WO2019152895A1 - Antibodies to galectin-3 and methods of use thereof - Google Patents
Antibodies to galectin-3 and methods of use thereof Download PDFInfo
- Publication number
- WO2019152895A1 WO2019152895A1 PCT/US2019/016430 US2019016430W WO2019152895A1 WO 2019152895 A1 WO2019152895 A1 WO 2019152895A1 US 2019016430 W US2019016430 W US 2019016430W WO 2019152895 A1 WO2019152895 A1 WO 2019152895A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- antigen
- lgals3
- binding fragment
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2851—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the lectin superfamily, e.g. CD23, CD72
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/7056—Lectin superfamily, e.g. CD23, CD72
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- Galectins are a family of small, highly conserved eukaryotic proteins which recognize specific complex sugars on glycosylated cell surface proteins. They are essential for linking cancer cells with the stromal microenvironment to modulate development, adhesion, signaling, invasions and immune system interactions. Galectins can be found in the nucleus, the cytoplasm and the pericellular space. Extracellular galectins are primarily released in exosomes and do not appear to have classic secretion from the ER or Golgi. Humans have at least 12 different galectins which are variably expressed in various tissues and stages on development. In the last decade, it has become apparent that human Galectins, particularly Galectin-3 (LGALS3), represent an important link between the
- LGALS3 participates in regulation of cell membrane residence time, adhesion, migration, invasion and angiogenesis functions. Although LGALS3 binds to other natural ligands, its highest affinity ligand is the most proximal lactosamine disaccharide in poly-lactosamine chains that decorate many O- and N-Glycan species. Through binding and polymerization, LGALS3 forms a lattice and regulates the position and residence time of growth factor receptors including EGFR, PDGFR, Integrins and CTLA4, among many others. (FIG.
- LGALS3 Activation of downstream signaling molecules, such as SRC, ERK, AKT, and FAK drives the production of key molecules involved in metastasis and invasion.
- SRC signaling molecules
- ERK ERK
- AKT AKT
- FAK Activation of downstream signaling molecules
- CTLA4 surface concentrations are stabilized by LGALS3, leading to immunosuppression. Loss of the LGALS3 lattice inhibits multiple cancer cell and immune cell behaviors.
- LGALS3 excess has also been linked to renal disease, hepatic fibrosis, pulmonary fibrosis, cardiac failure and parasitic diseases (see FIG. 3).
- compositions, methods, and uses involving antibodies that immunospecifically bind to Galectin-3 (LGALS3), and modulate expression and/or activity of LGALS3 for managing or treating LGALS-mediated disorders, such as cancer.
- LGALS3 Galectin-3
- antibodies or an antigen-binding fragments thereof wherein the antibody or antigen-binding fragment thereof
- the LGALS3 CBD comprises SEQ ID NO: 27.
- the antibody is a monoclonal antibody, a single chain antibody, or any composition comprising an antigen-binding fragment thereof.
- the antibody or antigen-binding fragment thereof inhibits in vitro invasion of tumor cells in a Matrigel invasion assay.
- the tumor cells are ovarian tumor cells.
- the antibody or antigen-binding fragment thereof inhibits binding of LGALS3 to a glycosylated cell surface protein.
- the antibody or antigen-binding fragment thereof inhibits binding of LGALS3 to a glycosylated cell surface receptor.
- the antibody or antigen-binding fragment thereof inhibits binding of LGALS3 to a glycosylated growth factor receptor.
- the antibody or antigen-binding fragment thereof inhibits binding of LGALS3 to glycosylated mucin- 1 (MUC1), mucin-4 (MUC4), mucin- 16 (MUC16), a disialoganglioside, GD2, epidermal growth factor receptor (EGFR), platelet-derived growth factor receptor (PDGFR), insulin-like growth factor receptor (IGFR), cMET/hepatocyte growth factor receptor (HGFR), an integrin and CTLA4.
- the glycosylated MUC16 is N-glycosylated at Asnl800 or Asnl806.
- the antibody or antigen-binding fragment thereof inhibits growth of a tumor that expresses a glycosylated form of MUC16.
