WO2019160751A2 - Methods for treating cancer with anti-pd-1 antibodies - Google Patents

Methods for treating cancer with anti-pd-1 antibodies Download PDF

Info

Publication number
WO2019160751A2
WO2019160751A2 PCT/US2019/017177 US2019017177W WO2019160751A2 WO 2019160751 A2 WO2019160751 A2 WO 2019160751A2 US 2019017177 W US2019017177 W US 2019017177W WO 2019160751 A2 WO2019160751 A2 WO 2019160751A2
Authority
WO
WIPO (PCT)
Prior art keywords
cancer
patient
antibody
seq
binding fragment
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2019/017177
Other languages
English (en)
French (fr)
Other versions
WO2019160751A3 (en
Inventor
Mallika LALA
Lokesh JAIN
Mengyao LI
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Organon Pharma UK Ltd
Merck Sharp and Dohme LLC
Original Assignee
Merck Sharp and Dohme Ltd
Merck Sharp and Dohme LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=67620026&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2019160751(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to CN201980013286.8A priority Critical patent/CN111712255A/zh
Priority to BR112020016331A priority patent/BR112020016331A8/pt
Priority to RU2020129827A priority patent/RU2846266C2/ru
Priority to JP2020542960A priority patent/JP2021513541A/ja
Priority to MX2020008445A priority patent/MX2020008445A/es
Priority to SG11202007590TA priority patent/SG11202007590TA/en
Priority to KR1020207026004A priority patent/KR20200119844A/ko
Priority to AU2019220495A priority patent/AU2019220495B2/en
Priority to CN202511206047.8A priority patent/CN120919306A/zh
Priority to CA3090995A priority patent/CA3090995A1/en
Priority to US16/966,968 priority patent/US12358984B2/en
Priority to EP19754909.0A priority patent/EP3752180A4/en
Application filed by Merck Sharp and Dohme Ltd, Merck Sharp and Dohme LLC filed Critical Merck Sharp and Dohme Ltd
Publication of WO2019160751A2 publication Critical patent/WO2019160751A2/en
Priority to IL276303A priority patent/IL276303A/en
Priority to MX2024013016A priority patent/MX2024013016A/es
Anticipated expiration legal-status Critical
Publication of WO2019160751A3 publication Critical patent/WO2019160751A3/en
Priority to US18/459,842 priority patent/US20240026003A1/en
Priority to JP2024000162A priority patent/JP2024038251A/ja
Priority to AU2026201041A priority patent/AU2026201041A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/495Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with two or more nitrogen atoms as the only ring heteroatoms, e.g. piperazine or tetrazines
    • A61K31/505Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim
    • A61K31/519Pyrimidines; Hydrogenated pyrimidines, e.g. trimethoprim ortho- or peri-condensed with heterocyclic rings
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/555Heterocyclic compounds containing heavy metals, e.g. hemin, hematin, melarsoprol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39541Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/22Heterocyclic compounds, e.g. ascorbic acid, tocopherol or pyrrolidones
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/26Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/04Antineoplastic agents specific for metastasis
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/51Complete heavy chain or Fd fragment, i.e. VH + CH1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/515Complete light chain, i.e. VL + CL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding

