2024-07-24 | Korea University Research and Business Foundation | NOVEL IMPROVED BASIC EDITING OR REVISION FUSION PROTEIN AND USE THEREOF |
| JP2023549339A (ja) * | 2020-11-06 | 2023-11-24 | ペアワイズ・プランツ・サーヴィシズ,インコーポレイテッド | 対立遺伝子の、rnaによりコードされるdna置換のための組成物および方法 |
| US12435323B2 (en) | 2021-08-27 | 2025-10-07 | Metagenomi, Inc. | Enzymes with RUVC domains |
| US12410449B2 (en) | 2021-11-24 | 2025-09-09 | Metagenomi, Inc. | Endonuclease systems |
Also Published As
| Publication number | Publication date |
|---|---|
| US20190249200A1 (en) | 2019-08-15 |
| CN111902536A (zh) | 2020-11-06 |
| US12297449B2 (en) | 2025-05-13 |
| KR102684890B1 (ko) | 2024-07-12 |
| JP7109547B2 (ja) | 2022-07-29 |
| EP3752607A1 (en) | 2020-12-23 |
| KR102465067B1 (ko) | 2022-11-10 |
| KR20230022258A (ko) | 2023-02-14 |
| AU2024202158A1 (en) | 2024-05-02 |
| BR112020010479A2 (pt) | 2020-11-24 |
| CA3084020A1 (en) | 2019-08-22 |
| AU2019222568B2 (en) | 2021-10-14 |
| JP2021505180A (ja) | 2021-02-18 |
| AU2019222568A1 (en) | 2020-05-21 |
| SG11202007382TA (en) | 2020-08-28 |
| JP2022122910A (ja) | 2022-08-23 |
| CN111902536B (zh) | 2024-07-30 |
| KR102494449B1 (ko) | 2023-01-31 |
| IL274528B1 (en) | 2025-06-01 |
| US10767193B2 (en) | 2020-09-08 |
| IL321024A (en) | 2025-07-01 |
| IL274528B2 (en) | 2025-10-01 |
| KR20220015502A (ko) | 2022-02-08 |
| US20200354752A1 (en) | 2020-11-12 |
| AU2022200130B2 (en) | 2024-03-07 |
| CA3281020A1 (en) | 2026-03-02 |
| JP7559005B2 (ja) | 2024-10-01 |
| IL274528A (en) | 2020-06-30 |
| KR20200121342A (ko) | 2020-10-23 |
| AU2022200130A1 (en) | 2022-02-10 |
| CA3084020C (en) | 2025-11-25 |
| JP2024161376A (ja) | 2024-11-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12297449B2 (en) | Engineered CAS9 systems for eukaryotic genome modification | |
| AU2022200851B2 (en) | Using nucleosome interacting protein domains to enhance targeted genome modification | |
| US11965184B2 (en) | CRISPR/Cas fusion proteins and systems | |
| BR122025004697A2 (pt) | Sistema para modificar uma sequência cromossômica em uma célula eucariótica, pluralidade de ácidos nucleicos, vetor, célula eucariótica, proteína de fusão, composição e usos | |
| BR122025004697B1 (pt) | Sistemas para modificar um genoma eucariótico, pluralidade de ácidos nucleicos, vetor, e proteína de fusão | |
| HK40040051B (zh) | 用於真核基因组修饰的改造的cas9系统 | |
| HK40040051A (en) | Engineered cas9 systems for eukaryotic genome modification |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19714890 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2019222568 Country of ref document: AU Date of ref document: 20190215 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 3084020 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020531575 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 20207026571 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019714890 Country of ref document: EP Effective date: 20200915 |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020010479 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112020010479 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200526 |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 321024 Country of ref document: IL |
|
| WWG | Wipo information: grant in national office |
Ref document number: 11202007382T Country of ref document: SG |
|
| WWP | Wipo information: published in national office |
Ref document number: 11202007382T Country of ref document: SG |