- the antibody or antigen-binding fragment thereof comprises a heavy chain variable region (VH), comprising (a) a VH complementarity determining region (CDR)l comprising the amino acid sequence SYGVH (SEQ ID NO: 5); (b) a VH CDR2 comprising the amino acid sequence VIWSDGSTTYNSTLKS (SEQ ID NO: 6); and (c) a VH CDR3 comprising the amino acid sequence HISNYGTMDY (SEQ ID NO:
- VH heavy chain variable region
- CDR VH complementarity determining region
- the antibody or antigen-binding fragment thereof comprises a VH, comprising (a) a VH complementarity determining region (CDR)l comprising the amino acid sequence GFSLSSY (SEQ ID NO: 11); (b) a VH CDR2 comprising the amino acid sequence WSDGS (SEQ ID NO: 12); and (c) a VH CDR3 comprising the amino acid sequence HISNYGTMDY (SEQ ID NO: 13).
- VH comprising (a) a VH complementarity determining region (CDR)l comprising the amino acid sequence GFSLSSY (SEQ ID NO: 11); (b) a VH CDR2 comprising the amino acid sequence WSDGS (SEQ ID NO: 12); and (c) a VH CDR3 comprising the amino acid sequence HISNYGTMDY (SEQ ID NO: 13).
- the antibody or antigen-binding fragment thereof comprises a VH, comprising: (a) a VH complementarity determining region (CDR)l comprising the amino acid sequence GFSLSSYG (SEQ ID NO: 17); (b) a VH CDR2 comprising the amino acid sequence IWSDGST (SEQ ID NO: 18); and (c) a VH CDR3 comprising the amino acid sequence ARHISNYGTMDY (SEQ ID NO: 19).
- the antibody or antigen-binding fragment thereof comprises a VH comprising the amino acid sequence of
- the antibody or antigen-binding fragment thereof comprises a light chain variable region (VL), comprising (a) a VL CDR1 comprising the amino acid sequence RASQDIRNYLN (SEQ ID NO: 8); (b) a VL CDR2 comprising the amino acid sequence YTSRLHS (SEQ ID NO: 9); and (c) a VL CDR3 comprising the amino acid sequence QHFNTLPPT (SEQ ID NO: 10).
- VL light chain variable region
- the antibody or antigen-binding fragment thereof comprises a VL, comprising: (a) a VL CDR1 comprising the amino acid sequence RASQDIRNYLN (SEQ ID NO: 14); (b) a VL CDR2 comprising the amino acid sequence YTSRLHS (SEQ ID NO: 15); and (c) a VL CDR3 comprising the amino acid sequence QHFNTLPPT (SEQ ID NO: 16).
- the antibody or antigen-binding fragment thereof comprises a VL, comprising: (a) a VL CDR1 comprising the amino acid sequence QDIRNY (SEQ ID NO: 20); (b) a VL CDR2 comprising the amino acid sequence YTS (SEQ ID NO: 21); and (c) a VL CDR3 comprising the amino acid sequence QHFNTLPPT (SEQ ID NO: 22).
- the antibody or antigen binding fragment thereof comprises a VL comprising the amino acid sequence of
- the antibody or antigen-binding fragment thereof comprises a VH comprising the amino acid sequence of SEQ ID NO: 24 and a VL comprising the amino acid sequence of SEQ ID NO: 26.
- the antibody or antigen-binding fragment thereof comprises a heavy chain variable region (VH), comprising a VH CDR1, VH CDR2, and VH CDR3 of an antibody provided in any one of FIGS.13 A, 13B, or 13C.
- the antibody or antigen-binding fragment thereof comprises a light chain variable region (VL), comprising a VL CDR1, VL CDR2, and VL CDR3 of an antibody provided in any one of FIGS.13 A, 13B, or 13C.
- the antibody or antigen-binding fragment thereof comprises a heavy chain variable region (VH), comprising a VH CDR1, VH CDR2, and VH CDR3 and a light chain variable region (VL), comprising a VL CDR1, VL CDR2, and VL CDR3 of an antibody provided in any one of FIGS.13 A, 13B, or 13C.