Definitions

  • the present invention relates to therapies useful for the treatment of cancer.
  • the invention relates to a method for treating cancer which comprises administering to a patient in need thereof an anti -PD- 1 antibody, or antigen binding fragment thereof, using the dosage regimens specified herein.
  • sequence listing of the present application is submitted electronically via EFS-Web as an ASCII formatted sequence listing with a file name“24567WOPCT-SEQLIST- 25JAN20l9.TXT”, creation date of January 25, 2019, and a size of 23.7 kb.
  • This sequence listing submitted via EFS-Web is part of the specification and is herein incorporated by reference in its entirety.
  • PD-l is recognized as an important player in immune regulation and the maintenance of peripheral tolerance. PD-l is moderately expressed on naive T, B and NKT cells and up-regulated by T/B cell receptor signaling on lymphocytes, monocytes and myeloid cells (Sharpe et al ., The function of programmed cell death 1 and its ligands in regulating
  • PD-L1 Two known ligands for PD-l, PD-L1 (B7-H1) and PD-L2 (B7-DC), are expressed in human cancers arising in various tissues.
  • PD-L1 expression correlated with poor prognosis and reduced overall survival irrespective of subsequent treatment (Dong et al., Nat Med. 8(8):793-800 (2002); Yang et al. Invest Ophthalmol Vis Sci. 49: 2518-2525 (2008); Ghebeh et al. Neoplasia 8: 190-198 (2006); Hamanishi et al., Proc. Natl.
  • PD-l expression on tumor infiltrating lymphocytes was found to mark dysfunctional T cells in breast cancer and melanoma (Ghebeh et al , BMC Cancer. 2008 8:5714- 15 (2008); Ahmadzadeh et al ., Blood 114: 1537-1544 (2009)) and to correlate with poor prognosis in renal cancer (Thompson et al., Clinical Cancer Research 15: 1757-1761(2007)).
  • PD-L1 expressing tumor cells interact with PD-l expressing T cells to attenuate T cell activation and evasion of immune surveillance, thereby contributing to an impaired immune response against the tumor.
  • Immune therapies targeting the PD-l axis include monoclonal antibodies directed to the PD-l receptor (KEYTRUDATM (pembrolizumab), Merck and Co., Inc., Kenilworth, NJ, USA and OPDIVOTM (nivolumab), Bristol-Myers Squibb Company, Princeton, NJ, USA) and also those that bind to the PD-L1 ligand (MPDL3280A; TECENTRIQTM
  • the present invention provides alternative, less frequent, dosing regimens for treating a cancer patient with an anti-PD-l antibody, or antigen-binding fragment thereof, wherein the dosing schedule is expected to provide a safe and effective dose of the anti-PD-l antibody, or antigen-binding fragment thereof.
  • the invention provides a method of treating cancer in a human patient comprising administering about 400 mg of an anti-PD-l antibody or antigen binding fragment thereof to the patient every six weeks, wherein the anti-PD- 1 antibody or antigen-binding fragment thereof comprises (a) light chain complementarity determining regions (CDRs) comprising a sequence of amino acids as set forth in SEQ ID NOs:
  • the antibody or antigen-binding fragment is pembrolizumab.
  • the amount of anti -PD- 1 antibody or antigen binding fragment thereof administered to the patient is from about 350 mg to about 450 mg. In further embodiments, the amount of antibody or antigen-binding fragment is about 400 mg. In further embodiments, the amount of antibody or antigen-binding fragment is 400 mg.
  • the PD-l antibody or antigen-binding fragment inhibits the binding of PD-L1 to PD-l, and preferably also inhibits the binding of PD-L2 to PD-l .
  • the PD-l antibody or antigen-binding fragment is a monoclonal antibody, which specifically binds to PD-l and blocks the binding of PD-L1 to PD-l.
  • the anti -PD-l antibody comprises a heavy chain and a light chain, and wherein the heavy and light chains comprise the amino acid sequences shown in Figure 1 (SEQ ID NO:5 and SEQ ID NO: 10).
  • the cancer expresses one or both of PD-L1 and PD-L2. In some embodiments, PD-L1 expression is elevated in the cancer.
  • the anti -PD-l antibody or antigen binding fragment is administered to a patient subcutaneously.
  • the anti -PD-l antibody or antigen binding fragment is administered to a patient intravenously.
  • FIGURE 1 shows amino acid sequences of the light chain and heavy chain for an exemplary anti-PD-l monoclonal antibody useful in the present invention (SEQ ID NOs:5 and 10, respectively).
  • Light chain and heavy chain variable regions are underlined (SEQ ID NO’s 4 and 9) and CDRs are bold and boxed.
  • FIGURE 2 shows that pembrolizumab Cmax at steady state for 400 mg Q6W lies within the range from 2 mg/kg Q3W and 200 mg Q3W to 10 mg/kg Q2W.
  • FIGURE 3 shows that pembrolizumab exposures (Cavg and Cmin) at steady state are similar for 400 mg Q6W relative to 2 mg/kg Q3W and 200 mg Q3W.
  • FIGURE 4A and 4B show the pembrolizumab pharmacokinetic profiles at steady state for the 400 mg Q6W dosing regimen compared to the 200 mg, Q3W, flat dosing regimen (top), the Q3W, 2 mg/kg weight-based dosing regimen (middle), and the Q2W, 10 mg/kg weight- based dosing regimen (bottom). Results are provided for log scale concentrations (FIG. 4A) and linear scale concentrations (FIG. 4B).
  • PD-l programmed death 1 (a.k.a. programmed cell death- 1 and
  • “about” can mean a variation of ⁇ 0.1%, ⁇ 0.5%, ⁇ 1%, ⁇ 2%, ⁇ 3%, ⁇ 4%, ⁇ 5%, ⁇ 6%, ⁇ 7%, ⁇ 8%, ⁇ 9% or ⁇ 10%.
  • the dosage can be from 360 mg to 440 mg, from 370 mg to 430 mg, from 380 mg to 420 mg, from 390 mg to 410 mg, from 395 mg to 405 mg, from 400 mg to 440 mg, or from 390 mg to 440 mg.
  • the dosage can be 360 mg, 365 mg, 370 mg, 375 mg, 380 mg, 385 mg, 390 mg, 395 mg, 400 mg, 405 mg, 410 mg, 415 mg, 420 mg, 425 mg, 430 mg, 435 mg, or 440 mg.
  • amount of time between administrations in a therapeutic treatment regimen i.e., amount of time between administrations of the anti -PD- 1 antibody or antigen binding fragment thereof, e.g.“about 6 weeks,” which is used interchangeably herein with“approximately every six weeks”
  • “about” refers to the stated time ⁇ a variation that can occur due to patient/clinician scheduling and availability around the 6-week target date.
  • “about 6 weeks” can refer to 6 weeks ⁇ 5 days, 6 weeks ⁇ 4 days, 6 weeks ⁇ 3 days, 6 weeks ⁇ 2 days or 6 weeks ⁇ 1 day, or may refer to 5 weeks, 2 days through 6 weeks, 5 days.
  • Pharmacokinetic“steady state” is a period of time during which any accumulation of drug concentrations owing to multiple doses has been maximized and systemic drug exposure is considered uniform after each subsequent dose administered; in the specific case of
  • pembrolizumab steady state is achieved at and after -16 weeks of administration.
  • AUCss, Cavg,ss and Cmin,ss are pharmacokinetic measures of the systemic exposure to the drug (e.g. pembrolizumab) in humans after its administration, and are typically considered drivers of drug efficacy.
  • AUCss and Cavg,ss represent the average exposure over a dosing interval, but differ in terms of units.“Cmin,ss” represents the minimum or lowest (trough) drug concentration observed at the end of a dosing interval, just before the next dose is administered.
  • Cmax,ss is the maximum or highest (peak) drug concentration observed soon after its administration. In the specific case of pembrolizumab, which is administered as intravenous infusion, the peak concentration occurs immediately after end of infusion. Cmax,ss is a metric that is typically considered a driver of driver safety.
  • administering refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid.
  • Treat or “treating” a cancer, as used herein, means to administer an anti-PD-l antibody, or antigen-binding fragment, to a subject having a cancer, or diagnosed with a cancer, to achieve at least one positive therapeutic effect, such as for example, reduced number of cancer cells, reduced tumor size, reduced rate of cancer cell infiltration into peripheral organs, or reduced rate of tumor metastasis or tumor growth.
  • Treatment may include one or more of the following: inducing/increasing an antitumor immune response, decreasing the number of one or more tumor markers, halting or delaying the growth of a tumor or blood cancer or progression of disease associated with PD-l binding to its ligands PD-L1 and/or PD-L2 (“PD- 1 -related disease”) such as cancer, stabilization of PD-l -related disease, inhibiting the growth or survival of tumor cells, eliminating or reducing the size of one or more cancerous lesions or tumors, decreasing the level of one or more tumor markers, ameliorating or abrogating the clinical manifestations of PD-l -related disease, reducing the severity or duration of the clinical symptoms of PD-l -related disease such as cancer, prolonging the survival of a patient relative to the expected survival in a similar untreated patient, and inducing complete or partial remission of a cancerous condition or other PD-l related disease.
  • PD- 1 -related disease such as cancer
  • T/C £42% is the minimum level of anti -tumor activity.
  • the treatment achieved by a therapeutically effective amount is any of progression free survival (PFS), disease free survival (DFS) or overall survival (OS).
  • PFS also referred to as“Time to Tumor Progression” indicates the length of time during and after treatment that the cancer does not grow, and includes the amount of time patients have experienced a complete response or a partial response, as well as the amount of time patients have experienced stable disease.
  • DFS refers to the length of time during and after treatment that the patient remains free of disease.
  • OS refers to a prolongation in life expectancy as compared to naive or untreated individuals or patients.
  • While an embodiment of the treatment methods, compositions and uses of the present invention may not be effective in achieving a positive therapeutic effect in every patient, it should do so in a statistically significant number of subjects as determined by any statistical test known in the art such as the Student’s t-test, the chi 2 -test, the U-test according to Mann and Whitney, the Kruskal -Wallis test (H-test), Jonckheere-Terpstra-test and the Wilcoxon-test.
  • any statistical test known in the art such as the Student’s t-test, the chi 2 -test, the U-test according to Mann and Whitney, the Kruskal -Wallis test (H-test), Jonckheere-Terpstra-test and the Wilcoxon-test.
  • patient refers to a mammal (e.g ., rat, mouse, dog, cat, rabbit) capable of being treated with the methods and compositions of the invention, most preferably a human.
  • the patient is an adult patient. In other embodiments, the patient is a pediatric patient.
  • antibody refers to any form of antibody that exhibits the desired biological or binding activity. Thus, it is used in the broadest sense and specifically covers, but is not limited to, monoclonal antibodies (including full length monoclonal antibodies), polyclonal antibodies, humanized, fully human antibodies, and chimeric antibodies.
  • parent antibodies are antibodies obtained by exposure of an immune system to an antigen prior to modification of the antibodies for an intended use, such as humanization of an antibody for use as a human therapeutic.
  • the basic antibody structural unit comprises a tetramer.
  • Each tetramer includes two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy” chain (about 50-70 kDa).
  • the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
  • the carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function.
  • human light chains are classified as kappa and lambda light chains.
  • human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids.
  • the variable regions of each light/heavy chain pair form the antibody binding site.
  • an intact antibody has two binding sites. Except in bifunctional or bispecific antibodies, the two binding sites are, in general, the same.
  • variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), which are located within relatively conserved framework regions (FR).
  • CDRs complementarity determining regions
  • FR framework regions
  • the CDRs are usually aligned by the framework regions, enabling binding to a specific epitope.
  • both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
  • the assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest. Rabat, et al:, National Institutes of Health, Bethesda, Md. ; 5 th ed.; NIH Publ. No.
  • hypervariable region refers to the amino acid residues of an antibody that are responsible for antigen-binding.
  • the hypervariable region comprises amino acid residues from a "complementarity determining region" or "CDR" (i.e . CDRL1, CDRL2 and CDRL3 in the light chain variable domain and CDRH1, CDRH2 and CDRH3 in the heavy chain variable domain).
  • CDR complementarity determining region
  • CDRL1, CDRL2 and CDRL3 in the light chain variable domain
  • CDRH1, CDRH2 and CDRH3 in the heavy chain variable domain.
  • an "antibody fragment” or “antigen binding fragment” refers to antigen binding fragments of antibodies, i.e. antibody fragments that retain the ability to specifically bind to the antigen bound by the full-length antibody, e.g. fragments that retain one or more CDR regions.
  • antibody binding fragments include, but are not limited to, Fab, Fab', F(ab') 2 , and Fv fragments.
  • An antibody that“specifically binds to” a specified target protein is an antibody that exhibits preferential binding to that target as compared to other proteins, but this specificity does not require absolute binding specificity.
  • An antibody is considered “specific” for its intended target if its binding is determinative of the presence of the target protein in a sample, e.g. without producing undesired results such as false positives.
  • Antibodies, or binding fragments thereof, useful in the present invention will bind to the target protein with an affinity that is at least two fold greater, preferably at least ten times greater, more preferably at least 20-times greater, and most preferably at least lOO-times greater than the affinity with non-target proteins.
  • an antibody is said to bind specifically to a polypeptide comprising a given amino acid sequence, e.g. the amino acid sequence of a mature human PD-l or human PD-L1 molecule, if it binds to polypeptides comprising that sequence but does not bind to proteins lacking that sequence.
  • Chimeric antibody refers to an antibody in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in an antibody derived from a particular species (e.g., human) or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in an antibody derived from another species (e.g., mouse) or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
  • a particular species e.g., human
  • another species e.g., mouse
  • Human antibody refers to an antibody that comprises human immunoglobulin protein sequences only.
  • a human antibody may contain murine carbohydrate chains if produced in a mouse, in a mouse cell, or in a hybridoma derived from a mouse cell.
  • “mouse antibody” or“rat antibody” refer to an antibody that comprises only mouse or rat
  • immunoglobulin sequences respectively.
  • Humanized antibody refers to forms of antibodies that contain sequences from non-human (e.g., murine) antibodies as well as human antibodies. Such antibodies contain minimal sequence derived from non-human immunoglobulin.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human
  • the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • the prefix“hum”,“hu” or“h” is added to antibody clone designations when necessary to distinguish humanized antibodies from parental rodent antibodies.
  • the humanized forms of rodent antibodies will generally comprise the same CDR sequences of the parental rodent antibodies, although certain amino acid substitutions may be included to increase affinity, increase stability of the humanized antibody, or for other reasons.
  • cancer refers to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth.
  • cancer include but are not limited to, carcinoma, lymphoma, leukemia, blastoma, and sarcoma.
  • cancers include, but are not limited to, squamous cell carcinoma, myeloma, small-cell lung cancer, non-small cell lung cancer, glioma, Hodgkin lymphoma, non-hodgkin's lymphoma, acute myeloid leukemia (AML), multiple myeloma, gastrointestinal (tract) cancer, renal cancer, ovarian cancer, liver cancer, lymphoblastic leukemia, lymphocytic leukemia, colorectal cancer, endometrial cancer, kidney cancer, prostate cancer, thyroid cancer, melanoma, chondrosarcoma, neuroblastoma, pancreatic cancer, glioblastoma multiforme, cervical cancer, brain cancer, stomach cancer, bladder cancer, hepatoma, breast cancer, colon carcinoma, and head and neck cancer.
  • Additional cancers that may be treated in accordance with the present invention include those characterized by elevated expression of one or both of PD-L1 and PD-L2 in tested tissue samples
  • Biotherapeutic agent means a biological molecule, such as an antibody or fusion protein, that blocks ligand / receptor signaling in any biological pathway that supports tumor maintenance and/or growth or suppresses the anti-tumor immune response.
  • CDR or“CDRs” means complementarity determining region(s) in an immunoglobulin variable region, generally defined using the Rabat numbering system.
  • Platinum-containing chemotherapy refers to the use of chemotherapeutic agent(s) used to treat cancer that are coordination complexes of platinum. Platinum-containing chemotherapeutic agents are alkylating agents that crosslink DNA, resulting in ineffective DNA mismatch repair and generally leading to apoptosis. Examples of platins include cisplatin, carboplatin, and oxaliplatin.
  • “Chemotherapeutic agent” is a chemical compound useful in the treatment of cancer.
  • Classes of chemotherapeutic agents include, but are not limited to: alkylating agents, antimetabolites, kinase inhibitors, spindle poison plant alkaloids, cytotoxic/antitumor antibiotics, topisomerase inhibitors, photosensitizers, anti -estrogens and selective estrogen receptor modulators (SERMs), anti-progesterones, estrogen receptor down-regulators (ERDs), estrogen receptor antagonists, leutinizing hormone-releasing hormone agonists, anti-androgens, aromatase inhibitors, EGFR inhibitors, VEGF inhibitors, anti-sense oligonucleotides that that inhibit expression of genes implicated in abnormal cell proliferation or tumor growth.
  • SERMs selective estrogen receptor modulators
  • ESDs estrogen receptor down-regulators
  • estrogen receptor antagonists leutinizing hormone-releasing hormone agonists, anti-androgens, aromatase
  • Chemotherapeutic agents useful in the treatment methods of the present invention include cytostatic and/or cytotoxic agents.
  • Chothia means an antibody numbering system described in Al-Lazikani el al ., JMB 273:927-948 (1997).
  • Consatively modified variants or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity or other desired property of the protein, such as antigen affinity and/or specificity.
  • Those of skill in the art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987)
  • a PD-l antigen binding fragment that consists essentially of a recited amino acid sequence may also include one or more amino acids, including substitutions of one or more amino acid residues, which do not materially affect the properties of the binding compound.
  • Diagnostic anti-PD-L monoclonal antibody means a mAh which specifically binds to the mature form of the designated PD-L (PD-L1 or PD-L2) that is expressed on the surface of certain mammalian cells.
  • a mature PD-L lacks the presecretory leader sequence, also referred to as leader peptide
  • the terms "PD-L” and “mature PD-L” are used interchangeably herein, and shall be understood to mean the same molecule unless otherwise indicated or readily apparent from the context.
  • a diagnostic anti-human PD-L1 mAh or an anti-hPD-Ll mAh refers to a monoclonal antibody that specifically binds to mature human PD-L1.
  • a mature human PD-L1 molecule consists of amino acids 19-290 of the following sequence: MRIFAVFIFMTYWHLLNAFTVTVPKDLYWEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNI IQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITV KVNAPYNKINQRILWDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFN VTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTHLVILGAILLCLGVALT FIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET (SEQ ID NO: 17).
  • diagnostic anti-human PD-L1 mAbs useful as diagnostic mAbs for immunohistochemistry (IHC) detection of PD-L1 expression in formalin-fixed, paraffin-embedded (FFPE) tumor tissue sections are antibody 20C3 and antibody 22C3, which are described in WO 2014/100079. These antibodies comprise the light chain and heavy chain variable region amino acid sequences shown in Table 2 below:
  • Another anti-human PD-L1 mAh that has been reported to be useful for IHC detection of PD-L1 expression in FFPE tissue sections is a rabbit anti -human PD-L1 mAh publicly available from Sino Biological, Inc. (Beijing, P.R. China; Catalog number 10084-R015).
  • Framework region or“FR” as used herein means the immunoglobulin variable regions excluding the CDR regions.
  • isolated antibody and“isolated antibody fragment” refers to the purification status and in such context means the named molecule is substantially free of other biological molecules such as nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth media. Generally, the term “isolated” is not intended to refer to a complete absence of such material or to an absence of water, buffers, or salts, unless they are present in amounts that substantially interfere with experimental or therapeutic use of the binding compound as described herein.
  • Kabat (1991) Sequences of Proteins of Immunological Interest
  • “Monoclonal antibody” or“mAh” or“Mab”, as used herein, refers to a population of substantially homogeneous antibodies, i.e., the antibody molecules comprising the population are identical in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts.
  • conventional (polyclonal) antibody preparations typically include a multitude of different antibodies having different amino acid sequences in their variable domains, particularly their CDRs, which are often specific for different epitopes.
  • the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256: 495, or may be made by recombinant DNA methods (see, e.g., ET.S. Pat. No. 4,816,567).
  • the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature 352: 624-628 and Marks et al. (1991) J Mol. Biol. 222: 581-597, for example. See also Presta (2005) J Allergy Clin. Immunol. 116:731.
  • An“anti -PD- 1 antibody” useful in the any of the treatment methods, compositions and uses of the present invention include monoclonal antibodies (mAh), or antigen binding fragments thereof, which specifically bind to human PD-l.