- VH heavy chain variable region
- VL light chain variable region
- the antibody or antigen-binding fragment thereof comprises a heavy chain and/or a light chain of an antibody provided in any one of FIGS.
- the antibody comprises human-derived heavy and light chain constant regions.
- the heavy chain constant region has an isotype selected from the group consisting of gamma 1, gamma 2, gamma 3, and gamma 4.
- the light chain constant region has an isotype selected from the group consisting of kappa and lambda.
- the antibody or antigen-binding fragment thereof is humanized.
- the antibody or antigen-binding fragment thereof is a humanized form of a rodent antibody.
- the antibody is an immunoglobulin comprising two identical heavy chains and two identical light chains. In some embodiments, the immunoglobulin is an IgG.
- antibody conjugates comprising an antibody or antigen-binding fragment thereof provided herein conjugated to an agent.
- the agent is an imaging agent or a cytotoxic agent.
- the antibody or antigen-binding fragment thereof is a bispecific antibody.
- the bispecific antibody immunospecifically binds CD3.
- the bispecific antibody comprises an immunoglobulin that immunospecifically binds LGALS3, wherein the light chain of the immunoglobulin is conjugated via a peptide linker to a single chain variable fragment (scFv) that
- bispecific antibody conjugates comprising a bispecific antibody provided herein conjugated to an agent.
- the agent is an imaging agent or a cytotoxic agent.
- the antigen-binding fragment thereof is a scFv.
- scFv conjugates comprising an scFv provided herein conjugated to an agent.
- the agent is an imaging agent or a cytotoxic agent.
- CAR chimeric antigen receptors
- T-cells that recombinantly expresses a CAR provided herein.
- polynucleotides comprising nucleic acid sequences encoding an antibody heavy chain provided herein, an antibody light chain provided herein, an scFv provided herein, and/or a CAR provided herein.
- vectors comprising a polynucleotide provided herein operably linked to a promoter.
- isolated cells comprising a polynucleotide provided herein or a vector provided herein.
- compositions comprising: a therapeutically effective amount of the antibody or antigen-binding fragment thereof provided herein, an antibody conjugate provided herein, a bispecific antibody provided herein, a bispecific antibody conjugate provided herein, an scFv provided herein, an scFv conjugate provided herein, a CAR provided herein, a polynucleotide provided herein, a vector provided herein, or a cell of provided herein; and a pharmaceutically acceptable carrier.
- methods of treating cancer in a patient in need thereof comprising administering to said patient a pharmaceutical composition provided herein.
- said cancer is a cancer of the ovary, lung, pancreas, breast, uterine, fallopian tube, or primary peritoneum. In some embodiments, said cancer is a metastatic cancer. In some embodiments, the pharmaceutical composition inhibits metastasis in the patient. In some embodiments, the said patient is a human patient. In some embodiments, the method further comprises administering a therapeutically effective amount of an additional therapeutic agent to the patient.
- an immunogenic peptide of SEQ ID NO: 2 is conjugated to an immunogenic carrier protein.
- fusion protein comprising: (a) a LGALS3 protein or fragment thereof comprising a LGALS3 carbohydrate binding domain; and (b) an Fc domain.
- the LGALS3 carbohydrate binding domain comprises domains SEQ ID NO:32.
- the LGALS3 carbohydrate binding domain comprises amino acids 117-244 of SEQ ID NO: 1.
- the Fc domain is a human IgGl Fc domain.
- kits for generating an antibody or an antigen-binding fragment thereof that specifically binds to a LGAL3 CBD comprising immunizing a subject with the immunogenic peptide provided herein or a fusion protein provided herein.
- the subject is a goat, a sheep, a donkey, a chicken, a guinea pig, a rat, a rabbit, or a mouse.
- the immunogenic peptide is conjugated to an immunogenic carrier protein.
- the immunogenic carrier protein is keyhole limpet hemocyanin.
- FIG. 1A illustrates the structure and activity of extracellular Galectin-3
- LGALS3 which forms a pentamer to link cell surface cancer molecules, such as MUC16 in ovarian cancer, to signaling molecules via contact with signaling receptor, such as EGFR and Integrins.
- signaling receptor such as EGFR and Integrins.
- Activation of downstream signaling molecules, such as SRC, ERK, AKT, and FAK in turn drives the production of key molecules for metastasis and invasion.
- FIG. IB illustrates how antibody inhibitors that bind to the LGALS3 carbohydrate binding domain will block activation of“outside-in” signal transduction by disrupting the LGALS3 surface complexes and destabilizing the cell surface receptors.
- FIG. 2A illustrates LGALS3 shRNA blocking MUC16 oncogene activation, as assessed by inhibition of phosphorylation of EGFR, ART, ERK and SRC (P-EGFR, P-AKT, P-ERK, P-SRC, respectively). Loss of LGALS3 greatly inhibits MFJC16 activation
- FIG. 2B illustrates competing LGALS3 but not LGAL1 (Galectin-l) blocks Matrigel invasion of ovarian cancer cell lines, OVCAR3, OVCA-432, OVCA-433 and CAOV3.
- the carbohydrate binding domain of LGALS3 ( 117 244 LGAL3-pFETSE), but not u 119 LGALl-pFEiSE block ovarian cancer cell invasion.
- Swainsonine and Kifunensine both block the synthesis of the LGALS3 ligand, polylactosamine.
- FIG. 2C illustrates inhibition of A2780 Ovarian Cancer in a tumor xenograft model by inhibitors of LGALS3 function.
- FIG. 2D illustrates antisense knockdowns of MGAT5 and LGALS3 inhibit tumor growth.
- MUC16 expression enhanced tumor growth (top line).
- loss of N- glycosylation sites, or shRNA against MGAT5 or LGALS3 reduced growth back to control levels.
- FIG. 3 illustrates in vitro and in vivo experimental functions of Galectin 3 and potential blocking antibody effects for treatment with the antibodies provided.
- FIG. 4 illustrates the primary structure of the LGALS3 carbohydrate binding domain (CBD).
- the LGALS3 CBD is divided into 5 sub-domains, each binding to a single sugar residue and, conventionally labeled as A B C D and E.
- the highly conserved amino acids are underlined while domains C, D and E are shown in the boxed area.
- This sequence was used for the murine peptide immunization.
- Rl86(*) in particular is important to the functions of LGALS3.
- the LGALS3 CBD sequence is highly homologous to the murine Galectin-3 but differs from GAL1, GAL7 and GAL9. While each of these family members have similar sugar binding domains, LGALS3 is the only lectin with the polymerization domain.
- FIG. 5 illustrates ELISA reactivity for various Galectin family members and sequences.
- the antibodies selected were positive both whole protein (LGALS3) and the LGALS3 carbohydrate binding domain (CBD-3).
- LGALS3 Carbohydrate binding domain
- CBD-3 LGALS3 carbohydrate binding domain
- FIG. 6 illustrates inhibition of LGALS3 binding to laminin by the candidate antibodies.
- FIG. 7 illustrates binding of antibody 14D11.2D2 to LGALS3 in an ELISA assay utilizing nickel plated 96-well microplates, polyhistidine-tagged LGALS3 as primary protein at 500 ng/well, dilutions of primary antibody 14D11.2D2 with a starting concentration of 1 mg/mL, and secondary antibody of goat anti-mouse IgGl-HRP at 1 :3000 dilution.
- FIG. 8 illustrates binding of antibody 14D11.2D2 to LGALS3 in a surface plasmon resonance (SPR) assay.
- KD dissociation constant
- FIG. 9 illustrates an ELISA assay showing 14D11.2D2 blocking of LGALS3 binding to laminin. At a concentration of 250 nM, 14D11.2D2 decreased LGALS3 binding by 36.6%.