  • Alternative names or synonyms for PD-l and its ligands include: PDCD1, PD1, CD279 and SLEB2 for PD-l; PDCD1L1, PDL1, B7H1, B7-4, CD274 and B7-H for PD-L1; and PDCD1L2, PDL2, B7-DC, Btdc and CD273 for PD-L2.
  • the PD-l antibody or antigen binding fragment thereof is a PD-l antagonist that blocks binding of human PD-L1 to human PD-l, or blocks binding of both human PD-L1 and PD-L2 to human PD-l.
  • Human PD-l amino acid sequences can be found in NCBI Locus No. : NP 005009.
  • Human PD-L1 and PD-L2 amino acid sequences can be found in NCBI Locus No.: NP_054862 and NP_0795l5, respectively.
  • An anti-PD-l antibody may be a human antibody, a humanized antibody or a chimeric antibody, and may include a human constant region.
  • the human constant region is selected from the group consisting of IgGl, IgG2, IgG3 and IgG4 constant regions, and in preferred embodiments, the human constant region is an IgGl or IgG4 constant region.
  • the antigen binding fragment is selected from the group consisting of Fab, Fab'- SH, F(ab') 2 , scFv and Fv fragments.
  • PD-L1 or“PD-L2” expression means any detectable level of expression of the designated PD-L protein on the cell surface or of the designated PD-L mRNA within a cell or tissue, unless otherwise defined.
  • PD-L protein expression may be detected with a diagnostic PD- L antibody in an IHC assay of a tumor tissue section or by flow cytometry.
  • PD-L protein expression by tumor cells may be detected by PET imaging, using a binding agent (e.g., antibody fragment, affibody and the like) that specifically binds to the desired PD-L target, e.g., PD-L1 or PD-L2.
  • a binding agent e.g., antibody fragment, affibody and the like
  • Techniques for detecting and measuring PD-L mRNA expression include RT- PCR and real-time quantitative RT-PCR.
  • One approach employs a simple binary end-point of positive or negative for PD- Ll expression, with a positive result defined in terms of the percentage of tumor cells that exhibit histologic evidence of cell-surface membrane staining.
  • a tumor tissue section is counted as positive for PD-L1 expression is at least 1%, and preferably 5% of total tumor cells.
  • PD-L1 expression in the tumor tissue section is quantified in the tumor cells as well as in infiltrating immune cells, which predominantly comprise
  • lymphocytes The percentage of tumor cells and infiltrating immune cells that exhibit membrane staining are separately quantified as ⁇ 5%, 5 to 9%, and then in 10% increments up to 100%.
  • PD-L1 expression is counted as negative if the score is ⁇ 5% score and positive if the score is > 5%.
  • PD-L1 expression in the immune infiltrate is reported as a semi-quantitative measurement called the adjusted inflammation score (AIS), which is determined by multiplying the percent of membrane staining cells by the intensity of the infiltrate, which is graded as none (0), mild (score of 1, rare lymphocytes), moderate (score of 2, focal infiltration of tumor by lymphohistiocytic aggregates), or severe (score of 3, diffuse infiltration).
  • AIS adjusted inflammation score
  • a tissue section from a tumor that has been stained by IHC with a diagnostic PD- Ll antibody may also be scored for PD-L1 protein expression by assessing PD-L1 expression in both the tumor cells and infiltrating immune cells in the tissue section using a scoring process. See WO 2014/165422.
  • One PD-L1 scoring process comprises examining each tumor nest in the tissue section for staining, and assigning to the tissue section one or both of a modified H score (MHS) and a modified proportion score (MPS).
  • MHS modified H score
  • MPS modified proportion score
  • the estimated percentages are then input into the formula of 1 x (percent of weak staining cells) + 2 x (percent of moderate staining cells) + 3 x (percent of strong staining cells), and the result is assigned to the tissue section as the MHS.
  • the MPS is assigned by estimating, across all of the viable tumor cells and stained mononuclear inflammatory cells in all of the examined tumor nests, the percentage of cells that have at least partial membrane staining of any intensity, and the resulting percentage is assigned to the tissue section as the MPS.
  • the tumor is designated as positive for PD-L1 expression if the MHS or the MPS is positive.
  • CPS combined positive score
  • the CPS is useful in selecting patients for treatment with particular treatment regimens including methods of treatment comprising administration of an anti-PD-l antibody in which expression of PD-L1 is associated with a higher response rate in a particular patient population relative to same patient population that does not express PD-L1.
  • the CPS is determined by determining the number of viable PD-L1 positive tumor cells, the number of viable PD-L1 negative tumor cells, and the number of viable PD-L1 positive mononuclear inflammatory cells (MIC) in a tumor tissue from a patient having a tumor and calculating the CPS using the following formula:
  • the PD-L1 expression scoring method used is the “lymphoma proportion score.” Lymphoma is characterized by a homogeneous population of confluent cells which efface the architecture of the lymph node or the architecture of metastatic site.
  • The“LPS” or“lymphoma proportion score” is the percentage of this population of cells which express PD-L1. When determining the LPS, no attempt is made to distinguish the truly neoplastic cells from the reactive cells.
  • PD-L1 expression is characterized by partial or complete membrane staining at any intensity.
  • TPS tumor proportion score
  • TPS typically includes the percentage of neoplastic cells expressing PD-L1 at any intensity (weak, moderate, or strong), which can be determining using an immunohistochemical assay using a diagnostic anti-human PD-L1 mAh, e.g. antibody 20C3 and antibody 22C3, described, supra.
  • Cells are considered to express PD-L1 if membrane staining is present, including cells with partial membrane staining.
  • the level of PD-L mRNA expression may be compared to the mRNA expression levels of one or more reference genes that are frequently used in quantitative RT-PCR, such as ubiquitin C.
  • a level of PD-L1 expression (protein and/or mRNA) by malignant cells and/or by infiltrating immune cells within a tumor is determined to be “overexpressed” or“elevated” based on comparison with the level of PD-L1 expression (protein and / or mRNA) by an appropriate control.
  • a control PD-L1 protein or mRNA expression level may be the level quantified in nonmalignant cells of the same type or in a section from a matched normal tissue.
  • PD-L1 expression in a tumor sample is determined to be elevated if PD-L1 protein (and/or PD-L1 mRNA) in the sample is at least 10%, 20%, or 30% greater than in the control.
  • tissue section refers to a single part or piece of a tissue sample, e.g., a thin slice of tissue cut from a sample of a normal tissue or of a tumor.
  • Tumor as it applies to a subject diagnosed with, or suspected of having, a cancer refers to a malignant or potentially malignant neoplasm or tissue mass of any size, and includes primary tumors and secondary neoplasms.
  • a solid tumor is an abnormal growth or mass of tissue that usually does not contain cysts or liquid areas. Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors are sarcomas, carcinomas, and lymphomas. Leukemias (cancers of the blood) generally do not form solid tumors (National Cancer Institute, Dictionary of Cancer Terms).
  • V region means the segment of IgG chains which is variable in sequence between different antibodies. It extends to Rabat residue 109 in the light chain and 113 in the heavy chain.
  • RECIST 1.1 Response Criteria as used herein means the definitions set forth in Eisenhauer, E.A. et al., Eur. ./. Cancer 45:228-247 (2009) for target lesions or non-target lesions, as appropriate based on the context in which response is being measured.
  • mAbs that bind to human PD-l useful in the treatment methods, compositions, and uses of the invention, are described in US 7,521,051, US 8,008,449, and US 8,354,509.
  • Specific anti-human PD-l mAbs useful as the PD-l antagonist in the treatment methods, compositions, and uses of the present invention include: pembrolizumab (formerly known as MK-3475, SCH 900475 and lambrolizumab), a humanized IgG4 mAb with the structure described in WHO Drug Information, Vol. 27, No. 2, pages 161-162 (2013) and which comprises the heavy and light chain amino acid sequences shown in FIGURE 1, and the humanized antibodies h409Al 1, h409Al6 and h409Al7, which are described in WO
  • the anti-PD-l antibody, or antigen binding fragment thereof comprises: (a) light chain CDRs comprising a sequence of amino acids as set forth in SEQ ID NOs: 1, 2 and 3 and heavy chain CDRs comprising a sequence of amino acids as set forth in SEQ ID NOs: 6, 7 and 8; or (b) light chain CDRs comprising a sequence of amino acids as set forth in SEQ ID NOs: 11, 12 and 13 and heavy chain CDRs comprising a sequence of amino acids as set forth in SEQ ID NOs: 14, 15 and 16.
  • the anti-PD-l antibody or antigen binding fragment thereof is a human antibody.
  • the anti-PD-l antibody or antigen binding fragment thereof is a humanized antibody. In other embodiments, the anti-PD-l antibody or antigen binding fragment thereof is a chimeric antibody. In specific embodiments, the anti-PD-l antibody or antigen binding fragment thereof is a monoclonal antibody.
  • the PD-l antibody, or antigen binding fragment thereof specifically binds to human PD-l and comprises (a) a heavy chain variable region comprising an amino acid sequence as set forth in SEQ ID NO:9, or a variant thereof, and (b) a light chain variable region comprising an amino acid sequence selected from the group consisting of SEQ ID NO:4 or a variant thereof; SEQ ID NO:22 or a variant thereof; and SEQ ID NO:23 or a variant thereof.
  • a variant of a heavy chain variable region sequence or full-length heavy chain sequence is identical to the reference sequence except having up to 17 conservative amino acid substitutions in the framework region (i.e., outside of the CDRs), and preferably has less than ten, nine, eight, seven, six or five conservative amino acid substitutions in the framework region.
  • a variant of a light chain variable region sequence or full-length light chain sequence is identical to the reference sequence except having up to five conservative amino acid substitutions in the framework region (i.e., outside of the CDRs), and preferably has less than four, three or two conservative amino acid substitution in the framework region.
  • the PD-l antibody or antigen-binding fragment thereof is a monoclonal antibody which specifically binds to human PD-l and comprises (a) a heavy chain comprising or consisting of a sequence of amino acids as set forth in SEQ ID NO: 10, or a variant thereof; and (b) a light chain comprising or consisting of a sequence of amino acids as set forth in SEQ ID NO:5, or a variant thereof; SEQ ID NO:24, or a variant thereof; or SEQ ID NO:25, or a variant thereof.
  • the PD-l antibody or antigen-binding fragment thereof is a monoclonal antibody which specifically binds to human PD-l and comprises (a) a heavy chain comprising or consisting of a sequence of amino acids as set forth in SEQ ID NO: 10 and (b) a light chain comprising or consisting of a sequence of amino acids as set forth in SEQ ID NO:5.
  • Table 3 below provides a list of the amino acid sequences of exemplary anti-PD-l mAbs for use in the treatment methods, compositions, kits and uses of the present invention.
  • the invention provides a method of treating cancer in a human patient comprising administering about 400 mg of an anti -PD- 1 antibody, or antigen-binding fragment thereof, to the patient once every about six weeks, wherein the anti -PD- 1 antibody or antigen binding fragment thereof comprises: (a) light chain complementarity determining regions (CDRs) comprising a sequence of amino acids as set forth in SEQ ID NOs: 1, 2 and 3 and heavy chain CDRs comprising a sequence of amino acids as set forth in SEQ ID NOs: 6, 7 and 8; or (b) light chain CDRs comprising a sequence of amino acids as set forth in SEQ ID NOs: 11, 12 and 13 and heavy chain CDRs comprising a sequence of amino acids as set forth in SEQ ID NOs: 14, 15 and 16.
  • the anti-PD-l antibody, or antigen-binding fragment thereof is pembrolizumab.
  • the anti-PD-l antibody, or antigen binding fragment thereof is administered to the patient about once every six weeks for 12 weeks or more. In other embodiments, the anti-PD-l antibody, or antigen binding fragment thereof is
  • the invention comprises a method of treating cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every
  • the invention comprises a method of treating unresectable or metastatic melanoma in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the invention comprises a method of treating metastatic non-small cell lung cancer (NSCLC) in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • NSCLC metastatic non-small cell lung cancer
  • Embodiment E3-A the patient has a tumor with high PD-L1 expression [(Tumor Proportion Score (TPS) >50%)] and was not previously treated with platinum-containing chemotherapy.
  • TPS Tumor Proportion Score
  • Embodiment E3-B the patient has a tumor with PD-L1 expression (TPS >1%) and was previously treated with platinum- containing chemotherapy.
  • TPS tumor with PD-L1 expression
  • the patient had disease progression on or after receiving platinum-containing chemotherapy.
  • Embodiment E3-C the patient has a tumor with PD-L1 expression (TPS >1%) and was not previously treated with platinum- containing chemotherapy.
  • the patient’s tumor is not tested for PD-L1 expression.
  • the patient is treated with the anti-PD-l antibody, or antigen binding fragment thereof, regardless of PD-L1 expression.
  • the patient was not previously treated with platinum- containing chemotherapy.
  • the PD-L1 TPS is determined by an FDA-approved test.
  • the patient’s tumor has no EGFR or ALK genomic aberrations.
  • the patient’s tumor has an EGFR or ALK genomic aberration and had disease progression on or after receiving treatment for the EGFR or ALK aberration(s) prior to receiving the anti -PD- 1 antibody, or antigen binding fragment thereof.
  • the invention comprises a method of treating metastatic non-small cell lung cancer (NSCLC) in a human patient comprising: (1) administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks, and (2) administering pemetrexed and carboplatin to the patient.
  • an anti-PD-l antibody e.g., pembrolizumab
  • pemetrexed and carboplatin to the patient.
  • the patient was not previously treated with an anti -cancer therapeutic prior to starting the combination treatment regimen with the anti-PD-l antibody, or antigen binding fragment thereof, pemetrexed and carboplatin.
  • the patient has nonsquamous non-small cell lung cancer.
  • pemetrexed is administered to the patient in an amount of 500 mg/m 2 .
  • pemetrexed is administered to the patient via intravenous infusion every 21 days.
  • the infusion time is about 10 minutes.
  • the invention further comprises administering about 400 pg to about 1000 pg of folic acid to the patient once per day, beginning about 7 days prior to administering pemetrexed to the patient and continuing until about 21 days after the patient is administered the last dose of pemetrexed.
  • the folic acid is administered orally.
  • the invention further comprises administering about 1 mg of vitamin B i2 to the patient about 1 week prior to the first administration of pemetrexed and about every three cycles of pemetrexed administration (i.e., approximately every 9 weeks).
  • the vitamin B i2 is administered intramuscularly.
  • the invention further comprises administering about 4 mg of dexamethasone to the patient twice a day on the day before, the day of, and the day after pemetrexed administration.
  • the dexamethasone is administered orally.
  • the invention comprises a method of treating recurrent or metastatic head and neck squamous cell cancer (HNSCC) in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • HNSCC head and neck squamous cell cancer
  • an anti-PD-l antibody e.g., pembrolizumab
  • the patient was previously treated with platinum-containing chemotherapy.
  • the patient had disease progression on or after platinum-containing chemotherapy.
  • the invention comprises a method of treating refractory classical Hodgkin lymphoma (cHL) in a human patient comprising
  • an anti-PD-l antibody e.g., pembrolizumab
  • an antigen binding fragment thereof e.g., pembrolizumab
  • the invention comprises a method of treating classical Hodgkin lymphoma (cHL) in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks, wherein the patient has relapsed after (a) one or more lines of therapy for cHL, (b) 2 or more lines of therapy for cHL, or (c) 3 or more lines of therapy for cHL.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the patient is an adult patient.
  • the patient is a pediatric patient.
  • the invention comprises a method of treating locally advanced or metastatic urothelial carcinoma in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the patient is not eligible for cisplatin- containing chemotherapy.
  • the patient had disease progression during or following platinum-containing chemotherapy or within 12 months of neoadjuvant or adjuvant treatment with platinum-containing chemotherapy.
  • the patient’s tumor expresses PD-L1
  • the invention comprises a method of treating unresectable or metastatic, microsatellite instability-high (MSI-H) or mismatch repair (MMR) deficient solid tumors in a human patient comprising administering 400 mg of an anti- PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti- PD-l antibody e.g., pembrolizumab
  • Embodiment E9 the patient had disease progression following prior anti-cancer treatment.
  • the invention comprises a method of treating unresectable or metastatic, MSI-H or MMR deficient colorectal cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the patient had disease progression following prior treatment with a fluoropyrimidine, oxaliplatin, and irinotecan.
  • the invention comprises a method of treating recurrent locally advanced or metastatic gastric cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the invention comprises a method of treating recurrent locally advanced or metastatic gastroesophageal junction adenocarcinoma in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the patient’s tumor expresses PD-L1 [Combined Positive Score (CPS) >1]
  • the patient had disease progression on or after one or more prior lines of therapy.
  • the prior lines of therapy include fluoropyrimidine and platinum-containing chemotherapy.
  • the patient had disease progression on or after two or more prior lines of therapy including fluoropyrimidine- and platinum-containing chemotherapy.
  • the patient had disease progression on or after one or more prior lines of therapy including HER2/neu-targeted therapy.
  • the patient had disease progression on or after two or more prior lines of therapy including HER2/neu-targeted therapy.
  • the invention comprises a method of treating cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g. pembrolizumab), or antigen binding fragment thereof, to the patient once every
  • a cancer selected from the group consisting of: melanoma, lung cancer, head and neck cancer, bladder cancer, breast cancer, gastrointestinal cancer, multiple myeloma, hepatocellular cancer, lymphoma, renal cancer, mesothelioma, ovarian cancer, esophageal cancer, anal cancer, biliary tract cancer, colorectal cancer, cervical cancer, thyroid cancer, and salivary cancer.
  • the invention comprises a method of treating cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g. pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks, wherein the patient has small-cell lung cancer.
  • an anti-PD-l antibody e.g. pembrolizumab
  • an antigen binding fragment thereof e.g. pembrolizumab
  • the invention comprises a method of treating non-Hodgkin lymphoma in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g. pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti-PD-l antibody e.g. pembrolizumab
  • the non-Hodgkin lymphoma is primary mediastinal large B-cell lymphoma (PMBCL).
  • PMBCL primary mediastinal large B-cell lymphoma
  • the patient has refractory PMBCL.
  • the patient has relapsed after one or more prior lines of therapy.
  • the patient has relapsed after two or more prior lines of therapy.
  • the patient was not previously treated with another line of therapy.
  • the invention comprises a method of treating metastatic squamous NSCLC in a human patient comprising: (1) administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks, and (2) administering (i) carboplatin and paclitaxel, or (ii) carboplatin and nab-paclitaxel to the patient.
  • an anti-PD-l antibody e.g., pembrolizumab
  • an antigen binding fragment thereof e.g., pembrolizumab
  • the invention comprises a method of treating Merkel cell carcinoma (MCC) in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • MCC Merkel cell carcinoma
  • an anti-PD-l antibody e.g., pembrolizumab
  • the cancer is recurrent, locally advanced MCC.
  • sub-embodiments of an anti-PD-l antibody e.g., pembrolizumab
  • Embodiment El 7 the cancer is metastatic MCC.
  • the patient is an adult patient.
  • the patient is a pediatric patient.
  • the invention comprises a method for adjuvant therapy of melanoma in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to a patient once every approximately six weeks, wherein the patient has previously had one or more melanoma lesions resected.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the method comprises treating resected high-risk stage IP melanoma.
  • the invention comprises a method of treating hepatocellular carcinoma (HCC) in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the patient was previously treated with sorafenib.
  • the invention comprises a method of treating renal cell carcinoma (RCC) in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • RCC renal cell carcinoma
  • the cancer is advanced clear cell RCC.
  • the patient has advanced or metastatic renal cell carcinoma (RCC).
  • RCC metastatic renal cell carcinoma
  • Embodiment E20 the patient is further treated with axitinib.
  • axitinib is taken orally.
  • 5 mg axitinib is taken by the patient approximately every 12 hours or twice a day.
  • the axitinib dosage is 2.5 mg, 3 mg, 7 mg, or 10 mg twice daily.
  • the invention comprises a method of treating breast cancer in a human patient comprising administering 400 mg of an anti- PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti- PD-l antibody e.g., pembrolizumab