- FIG. 10 illustrates 14D11.2D2 inhibits invasion of SKOV3-MUCl6c344 (SKOV3c344), A2780-MUCl6c344 (A2780c344), and OVCAR3 cell lines as compared to untreated cells in a Matrigel invasion assay. ** 0 r *** denotes statistically significant difference between untreated cells and cells treated with antibody.
- the Matrigel Invasion assay was done using SKOV3— MUCl6c344, A2780— MLTCl6c344, and wild type OVCAR3 cell lines.
- FIG. 11 illustrates the effect of increased survival of 14D11.2D2 antibody treated mice in an ovarian tumor xenograft model. Mice immunized with 14D11.2D2 antibody were more likely to survive than mice that did not receive the antibody.
- FIG. 12A illustrates 14D11.2D2 antibody Heavy Chain DNA and Amino Acid sequences and CDR sequences identified by Kabat, Chothia and IMGT numbering. The shaded region represents the highly conserved region of the heavy chain.
- FIG. 12B illustrates 14D11.2D2 antibody Lights Chain DNA and Amino Acid sequences and CDR sequences identified by Kabat, Chothia and IMGT numbering. The shaded region represents the highly conserved region of the light chain.
- FIG. 13A-C illustrates CDR sequences of isolated LGALS3 antibodies obtained by peptide immunization as identified by Kabat (13A), Chothia (13B) and IMGT (13C) numbering.
- FIG. 13D-0 illustrates VH and/or VL chain sequences of the same LGALS3 antibodies. Light chain sequences for 3G10.D11, 11D1.A12, and 21A12.A6 were not obtained.
- FIG. 14A illustrates loss of metastatic lung tumor development in athymic mice injected with breast cancer cell line deficient for LGALS3 expression.
- MDA-MB-231 cell line is an epithelial, human breast cancer cell line.
- FIG. 15 illustrates exemplary nucleotide (NM 002306.3) and amino acid
- a range includes each individual member.
- a group having 1-3 cells refers to groups having 1, 2, or 3 cells.
- a group having 1-5 cells refers to groups having 1, 2, 3, 4, or 5 cells, and so forth.
- the term“administration” of an agent to a subject includes any route of introducing or delivering the agent to a subject to perform its intended function. Administration can be carried out by any suitable route, including but not limited to, intravenously, intramuscularly, intraperitoneally, subcutaneously, and other suitable routes as described herein. Administration includes self-administration and the administration by another.
- amino acid refers to naturally occurring and non-naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyrolysine and selenocysteine.
- Amino acid analogs refer to agents that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- amino acids forming a polypeptide are in the D form.
- the amino acids forming a polypeptide are in the L form.
- a first plurality of amino acids forming a polypeptide are in the D form and a second plurality are in the L form.
- Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, are referred to by their commonly accepted single-letter code.
- polypeptide “peptide,” and“protein” are used interchangeably herein to refer to a polymer of amino acid residues.
- the terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non-naturally occurring amino acid, e.g., an amino acid analog.
- the terms encompass amino acid chains of any length, including full length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
- a“control” is an alternative sample used in an experiment for comparison purpose.
- a control can be“positive” or“negative.”
- a positive control a composition known to exhibit the desired therapeutic effect
- a negative control a subject or a sample that does not receive the therapy or receives a placebo
- the term“effective amount” or“therapeutically effective amount” refers to a quantity of an agent sufficient to achieve a desired therapeutic effect.
- the amount of a therapeutic peptide administered to the subject can depend on the type and severity of the infection and on the characteristics of the individual, such as general health, age, sex, body weight and tolerance to drugs. It can also depend on the degree, severity and type of disease. The skilled artisan will be able to determine appropriate dosages depending on these and other factors.
- the term “expression” refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression can include splicing of the mRNA in a eukaryotic cell. The expression level of a gene can be determined by measuring the amount of mRNA or protein in a cell or tissue sample. In one aspect, the expression level of a gene from one sample can be directly compared to the expression level of that gene from a control or reference sample.
- the expression level of a gene from one sample can be directly compared to the expression level of that gene from the same sample following administration of the compositions disclosed herein.