  • the breast cancer is triple negative breast cancer.
  • the breast cancer is ER+/HER2- breast cancer.
  • the invention comprises a method of treating nasopharyngeal cancer in a human patient comprising administering 400 mg of an anti -PD- 1 antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti -PD- 1 antibody e.g., pembrolizumab
  • the invention comprises a method of treating thyroid cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the invention comprises a method of treating salivary cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the invention comprises a method of treating cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks, wherein the cancer is selected from the group consisting of: melanoma, non-small cell lung cancer, relapsed or refractory classical Hodgkin lymphoma, primary mediastinal large B-cell lymphoma, head and neck squamous cell cancer, urothelial carcinoma, esophageal cancer, gastric cancer, cervical cancer, PMBCL, MSI-H cancer, hepatocellular carcinoma, and Merkel cell carcinoma.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the cancer is selected from the group consisting of: melanoma, non-small cell lung cancer, relapsed or refractory classical Hodgkin lymphoma, primary mediastinal large B-cell lymphoma, head and neck
  • the invention comprises a method of treating cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks, wherein the cancer is a Heme malignancy.
  • an anti-PD-l antibody e.g., pembrolizumab
  • an antigen binding fragment thereof e.g., pembrolizumab
  • the heme malignancy is selected from the group consisting of: acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myeloid leukemia (CML), diffuse large B-cell lymphoma (DLBCL), EBV-positive DLBCL, primary mediastinal large B-cell lymphoma, T- cell/histiocyte-rich large B-cell lymphoma, follicular lymphoma, Hodgkin’s lymphoma (HL), mantle cell lymphoma (MCL), multiple myeloma (MM), myeloid cell leukemia- 1 protein (MCL- 1), myelodysplastic syndrome (MDS), non-Hodgkin lymphoma (NHL), and small lymphocytic lymphoma (SLL).
  • ALL acute lymphoblastic leukemia
  • AML acute myeloid leukemia
  • CLL chronic lymphocytic leukemia
  • the invention comprises a method of treating cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks, wherein the patient has a tumor with a high mutational burden.
  • an anti-PD-l antibody e.g., pembrolizumab
  • a high mutational burden is at least about 10 mutations per megabase of genome examined, at least about 11 mutations per megabase of genome examined, at least about 12 mutations per megabase of genome examined, or at least about 13 mutations per megabase of genome examined.
  • the invention comprises a method of treating esophageal cancer in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • an anti-PD-l antibody e.g., pembrolizumab
  • the patient progressed with one previous line of standard therapy prior to receiving the anti-PD-l antibody, or antigen binding fragment thereof.
  • the patient progressed with one or more lines of standard therapy prior to receiving the anti-PD-l antibody, or antigen binding fragment thereof.
  • the patient progressed with two or more lines of standard therapy prior to receiving the anti-PD-l antibody, or antigen binding fragment thereof.
  • the standard therapy includes one or more of: paclitaxel, docetaxel, or irinotecan.
  • the patient has advanced or metastatic adenocarcinoma or squamous cell carcinoma of the esophagus.
  • the patient has advanced or metastatic Siewert type I adenocarcinoma of the esophagogastric junction.
  • the patient’s tumor expresses PD-Ll (Combined Positive Score [CPS] >10).
  • the invention comprises a method of treating high-risk non-muscle invasive bladder cancer (NMIBC) in a human patient comprising administering 400 mg of an anti-PD-l antibody (e.g., pembrolizumab), or antigen binding fragment thereof, to the patient once every approximately six weeks.
  • NMIBC high-risk non-muscle invasive bladder cancer
  • the patient has NMIBC with carcinoma in situ (CIS) or CIS plus papillary disease.
  • the patient was previously treated with standard therapy prior to being treated with the anti-PD-l antibody, or antigen binding fragment thereof.
  • the prior therapy is Bacillus Calmette-Guerin (BCG) therapy.
  • BCG Bacillus Calmette-Guerin
  • the patient did not respond to BCG therapy.
  • the patient was ineligible for radical cystectomy or chose not to undergo radical cystectomy.
  • the PD-l antibody or antigen binding fragment is any of the antibodies or antigen binding fragments described in Section II of the Detailed Description of the Invention“PD-l Antibodies and Antigen Binding Fragments ETseful in the Invention” herein.
  • the anti-PD-l antibody is pembrolizumab or an antigen-binding fragment thereof, or an antibody which cross competes with pembrolizumab for binding to human PD-l .
  • the anti-PD-l antibody is a variant of pembrolizumab; i.e. an antibody or antigen binding fragment having light chain CDRs comprising a sequence of amino acids as set forth in SEQ ID NOs: 1, 2 and 3 and heavy chain CDRs comprising a sequence of amino acids as set forth in SEQ ID NOs: 6, 7 and 8.
  • the PD-l antibody or antigen binding fragment is administered to the patient once every approximately six weeks.
  • the PD-l antibody or antigen binding fragment is administered to the patient every six weeks, every six weeks ⁇ 5 days, ⁇ 4 days, ⁇ 3 days, ⁇ 2 days or ⁇ 1 day.
  • a patient is administered an intravenous (IV) infusion of a medicament comprising any of the anti-PD-l antibodies or antigen-binding fragments described herein.
  • IV intravenous
  • the patient is administered (e.g., by a clinician) or administers any of the anti-PD-l antibodies or antigen binding fragments subcutaneously.
  • the method may further comprise one or more“additional therapeutic agents” (as used herein,“additional therapeutic agent” refers to an additional agent relative to the anti-PD-l antibody or antigen-binding fragment thereof).
  • the additional therapeutic agent may be, e.g., a chemotherapeutic other than an anti-PD-l antibody, a biotherapeutic agent (including but not limited to antibodies to CTLA4, VEGF, EGFR, Her2/neu, VEGF receptors, other growth factor receptors, CD20, CD40, CD-40L, OX-40, 4-1BB, and ICOS), an immunogenic agent (for example, attenuated cancerous cells, tumor antigens, antigen presenting cells such as dendritic cells pulsed with tumor derived antigen or nucleic acids, immune stimulating cytokines (for example, IL-2, IFNa2, GM-CSF), and cells transfected with genes encoding immune stimulating cytokines such as but not limited to GM-CSF).
  • a chemotherapeutic other than an anti-PD-l antibody e.g., a chemotherapeutic other than an anti-PD-l antibody
  • a biotherapeutic agent including but not limited to antibodies to CTLA4, VEGF
  • the method further comprises administering an additional therapeutic agent.
  • the additional therapeutic agent is an anti-CTLA4 antibody or antigen binding fragment thereof, an anti-LAG3 antibody or antigen binding fragment thereof, an anti-GITR antibody, or antigen binding fragment thereof, an anti-TIGIT antibody, or antigen binding fragment thereof, an anti-CD27 antibody or antigen binding fragment thereof, an anti-ILT3 antibody, or antigen binding fragment thereof, or an anti-ILT4 antibody, or antigen binding fragment thereof.
  • the additional therapeutic agent is a Newcastle disease viral vector expressing IL-12.
  • the additional therapeutic agent is dinaciclib.
  • the additional therapeutic agent is navarixin.
  • the additional therapeutic agent is vicriviroc.
  • the additional therapeutic agent is an oncolytic virus.
  • the additional therapeutic agent is Coxsackievirus or CVA21.
  • the additional therapeutic agent is CAVATAKTM.
  • the additional therapeutic agent is a STING agonist.
  • the additional therapeutic agent is an IL-27 antagonist. In one embodiment, the additional therapeutic agent is a PARP inhibitor. In one embodiment, the additional therapeutic agent is a multi-kinase inhibitor. In one embodiment, the additional therapeutic agent is a MEK inhibitor. In one embodiment, the additional therapeutic agent is a 4- 1BB agonist.
  • chemotherapeutic agents include alkylating agents such as thiotepa and cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan;
  • aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphoramide and trimethylolomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin;
  • callystatin including its adozelesin, carzelesin and bizelesin synthetic analogues
  • cryptophycins particularly cryptophycin 1 and cryptophycin 8
  • dolastatin duocarmycin
  • cholophosphamide estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustine; antibiotics such as the enediyne antibiotics (e.g. calicheamicin, especially calicheamicin gammall and calicheamicin phill, see, e.g., Agnew, Chem. Inti. Ed.
  • dynemicin including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromomophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin,
  • daunorubicin detorubicin, 6-diazo-5-oxo-L-norleucine, doxorubicin (including morpholino- doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C,
  • mycophenolic acid nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6- mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6- azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine;
  • androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone;
  • elformithine elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2- ethylhydrazide; procarbazine; razoxane; rhizoxin; sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2, 2',2''-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine;
  • mitolactol pipobroman; gacytosine; arabinoside (“Ara-C”); cyclophosphamide; thiotepa;
  • taxoids e.g. paclitaxel and doxetaxel; chlorambucil; gemcitabine; 6-thioguanine;
  • mercaptopurine methotrexate
  • platinum analogs such as cisplatin and carboplatin
  • vinblastine platinum
  • platinum etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine; vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; CPT-l l; topoisomerase inhibitor RFS 2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid;
  • DMFO difluoromethylornithine
  • capecitabine and pharmaceutically acceptable salts, acids or derivatives of any of the above.
  • anti-hormonal agents that act to regulate or inhibit hormone action on tumors
  • SERMs selective estrogen receptor modulators
  • tamoxifen raloxifene
  • droloxifene 4-hydroxytamoxifen
  • trioxifene keoxifene
  • aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)- imidazoles, aminoglutethimide, megestrol acetate, exemestane, formestane, fadrozole, vorozole, letrozole, and anastrozole; and anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; and pharmaceutically acceptable salts, acids or derivatives of any of the above.
  • the additional therapeutic agent in the combination therapy may be any additional therapeutic agent (i.e., in addition to the PD-l antibody (e.g., pembrolizumab) or antigen-binding fragment thereof).
  • the additional therapeutic agent in the combination therapy may be any additional therapeutic agent (i.e., in addition to the PD-l antibody (e.g., pembrolizumab) or antigen-binding fragment thereof).
  • the patient receives a lower total amount of the additional therapeutic agent in the combination therapy than when that agent is used as monotherapy, e.g., smaller doses, less frequent doses, and/or shorter treatment duration.
  • the additional therapeutic agent in a combination therapy can be administered orally, intratumorally, or parenterally, including the intravenous, intramuscular, intraperitoneal, subcutaneous, rectal, topical, and transdermal routes of administration.
  • the combination treatment may comprise an anti -PD- 1 antibody or antigen binding fragment thereof, and an anti-CTLA antibody or antigen binding fragment thereof, both of which may be administered intravenously or subcutaneously, as well as a chemotherapeutic agent, which may be administered orally.
  • a combination therapy of the invention may be used prior to or following surgery to remove a tumor and may be used prior to, during or after radiation therapy.
  • a combination therapy of the invention may also be used when a patient’s tumor is non-resectable.
  • a combination therapy of the invention is administered to a patient who has not been previously treated with a biotherapeutic or chemotherapeutic agent, i.e., is treatment-naive.
  • the combination therapy is administered to a patient who failed to achieve a sustained response after prior therapy with a biotherapeutic or
  • chemotherapeutic agent i.e., is treatment-experienced.
  • a combination therapy of the invention may be used to treat a tumor that is large enough to be found by palpation or by imaging techniques well known in the art, such as MRI, ultrasound, or CAT scan.
  • a combination therapy of the invention is used to treat an advanced stage tumor having dimensions of at least about 200 mm 3, 300 mm 3 , 400 mm 3 , 500 mm 3 , 750 mm 3 , or up to 1000 mm 3 .
  • a combination therapy of the invention is administered to a human patient who has a cancer that expresses PD-L1.
  • PD-L1 expression is detected using a diagnostic anti-human PD-L1 antibody, or antigen binding fragment thereof, in an IHC assay on an FFPE or frozen tissue section of a tumor sample removed from the patient.
  • a patient’s physician may order a diagnostic test to determine PD-L1 expression in a tumor tissue sample removed from the patient prior to initiation of treatment with the anti -PD- 1 antibody, or antigen-binding fragment thereof, but it is envisioned that the physician could order the first or subsequent diagnostic tests at any time after initiation of treatment, such as for example after completion of a treatment cycle.
  • Selecting a dosage of the additional therapeutic agent depends on several factors, including the serum or tissue turnover rate of the entity, the level of symptoms, the
  • the dosage of the additional therapeutic agent should be an amount that provides an acceptable level of side effects. Accordingly, the dose amount and dosing frequency of each additional therapeutic agent (e.g. biotherapeutic or chemotherapeutic agent) will depend in part on the particular therapeutic agent, the severity of the cancer being treated, and patient characteristics. Guidance in selecting appropriate doses of antibodies, cytokines, and small molecules are available. See, e.g., Wawrzynczak (1996) Antibody Therapy , Bios Scientific Pub.
  • Determination of the appropriate dosage regimen may be made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment or predicted to affect treatment, and will depend, for example, the patient's clinical history (e.g., previous therapy), the type and stage of the cancer to be treated and biomarkers of response to one or more of the therapeutic agents in the combination therapy.
  • the invention also relates to compositions comprising a dosage of an anti -PD- 1 antibody (e.g., pembrolizumab) or antigen binding fragment thereof and a pharmaceutically acceptable carrier or excipient, wherein the dosage is about 400 mg.
  • an anti -PD- 1 antibody e.g., pembrolizumab
  • the anti-PD-l antibody may be produced, for example, in CHO cells using conventional cell culture and
  • the composition further comprises histidine buffer at about pH 5.0 to pH 6.0.
  • the histidine is present in a concentration of about 10 mM.
  • the composition further comprises sucrose.
  • sucrose is present in a concentration of about 70 mg/mL.
  • the composition further comprises polysorbate 80.
  • the polysorbate 80 is present in a concentration of about 0.2 mg/mL.
  • the composition comprises 10 mM histidine, pH 5.5, 7% sucrose, 0.02% polysorbate 80, and 400 mg of the anti-PD-l antibody or antigen-binding fragment thereof.
  • the composition is liquid.
  • the composition is lyophilized.
  • the anti-PD-l antibody or antigen binding fragment thereof can be any of the antibodies and antigen binding fragments described herein, i.e. described in Section P of the Detailed Description of the Invention“PD-l Antibodies and Antigen Binding Fragments ETseful in the Invention” (e.g. pembrolizumab).
  • a composition comprising an anti-PD-l antibody as the PD-l antagonist may be provided as a liquid formulation or prepared by reconstituting a lyophilized powder with sterile water for injection prior to use.
  • WO 2012/135408 describes the preparation of liquid and lyophilized medicaments comprising pembrolizumab that are suitable for use in the present invention.
  • the invention also relates to a kit for treating a patient with cancer, the kit comprising: (a) 400 mg of an anti -PD- 1 antibody or antigen binding fragment thereof, and (b) instructions for using the anti -PD- 1 antibody or antigen binding fragment thereof in any of the methods for treating cancer described herein.
  • the PD-l antibody or antigen binding fragment can be any of the antibodies or antigen-binding fragments described in Section II of the Detailed Description of the Invention“PD-l Antibodies and Antigen Binding Fragments Useful in the Invention”.
  • kits of the invention may provide the anti -PD-l or antigen-binding fragments thereof in a container and a package insert.
  • the container contains at least one dose (i.e. about 400 mg) of a medicament comprising an anti -PD-l antibody, or antigen binding fragment thereof, and the package insert, or label, which comprises instructions for treating a patient with cancer using the medicament.
  • the container may be comprised of the same or different shape (e.g., vials, syringes and bottles) and/or material (e.g., plastic or glass).
  • the kit may further comprise other materials that may be useful in administering the medicaments, such as diluents, filters, IV bags and lines, needles and syringes.
  • the instructions state that the medicament is intended for use in treating a patient having a tumor, wherein the tumor expresses PD-L1 by, e.g., an IHC assay.
  • the tumor has a tumor proportion score (TPS) of >1% PD-L1.
  • TPS tumor proportion score
  • a PD-L1 TPS is the number of tumor cells in a sample expressing PD-L1.
  • the tumor has a TPS of >5% PD-L1, >10 PD-L1, >15% PD-L1, >20% PD- Ll, >25% PD-L1, >30% PD-L1, >35% PD-L1, >40% PD-L1, or >45% PD-L1.
  • the patient’s tumor expresses PD-L1 with a CPS of >10%.
  • the patient’s tumor expresses PD-L1 with a CPS of >5%. In another embodiment, the patient’s tumor expresses PD-L1 with a CPS of >1%.
  • Monoclonal, polyclonal, and humanized antibodies can be prepared (see, e.g, Sheperd and Dean (eds.) (2000) Monoclonal Antibodies, Oxford Univ. Press, New York, NY; Kontermann and Dubel (eds.) (2001) Antibody Engineering, Springer-Verlag, New York; Harlow and Lane (1988) Antibodies A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, pp. 139-243; Carpenter, et al. (2000) J. Immunol. 165:6205; He, et al. (1998) J. Immunol. 160:1029; Tang et al. (1999) J. Biol. Chem.
  • Antibodies can be conjugated, e.g, to small drug molecules, enzymes, liposomes, polyethylene glycol (PEG).
  • Antibodies are useful for therapeutic, diagnostic, kit or other purposes, and include antibodies coupled, e.g. , to dyes, radioisotopes, enzymes, or metals, e.g. , colloidal gold (see, e.g., Le Doussal et al. (1991) J. Immunol. 146: 169-175; Gibellini et al.
  • FACS Fluorescence Activated Cell Sorting
  • Fluorescent reagents suitable for modifying nucleic acids including nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g, as diagnostic reagents, are available (Molecular Probesy (2003) Catalogue, Molecular Probes, Inc., Eugene, OR; Sigma- Aldrich (2003) Catalogue, St. Louis, MO).
  • Pembrolizumab, an anti -PD- 1 checkpoint inhibitor currently approved for use in multiple cancer indications has demonstrated safety and efficacy when administered at a dose of either 200 mg or 2 mg/kg Q3W.
  • An alternative extended dosing regimen would provide the benefits of convenience and flexibility to both patients and prescribes. The robust
  • PK pharmacokinetics
  • E-R exposure-concentration- response
  • the dose for a Q6W schedule of pembrolizumab was selected by matching exposures with the approved Q3W (200 mg and 2 mg/kg) regimens after PK steady state is achieved; the efficacy and safety between regimens were bridged based on knowledge of E-R.
  • PK exposures were simulated up to 24 weeks of dosing, to ensure steady state in all subjects, using the established population PK model (with time dependent elimination) of pembrolizumab that adequately described PK across multiple tumor types. Efficacy was bridged using exposure metrics at steady state, AUCss or time-averaged concentration (Cavg,ss) and trough
  • the PK of pembrolizumab after administration of 400 mg Q6W is predicted to follow a similar profile as the PK at the approved 200 mg Q3W and 2 mg/kg Q3W dosing regimens (see FIG. 4).
  • the exposure metrics as compared between regimens are summarized in Table 4.
  • the 400 mg Q6W dosing regimen of pembrolizumab was selected based on similar predicted exposures (Cavg,ss or AUCss, geometric mean (GM) -1% higher) compared with those achieved at 200 mg Q3W (see FIG. 3). Less than 1% subjects were predicted to have Cmin,ss that are lower in comparison with those at 200 mg Q3W and 2 mg/kg Q3W (FIG. 3).
  • the predicted Cmax,ss for 400 mg Q6W are well below (GM -65% lower) that achieved with 10 mg/kg Q2W, which has been shown to have acceptable safety across multiple tumor types (see FIG. 2).
  • the clinical outcomes achieved with 400 mg Q6W are expected to be similar to those with 200 mg Q3W across tumor types.
  • PK simulations demonstrate that in terms of pembrolizumab exposures - Average concentration over the dosing interval (Cavg) (or area under the curve [AUC]) at 400 mg Q6W was similar to that at the approved 200 mg Q3W dose, thus bridging efficacy between dosing regimens.
  • Trough concentrations (Cmin) at 400 mg Q6W were generally within the range of those achieved with 2 mg/kg or 200 mg Q3W in the majority (>99%) of patients.
  • Peak concentrations (Cmax) at 400 mg Q6W were well below the Cmax for the highest clinically tested dose of 10 mg/kg Q2W, supporting that the safety profile for 400 mg Q6W should be comparable to the established safety profile of pembrolizumab.
  • Exposure-response (E-R) for pembrolizumab was demonstrated to be flat across indications, and OS predictions in melanoma and NSCLC demonstrate that efficacy at 400 mg Q6W is expected to be similar to that at 200 mg or 2 mg/kg Q3W, given the similar exposures; thus 400 mg Q6W is expected to be efficacious across indications.
  • This study is designed to assess the pharmacokinetics (PK), safety and tolerability of pembrolizumab when administered every 6 weeks (Q6W).
  • PK pharmacokinetics
  • Q6W pharmacokinetics
  • a cohort of 100 participants is given 400 mg pembrolizumab Q6W.
  • PK, efficacy, and safety data are collected from this cohort of participants.
  • Male/female participants of at least 18 years of age with advanced melanoma are enrolled in the study. No stratification based on age, sex, or other characteristics is used in this study.
  • PK, efficacy, and safety data are collected from these participants. Results provide preliminary PK, efficacy, and safety data of pembrolizumab when administered Q6W. Based on the robust understanding of pembrolizumab clinical pharmacology and its well-established E-R profiles, such a dosing schedule change is expected to produce similar efficacy and safety in all treatment settings where 200 mg Q3W pembrolizumab is approved (including monotherapy and in combination with other agents). Thus, a 400 mg Q6W regimen would have a similar benefit- risk profile to 200 mg Q3W, as a less frequent dosing regimen in the clinical use of
  • pembrolizumab based on modeling and simulation analyses (see EXAMPLE 1).
  • the study which is a randomized, cross-over, multicenter, open-label, safety study of pembrolizumab in participants with advanced melanoma, is conducted in conformance with Good Clinical Practices (GCP).
  • GCP Good Clinical Practices
  • This Phase 1 study is conducted in participants with unresectable or metastatic melanoma.
  • the treatment period continues every 42 days for up to 18 cycles (approximately 2 years). Treatment will continue as long as participants are receiving benefit from treatment and have not had disease progression or met any criteria for study withdrawal.
  • the study consists of: (1) A screening period of up to a 28-day duration to ensure that the participant is eligible for the study and (2) an intervention period of approximately 104 weeks of treatment with pembrolizumab.
  • Participants receive pembrolizumab via IV infusion over 30 minutes Q6W for up to 18 cycles, and (3) a follow-up period during which participants are monitored for AEs for 30 days and serious adverse events (SAEs) for 90 days (30 days if the participant initiates new anticancer therapy). Participants with an ongoing AE at the time of treatment discontinuation are followed until resolution, stabilization, the event is otherwise explained, or the participant is lost to follow-up.
  • SAEs serious adverse events
  • PK data is analyzed after all participants complete Cycle 5.
  • PK parameters include AUC, Cmax, and Cmin.
  • Formation of Anti drug Antibodies (ADA) can potentially confound drug exposures at therapeutic doses and prime for subsequent infusion-related toxicity.
  • Antidrug antibody response to pembrolizumab at the beginning of each of Cycles 1, 2, 4, and 5 are determined. Any impact of presence of AD As on exposure of pembrolizumab is explored.
  • This study uses ORR based on RECIST 1.1 criteria as assessed by blinded independent central review (BICR) as the primary endpoint .
  • Objective response rate is an acceptable measure of clinical benefit for a late stage study that demonstrates superiority of a new antineoplastic therapy, especially if the magnitude of the effect is large and the therapy has an acceptable risk/benefit profile. Images are submitted to an imaging CRO (iCRO) and read by independent central review blinded to treatment assignment to minimize bias in the response assessments.
  • iCRO imaging CRO
  • RECIST 1.1 is used by the BICR when assessing images for efficacy measures and by the local site when determining eligibility.
  • Modified RECIST 1.1 for immune-based therapeutics (iRECIST) assessment has been developed and published by the RECIST Working Group, with input from leading experts from industry andTECH, along with participation from the US Food and Drug Administration and the European Medicines Agency. The unidimensional measurement of target lesions, qualitative assessment of non-target lesions, and response categories are identical to RECIST 1.1, until progression is seen by RECIST 1.1.
  • iRECIST is used by investigators to assess tumor response and progression and to make treatment decisions as well as for exploratory efficacy analyses where specified.
  • BRAF V600 mutant melanoma may have received standard of care targeted therapy (e.g., BRAF/MEK inhibitor, alone or in combination) and be eligible for this study
  • Prior adjuvant or neoadjuvant melanoma therapy is permitted if it was completed at least 4 weeks before randomization and all related AEs have either returned to baseline or stabilized (resolution of toxic effect(s) of the most recent prior therapy to Grade 1 or less [except alopecia]). If subject received major surgery or radiation therapy of >30 Gy, they must have recovered from the toxicity and/or complications from the intervention.
  • a female participant is eligible to participate if she is not pregnant, not breastfeeding, and agrees to follow specific contraceptive guidance during the treatment period and for at least 120 days or provides informed consent.
  • a participant should have an Eastern Cooperative Oncology Group (ECOG) performance status 0 (fully active, able to carry on all pre-disease performance without restriction) or 1 (restricted in physically strenuous activity but ambulatory and able to carry out work of a light or sedentary nature, e.g., light house work, office work) and should have adequate organ function as defined in Table 5. Specimens are collected within 72 hours prior to the start of study intervention.
  • ECOG Eastern Cooperative Oncology Group
  • the participant is a woman of child-bearing potential (WOCBP) who has a positive urine pregnancy test within 72 hours prior to randomization or treatment allocation. If the urine test is positive or cannot be confirmed as negative, a serum pregnancy test is required.
  • WOCBP child-bearing potential
  • the participant has received prior therapy with an anti-PD-l, anti-PD-Ll, or anti-PD-L2 or with an agent directed to another stimulatory or co-inhibitory T-cell receptor (e.g., OX- 40 and CD 137) or any other antibody or drug specifically targeting checkpoint pathways other than anti-CTLA-4 which is permitted in the adjuvant setting.
  • an anti-PD-l, anti-PD-Ll, or anti-PD-L2 or with an agent directed to another stimulatory or co-inhibitory T-cell receptor (e.g., OX- 40 and CD 137) or any other antibody or drug specifically targeting checkpoint pathways other than anti-CTLA-4 which is permitted in the adjuvant setting.
  • another stimulatory or co-inhibitory T-cell receptor e.g., OX- 40 and CD 137
  • any other antibody or drug specifically targeting checkpoint pathways other than anti-CTLA-4 which is permitted in the adjuvant setting.
  • live vaccines include, but are not limited to, the following: measles, mumps, rubella, varicella/zoster (chicken pox), yellow fever, rabies, Bacillus
  • BCG Calmette-Guerin
  • typhoid vaccine typhoid vaccine.
  • Seasonal influenza vaccines for injection are generally killed virus vaccines and are allowed; however, intranasal influenza vaccines (e.g., FluMist®) are live attenuated vaccines and are not allowed.
  • investigational agent or has used an investigational device within 4 weeks prior to the first dose of study intervention.
  • the participant has a diagnosis of immunodeficiency or is receiving chronic systemic steroid therapy (in dosing exceeding 10 mg daily of prednisone equivalent) or any other form of immunosuppressive therapy within 7 days prior the first dose of study drug.
  • the participant has a known additional malignancy that is progressing or has required active treatment within the past 2 years.
  • Participants with basal cell carcinoma of the skin, squamous cell carcinoma of the skin, or carcinoma in situ (e.g., breast carcinoma, cervical cancer in situ) that have undergone potentially curative therapy are not excluded.
  • the participant has known active CNS metastases and/or carcinomatous meningitis.
  • Participants with previously treated brain metastases may participate provided they are radiologically stable, (i.e., without evidence of progression) for at least 4 weeks by repeat imaging (note that the repeat imaging should be performed during study screening), clinically stable and without requirement of steroid treatment for at least 14 days prior to first dose of study intervention.
  • the participant has severe hypersensitivity (> Grade 3) to pembrolizumab and/or any of its excipients.
  • the participant has ocular melanoma. • The participant has an active autoimmune disease that has required systemic treatment in past 2 years (i.e., with use of disease modifying agents, corticosteroids or
  • Replacement therapy e.g., thyroxine, insulin, or physiologic corticosteroid replacement therapy for adrenal or pituitary insufficiency
  • Replacement therapy is not considered a form of systemic treatment and is allowed.
  • the participant has a history of (non-infectious) pneumonitis that required steroids or has current pneumonitis.
  • the participant has a known history of human immunodeficiency virus (HIV) infection.
  • HIV human immunodeficiency virus
  • Hepatitis B defined as Hepatitis B surface antigen [HBsAg] reactive
  • HCV RNA known active Hepatitis C virus
  • the participant has a history or current evidence of any condition, therapy, or laboratory abnormality that might confound the results of the study, interfere with the participant's participation for the full duration of the study, or is not in the best interest of the participant to participate, in the opinion of the treating investigator.
  • the participant has a known psychiatric or substance abuse disorder that would interfere with cooperating with the requirements of the study.
  • Discontinuation of study intervention does not represent withdrawal from the study. As certain data on clinical events beyond study intervention discontinuation may be important to the study, they must be collected through the participant’s last scheduled follow-up, even if the participant has discontinued study intervention. Therefore, all participants who discontinue study intervention prior to completion of the protocol-specified treatment period will still continue to participate in the study.
  • Participants may discontinue study intervention at any time for any reason or be dropped from the study intervention at the discretion of the investigator should any untoward effect occur.
  • a participant may be discontinued from study intervention by the investigator if study intervention is inappropriate, the study plan is violated, or for administrative and/or other safety reasons.
  • a participant must be discontinued from study intervention but continue to be monitored in the study for any of the following reasons:
  • the participant has a medical condition or personal circumstance which, in the opinion of the investigator, placed the participant at unnecessary risk from continued administration of study intervention.
  • the participant has any progression or recurrence of any malignancy, or any occurrence of another malignancy that requires active treatment
  • the participant has intercurrent illness other than another malignancy as noted above that prevents further administration of treatment.
  • a participant is withdrawn from the study if the participant or participant’s legally acceptable representative withdraws consent from the study. If a participant withdraws from the study, they will no longer receive study treatment or be followed at scheduled protocol visits.
  • the investigator or medically qualified designee obtains documented consent from each potential participant or each participant’s legally acceptable representative prior to participating in a clinical study. If there are changes to the participant’s status during the study (e.g., health or age of majority requirements), the investigator or medically qualified designee ensures the appropriate consent is in place.
  • Tumor assessments include all known or suspected disease sites. Imaging may include chest, abdomen, and pelvis computed tomography (CT) or magnetic resonance imaging (MRI) at baseline and when disease progression or brain metastases is suspected. Tumor imaging is strongly preferred to be acquired by CT. For chest, abdomen and pelvis, contrast-enhanced MRI may be used when CT with iodinated contrast is contraindicated, or when mandated by local practice. For the brain, MRI is the strongly preferred imaging modality.
  • CT computed tomography
  • MRI magnetic resonance imaging
  • imaging modality technique ideally the same scanner, and consistent use of contrast
  • Consistent use of imaging techniques will help to optimize the reproducibility of the assessment of existing and new tumor burden, and to improve the accuracy of the assessment of response or progression.
  • All scheduled images for all study participants are reviewed by the investigator for disease progression.
  • images including those obtained via other modalities
  • images that are obtained at an unscheduled time point to determine disease progression (as well as imaging obtained for other reasons, but that capture radiologic progression based on investigator assessment), are also be filed at the study site.
  • Initial tumor imaging at screening is performed within 28 days prior to the date of first dose. Any imaging obtained after Cycle 1 Day 1 of treatment is not included in the screening assessment.
  • the site study team reviews screening images to confirm the participant has measurable disease per RECIST 1.1. If brain imaging is performed to document the stability of existing metastases, MRI is used if possible. If MRI is medically contraindicated, CT with contrast is an acceptable alternative.
  • the first on-study imaging assessment is performed at 12 weeks (84 days ⁇ 7 days]) from the date of first dose. Subsequent tumor imaging is performed every 9 weeks (63 days ⁇ 7 days) or more frequently if clinically indicated. After 52 weeks (365 days ⁇ 7 days), participants who remain on treatment will have imaging performed every 12 weeks (84 days ⁇ 7 days).
  • Tumor imaging to confirm PR or CR is performed at least 4 weeks after the first indication of a response is observed. Participants will then return to regular scheduled imaging, starting with the next scheduled imaging time point. Participants who receive additional imaging for confirmation do not need to undergo the next scheduled tumor imaging if it is less than 4 weeks later; tumor imaging may resume at the subsequent scheduled imaging time point.
  • Participants who have unconfirmed disease progression may continue on treatment at the discretion of the investigator until progression is confirmed by the site. Participants who receive confirmatory imaging do not need to undergo the next scheduled tumor imaging if it is less than 4 weeks later; tumor imaging may resume at the subsequent scheduled imaging time point, if clinically stable. Participants who have confirmed disease progression by iRECIST, as assessed by the site, will discontinue study treatment.
  • tumor imaging is performed at the time of treatment discontinuation ( ⁇ 4 week window). If previous imaging was obtained within 4 weeks prior to the date of discontinuation, then imaging at treatment discontinuation is not mandatory. For participants who discontinue study intervention due to documented disease progression, this is the final required tumor imaging if the investigator elects not to implement iRECIST.
  • RECIST 1.1 is used as the primary measure for assessment of tumor response, date of disease progression, and as a basis for all protocol guidelines related to disease status (e.g., discontinuation of study intervention). Although RECIST 1.1 references a maximum of 5 target lesions in total and 2 per organ, this protocol allows a maximum of 10 target lesions in total and 5 per organ, if clinically relevant to enable a broader sampling of tumor burden.
  • iRECIST is based on RECIST 1.1, but adapted to account for the unique tumor response seen with immunotherapeutic drugs. iRECIST will be used by the investigator to assess tumor response and progression, and make treatment decisions. When clinically stable, participants are not discontinued until progression is confirmed by the investigator, working with local radiology. This allowance to continue treatment despite initial radiologic PD takes into account the observation that some participants can have a transient tumor flare in the first few months after the start of immunotherapy, and then experience subsequent disease response.
  • Any participant deemed clinically unstable is discontinued from study intervention at the time when site-assessed first radiologic evidence of PD, and is not required to have repeat tumor imaging for confirmation of PD by iRECIST. If the investigator decides to continue treatment, the participant may continue to receive study intervention and the tumor assessment should be repeated 4 to 8 weeks later to confirm PD by iRECIST, per investigator assessment. If repeat imaging does not confirm PD per iRECIST, as assessed by the investigator, and the participant continues to be clinically stable, study intervention continues and follows the regular imaging schedule. If PD is confirmed, participants are discontinued from study intervention.
  • Safety assessments include the collection of AEs and SAEs, monitoring of vital signs and laboratory assessments (including pregnancy tests), performance of electrocardiograms (ECGs) and physical examinations, and verification of concurrent medications.
  • ECGs electrocardiograms
  • the investigator or qualified designee assesses each subject to evaluate for potential new or worsening AEs and more frequently if clinically indicated.
  • Assessment of AEs includes, but is not limited to, the type, incidence, severity (graded by the National Cancer Institute Common Terminology Criteria for Adverse Events [NCI CTCAE] Version 4.0), timing, seriousness, and relatedness to study drug. Adverse events that occur during the study, including baseline signs and symptoms, are recorded.
  • Vital signs are measured in a semi-supine position after 5 minutes rest and include temperature, systolic and diastolic blood pressure, respiratory rate, pulse rate, and weight. Height is collected at screening only. Electrocardiograms
  • a standard l2-lead ECG is performed using local standard procedures. Clinically significant abnormal findings at Screening are recorded as medical history. Additional ECG(s) are performed on study when clinically necessary. Clinically significant findings seen on the follow-up ECGs are recorded as AEs.
  • All AEs, SAEs, and other reportable safety events that occur after the consent form is signed but before treatment allocation/randomization must be reported by the investigator if the participant is receiving placebo run-in or other run-in treatment, if the event cause the participant to be excluded from the study, or is the result of a protocol-specified intervention, including but not limited to washout or discontinuation of usual therapy, diet, or a procedure. All AEs from the time of treatment allocation/randomization through 30 days following cessation of study intervention must be reported by the investigator.
  • ORR Objective Response Rate
  • PFS Progression-Free Survival
  • Participants who do not experience a PFS event will be censored at the last disease assessment.
  • the events PD or death
  • the data are censored at the last disease assessment prior to missing visits.
  • data after new anticancer therapy are censored at the last disease assessment prior to the initiation of new anticancer therapy. If a participant meets multiple criteria for censoring, the censoring criterion that occurs earliest will be applied.
  • OS Overall Survival
  • DOR Duration of Response
  • Table 8 summarizes the primary analysis approach for key efficacy endpoints.
  • APaT All Participants as Treated
  • BICR blindded independent central review
  • DOR duration of response
  • ORR objective response rate
  • OS overall
  • An AE is any untoward medical occurrence in a clinical study participant, temporally associated with the use of study intervention, whether or not considered related to the study intervention.
  • An AE can therefore be any unfavorable and unintended sign (including an abnormal laboratory finding), symptom, or disease (new or exacerbated) temporally associated with the use of the drug.
  • the following are included as AEs:
  • Any abnormal laboratory test results hematology, clinical chemistry, or urinalysis
  • other safety assessments e.g., ECG, radiological scans, vital signs measurements
  • ECG ECG, radiological scans, vital signs measurements
  • Medical or surgical procedure e.g., endoscopy, appendectomy: the condition that leads to the procedure is the AE.
  • An SAE is defined as any untoward medical occurrence that, at any dose:
  • Hospitalization is defined as an inpatient admission, regardless of length of stay, even if the hospitalization is a precautionary measure for continued observation. Hospitalization for an elective procedure to treat a pre-existing condition that has not worsened is not an SAE.
  • a pre-existing condition is a clinical condition that is diagnosed prior to the use of an MSD product and is documented in the participant’s medical history.
  • disability means a substantial disruption of a person’s ability to conduct normal life functions. This definition is not intended to include experiences of relatively minor medical significance such as uncomplicated headache, nausea, vomiting, diarrhea, influenza, and accidental trauma (e.g., sprained ankle) that may interfere with or prevent everyday life functions but do not constitute a substantial disruption.
  • Demographic variables e.g., age, gender
  • baseline characteristics e.g., primary and secondary diagnoses, and prior and concomitant therapies is summarized either by descriptive statistics or categorical tables for all enrolled subjects.
  • the estimate of the response rate (with a nominal 95% Cl) for the primary endpoint is estimated within each category of the following classification variables:
  • a Forest plot is produced, which provides the estimated point estimates and CIs for the treatment effect across the categories of subgroups listed above. Any specified subgroups that have less than 10 participants are excluded from analysis.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Oncology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicinal Preparation (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/US2019/017177 2018-02-13 2019-02-08 Methods for treating cancer with anti-pd-1 antibodies Ceased WO2019160751A2 (en)

Priority Applications (17)

Application Number Priority Date Filing Date Title
CA3090995A CA3090995A1 (en) 2018-02-13 2019-02-08 Methods for treating cancer with anti-pd-1 antibodies
US16/966,968 US12358984B2 (en) 2018-02-13 2019-02-08 Methods for treating cancer with anti-PD-1 antibodies
RU2020129827A RU2846266C2 (ru) 2018-02-13 2019-02-08 Способы лечения злокачественного новообразования с использованием антител против pd-1
JP2020542960A JP2021513541A (ja) 2018-02-13 2019-02-08 抗pd−1抗体によるがんの処置方法
MX2020008445A MX2020008445A (es) 2018-02-13 2019-02-08 Metodos para tratar el cancer con anticuerpos anti-pd-1.
SG11202007590TA SG11202007590TA (en) 2018-02-13 2019-02-08 Methods for treating cancer with anti-pd-1 antibodies
KR1020207026004A KR20200119844A (ko) 2018-02-13 2019-02-08 항-pd-1 항체를 사용한 암의 치료 방법
AU2019220495A AU2019220495B2 (en) 2018-02-13 2019-02-08 Methods for treating cancer with anti-PD-1 antibodies
CN202511206047.8A CN120919306A (zh) 2018-02-13 2019-02-08 用抗pd-1抗体治疗癌症的方法
CN201980013286.8A CN111712255A (zh) 2018-02-13 2019-02-08 用抗pd-1抗体治疗癌症的方法
EP19754909.0A EP3752180A4 (en) 2018-02-13 2019-02-08 METHOD OF TREATMENT OF CANCER WITH ANTI-PD-1 ANTIBODIES
BR112020016331A BR112020016331A8 (pt) 2018-02-13 2019-02-08 Métodos para tratar câncer com anticorpos anti-pd-1
IL276303A IL276303A (en) 2018-02-13 2020-07-26 Methods of treating cancer with ANTI-PD-1 antibodies
MX2024013016A MX2024013016A (es) 2018-02-13 2020-08-12 Anticuerpos anti-pd1 para usarse en el tratamiento del cancer
US18/459,842 US20240026003A1 (en) 2018-02-13 2023-09-01 Methods for treating cancer with anti-pd-1 antibodies
JP2024000162A JP2024038251A (ja) 2018-02-13 2024-01-04 抗pd-1抗体によるがんの処置方法
AU2026201041A AU2026201041A1 (en) 2018-02-13 2026-02-12 Methods for treating cancer with anti-PD-1 antibodies

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201862630038P 2018-02-13 2018-02-13
US62/630,038 2018-02-13
US201862732828P 2018-09-18 2018-09-18
US62/732,828 2018-09-18

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/966,968 A-371-Of-International US12358984B2 (en) 2018-02-13 2019-02-08 Methods for treating cancer with anti-PD-1 antibodies
US18/459,842 Continuation US20240026003A1 (en) 2018-02-13 2023-09-01 Methods for treating cancer with anti-pd-1 antibodies

Publications (2)

Publication Number Publication Date
WO2019160751A2 true WO2019160751A2 (en) 2019-08-22
WO2019160751A3 WO2019160751A3 (en) 2020-09-10

Family

ID=67620026

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2019/017177 Ceased WO2019160751A2 (en) 2018-02-13 2019-02-08 Methods for treating cancer with anti-pd-1 antibodies

Country Status (14)

Country Link
US (2) US12358984B2 (enExample)
EP (1) EP3752180A4 (enExample)
JP (2) JP2021513541A (enExample)
KR (1) KR20200119844A (enExample)
CN (2) CN111712255A (enExample)
AU (2) AU2019220495B2 (enExample)
BR (1) BR112020016331A8 (enExample)
CA (1) CA3090995A1 (enExample)
CL (1) CL2020002075A1 (enExample)
IL (1) IL276303A (enExample)
MA (1) MA52789A (enExample)
MX (2) MX2020008445A (enExample)
SG (1) SG11202007590TA (enExample)
WO (1) WO2019160751A2 (enExample)

Cited By (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021061719A1 (en) 2019-09-27 2021-04-01 Merck Sharp & Dohme Corp. Methods for treating metastatic triple negative breast cancer with anti-pd-1 antibodies
WO2021126906A1 (en) * 2019-12-20 2021-06-24 Merck Sharp & Dohme Corp. Methods for treating cancer using a combination of a pd-1 antagonist, an ilt4 antagonist, and chemotherapeutic agents
WO2021123202A1 (en) 2019-12-20 2021-06-24 Formycon Ag Formulations of anti-pd1 antibodies
WO2022268887A1 (en) 2021-06-23 2022-12-29 Formycon Ag Formulations of anti-pd1 antibodies
WO2024133625A1 (en) 2022-12-21 2024-06-27 Formycon Ag Formulations of anti-pd1 antibodies

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BR122017025062B8 (pt) 2007-06-18 2021-07-27 Merck Sharp & Dohme anticorpo monoclonal ou fragmento de anticorpo para o receptor de morte programada humano pd-1, polinucleotídeo e composição compreendendo o referido anticorpo ou fragmento
KR102650991B1 (ko) 2019-03-25 2024-03-27 (주)알테오젠 인간 히알루로니다제 ph20의 변이체와 약물을 포함하는 피하투여용 약학 조성물
CN112326961B (zh) * 2020-10-30 2021-08-06 福州迈新生物技术开发有限公司 一种非小细胞肺癌中pd-l1阳性肿瘤细胞比例的分析方法和存储设备
CN112394102B (zh) * 2020-11-05 2023-05-26 上海交通大学医学院附属瑞金医院 一种检测垂体功能减退症的标志物及其应用
US20250011453A1 (en) * 2021-07-20 2025-01-09 Merck Sharp & Dohme Llc Methods for treating cancer using a combination of a pd-1 antagonist, an ilt4 antagonist, and chemotherapeutic agents
CN113893343A (zh) * 2021-10-16 2022-01-07 广州誉衡生物科技有限公司 抗-pd-1抗体及其在制备治疗宫颈癌患者的药物中的用途
US20250044295A1 (en) * 2021-12-16 2025-02-06 Merck Sharp & Dohme Llc Biomarkers for predicting eligibility for an anti-ilt4 and anti-pd-1 combination therapy
CN115925954A (zh) * 2022-12-28 2023-04-07 广州誉衡生物科技有限公司 抗-pd-1抗体及其在制备治疗尿路上皮癌患者的药物中的用途
WO2025140467A1 (zh) * 2023-12-29 2025-07-03 上海复宏汉霖生物技术股份有限公司 稳定的高浓度抗pd-1抗体药物制剂

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9220776B2 (en) 2011-03-31 2015-12-29 Merck Sharp & Dohme Corp. Stable formulations of antibodies to human programmed death receptor PD-1 and related treatments
US20160022814A1 (en) 2014-07-18 2016-01-28 Advaxis, Inc. Combination of a pd-1 antagonist and a listeria-based vaccine for treating prostate cancer
WO2016176504A1 (en) 2015-04-28 2016-11-03 Bristol-Myers Squibb Company Treatment of pd-l1-positive melanoma using an anti-pd-1 antibody
US20170313775A1 (en) 2014-11-13 2017-11-02 The Johns Hopkins University Checkpoint Blockade and Microsatellite Instability
WO2017210624A1 (en) 2016-06-03 2017-12-07 Bristol-Myers Squibb Company Anti-pd-1 antibody for use in a method of treating a tumor

Family Cites Families (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
HK1044159A1 (zh) 1998-12-01 2002-10-11 蛋白质设计实验室股份有限公司 抗γ-干扰素的人化抗体
CN101899114A (zh) 2002-12-23 2010-12-01 惠氏公司 抗pd-1抗体及其用途
DK2439273T3 (da) 2005-05-09 2019-06-03 Ono Pharmaceutical Co Humane monoklonale antistoffer til programmeret død-1(pd-1) og fremgangsmåder til behandling af cancer ved anvendelse af anti-pd-1- antistoffer alene eller i kombination med andre immunterapeutika
BR122017025062B8 (pt) 2007-06-18 2021-07-27 Merck Sharp & Dohme anticorpo monoclonal ou fragmento de anticorpo para o receptor de morte programada humano pd-1, polinucleotídeo e composição compreendendo o referido anticorpo ou fragmento
AR093984A1 (es) 2012-12-21 2015-07-01 Merck Sharp & Dohme Anticuerpos que se unen a ligando 1 de muerte programada (pd-l1) humano
US20160084839A1 (en) 2013-04-02 2016-03-24 Marisa Dolled-Filhart Immunohistochemical assay for detecting expression of programmed death ligand 1 (pd-l1) in tumor tissue
WO2015095423A2 (en) 2013-12-17 2015-06-25 Genentech, Inc. Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists
US10695426B2 (en) * 2014-08-25 2020-06-30 Pfizer Inc. Combination of a PD-1 antagonist and an ALK inhibitor for treating cancer
AR103726A1 (es) * 2015-02-27 2017-05-31 Merck Sharp & Dohme Cristales de anticuerpos monoclonales anti-pd-1 humanos
WO2016196389A1 (en) 2015-05-29 2016-12-08 Bristol-Myers Squibb Company Treatment of renal cell carcinoma
ES2986067T3 (es) 2015-12-17 2024-11-08 Novartis Ag Moléculas de anticuerpos frente a PD-1 y usos de las mismas
CN108883132A (zh) 2016-01-22 2018-11-23 X4 制药有限公司 用于治疗癌症的方法
JP6821693B2 (ja) 2016-02-29 2021-01-27 ジェネンテック, インコーポレイテッド がんのための治療方法及び診断方法
WO2017165125A1 (en) * 2016-03-24 2017-09-28 Millennium Pharmaceuticals, Inc. Use of a pd-1 antagonist and an anti-ccr2 antibody in the treatment of cancer
TWI910495B (zh) 2016-05-13 2026-01-01 美商再生元醫藥公司 藉由投予pd-1抑制劑治療皮膚癌之方法
EP3463453A1 (en) 2016-05-23 2019-04-10 Eli Lilly and Company Combination of pembrolizumab and abemaciclib for the treatment of cancer
MY192158A (en) 2016-09-14 2022-08-03 Abbvie Biotherapeutics Inc Anti-pd-1 antibodies and their uses
AU2018206481B2 (en) 2017-01-09 2025-02-27 Tesaro, Inc. Methods of treating cancer with anti-PD-1 antibodies
KR20240149982A (ko) * 2017-06-01 2024-10-15 브리스톨-마이어스 스큅 컴퍼니 항-pd-1 항체를 사용하여 종양을 치료하는 방법

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9220776B2 (en) 2011-03-31 2015-12-29 Merck Sharp & Dohme Corp. Stable formulations of antibodies to human programmed death receptor PD-1 and related treatments
US20160022814A1 (en) 2014-07-18 2016-01-28 Advaxis, Inc. Combination of a pd-1 antagonist and a listeria-based vaccine for treating prostate cancer
US20170313775A1 (en) 2014-11-13 2017-11-02 The Johns Hopkins University Checkpoint Blockade and Microsatellite Instability
WO2016176504A1 (en) 2015-04-28 2016-11-03 Bristol-Myers Squibb Company Treatment of pd-l1-positive melanoma using an anti-pd-1 antibody
WO2017210624A1 (en) 2016-06-03 2017-12-07 Bristol-Myers Squibb Company Anti-pd-1 antibody for use in a method of treating a tumor

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
DANG T. O. ET AL: "Pembrolizumab for the treatment of PD-L1 positive advanced or metastatic non-small cell lung cancer", EXPERT REVIEW OF ANTICANCER THERAPY, vol. 16, no. 1, 10 December 2015 (2015-12-10), pages 13 - 20, XP055694108
FRESHWATER ET AL: "Evaluation of dosing strategy for pembrolizumab for oncologyindications", JOURNAL FOR IMMUNOTHERAPY OF CANCER, vol. 5, no. 1, 16 May 2017 (2017-05-16), pages 1 - 9, XP021245121
See also references of EP3752180A2
ZHAO ET AL.: "Abstract CT101: A model-based exposure-response (E-R) assessment of a nivolumab (NIVO) 4-weekly (Q4W) dosing schedule across multiple tumor types", PROCEEDINGS: AACR ANNUAL MEETING, vol. 77, no. Suppl. 13, July 2017 (2017-07-01), XP002789768, Retrieved from the Internet <URL:https://cancerres.aacrjournals.org/content/77/13_Supplement/CT101>

Cited By (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021061719A1 (en) 2019-09-27 2021-04-01 Merck Sharp & Dohme Corp. Methods for treating metastatic triple negative breast cancer with anti-pd-1 antibodies
EP4034163A4 (en) * 2019-09-27 2023-11-08 Merck Sharp & Dohme LLC METHOD FOR TREATING METASTASIC TRIPLE NEGATIVE BREAST CANCER USING ANTI-PD-1 ANTIBODIES
WO2021126906A1 (en) * 2019-12-20 2021-06-24 Merck Sharp & Dohme Corp. Methods for treating cancer using a combination of a pd-1 antagonist, an ilt4 antagonist, and chemotherapeutic agents
WO2021123202A1 (en) 2019-12-20 2021-06-24 Formycon Ag Formulations of anti-pd1 antibodies
CN115087461A (zh) * 2019-12-20 2022-09-20 默沙东有限责任公司 使用pd-1拮抗剂、ilt4拮抗剂和化学治疗剂的组合治疗癌症的方法
EP4722250A2 (en) 2019-12-20 2026-04-08 Formycon AG Formulations of anti-pd1 antibodies
WO2022268887A1 (en) 2021-06-23 2022-12-29 Formycon Ag Formulations of anti-pd1 antibodies
WO2024133625A1 (en) 2022-12-21 2024-06-27 Formycon Ag Formulations of anti-pd1 antibodies

Also Published As

Publication number Publication date
BR112020016331A2 (pt) 2020-12-15
CN120919306A (zh) 2025-11-11
JP2021513541A (ja) 2021-05-27
CN111712255A (zh) 2020-09-25
EP3752180A2 (en) 2020-12-23
CL2020002075A1 (es) 2020-10-23
AU2026201041A1 (en) 2026-03-05
US12358984B2 (en) 2025-07-15
BR112020016331A8 (pt) 2023-02-07
RU2020129827A (ru) 2022-03-14
MA52789A (fr) 2021-04-14
MX2020008445A (es) 2020-09-28
MX2024013016A (es) 2024-11-08
IL276303A (en) 2020-09-30
EP3752180A4 (en) 2021-12-15
JP2024038251A (ja) 2024-03-19
US20240026003A1 (en) 2024-01-25
AU2019220495A1 (en) 2020-08-13
US20210047408A1 (en) 2021-02-18
WO2019160751A3 (en) 2020-09-10
CA3090995A1 (en) 2019-08-22
KR20200119844A (ko) 2020-10-20
AU2019220495B2 (en) 2025-11-13
SG11202007590TA (en) 2020-09-29

Similar Documents

Publication Publication Date Title
US20240026003A1 (en) Methods for treating cancer with anti-pd-1 antibodies
US12083112B2 (en) Combination of a PD-1 antagonist and a VEGFR/FGFR/RET tyrosine kinase inhibitor for treating cancer
US20210047409A1 (en) Methods for treating cancer with anti pd-1 antibodies and anti ctla4 antibodies
AU2015214404B2 (en) Combination of a PD-1 antagonist and an IDO1 inhibitor for treating cancer
US20210347889A1 (en) Dosing regimen of anti-lag3 antibody and combination therapy with anti-pd-1 antibody for treating cancer
US20250074983A1 (en) Methods for treating cancer with subcutaneous administration of anti-pd1 antibodies
RU2825835C2 (ru) Способы лечения рака с помощью анти-PD-1-антител и анти-CTLA4-антител
RU2846266C2 (ru) Способы лечения злокачественного новообразования с использованием антител против pd-1
HK1232153B (en) Combination of a pd-1 antagonist and an ido1 inhibitor for treating cancer

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19754909

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3090995

Country of ref document: CA

Ref document number: 2020542960

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019220495

Country of ref document: AU

Date of ref document: 20190208

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 20207026004

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2019754909

Country of ref document: EP

Effective date: 20200914

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020016331

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112020016331

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20200811

WWG Wipo information: grant in national office

Ref document number: MX/A/2020/008445

Country of ref document: MX

WWG Wipo information: grant in national office

Ref document number: 16966968

Country of ref document: US

WWG Wipo information: grant in national office

Ref document number: 2020129827

Country of ref document: RU

WWG Wipo information: grant in national office

Ref document number: 11202007590T

Country of ref document: SG

WWP Wipo information: published in national office

Ref document number: 11202007590T

Country of ref document: SG