- the term“expression” also refers to one or more of the following events: (1) production of an RNA template from a DNA sequence (e.g ., by transcription) within a cell; (2) processing of an RNA transcript (e.g, by splicing, editing, 5’ cap formation, and/or 3’ end formation) within a cell; (3) translation of an RNA sequence into a polypeptide or protein within a cell; (4) post-translational modification of a polypeptide or protein within a cell; (5) presentation of a polypeptide or protein on the cell surface; and (6) secretion or presentation or release of a polypeptide or protein from a cell.
- linker refers to synthetic sequences (e.g, amino acid sequences) that connect or link two sequences, e.g, that link two polypeptide domains.
- the linker contains 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 of amino acid sequences.
- the term“antibody” means not only intact antibody molecules, but also fragments of antibody molecules that retain immunogen-binding ability. Such fragments are also well known in the art and are regularly employed both in vitro and in vivo. Accordingly, as used herein, the term“antibody” means not only intact immunoglobulin molecules but also the well-known active fragments F(ab')2, and Fab. F(ab')2, and Fab fragments that lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al, J. Nucl. Med. 24:316-325 (1983)).
- the antibodies of the invention comprise whole native antibodies, monoclonal antibodies, human antibodies, humanized antibodies, camelised antibodies, multispecific antibodies, bispecific antibodies, chimeric antibodies, Fab, Fab', single chain V region fragments (scFv), single domain antibodies (e.g ., nanobodies and single domain camelid antibodies), VNAR fragments, Bi-specific T-cell engager (BiTE) antibodies, minibodies, disulfide-linked Fvs (dsFv), and anti-idiotypic (anti-id) antibodies, intrabodies, fusion polypeptides, unconventional antibodies and antigen-binding fragments of any of the above.
- antibodies include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen binding site.
- Immunoglobulin molecules can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) or subclass.
- an antibody is a glycoprotein comprising at least two heavy (H) chains and two light (L) chains inter-connected by disulfide bonds.
- Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant (CH) region.
- the heavy chain constant region is comprised of three domains, CH1, CH2 and CH3.
- Each light chain is comprised of a light chain variable region (abbreviated herein as VL) and a light chain constant CL region.
- the light chain constant region is comprised of one domain, CL.
- VH and VL regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
- CDR complementarity determining regions
- FR framework regions
- Each VH and VL is composed of three CDRs and four FRs arranged from amino-terminus to carboxy -terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
- the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g, effector cells) and the first component (Cl q) of the classical complement system.
- the terms“antigen-binding portion”,“antigen-binding fragment”, or“antigen-binding region” of an antibody refer to the region or portion of an antibody that binds to the antigen and which confers antigen specificity to the antibody; fragments of antigen-binding proteins, for example, antibodies include one or more fragments of an antibody that retain the ability to specifically bind to an antigen (e.g, a peptide/HLA complex). It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- antigen-binding portions encompassed within the term“antibody fragments” of an antibody include a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains; a F(ab)2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; a Fd fragment consisting of the VH and CHI domains; a Fv fragment consisting of the VL and VH domains of a single arm of an antibody; a dAb fragment (Ward et al, Nature 341 : 544-546 (1989)), which consists of a VH domain; and an isolated complementarity determining region (CDR).
- a Fab fragment a monovalent fragment consisting of the VL, VH, CL and CHI domains
- F(ab)2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
- Antibodies and antibody fragments can be wholly or partially derived from mammals (e.g ., humans, non-human primates, goats, guinea pigs, hamsters, horses, mice, rats, rabbits and sheep) or non-mammalian antibody producing animals (e.g., chickens, ducks, geese, snakes, urodele amphibians).
- mammals e.g ., humans, non-human primates, goats, guinea pigs, hamsters, horses, mice, rats, rabbits and sheep
- non-mammalian antibody producing animals e.g., chickens, ducks, geese, snakes, urodele amphibians.
- the antibodies and antibody fragments can be produced in animals or produced outside of animals, such as from yeast or phage (e.g., as a single antibody or antibody fragment or as part of an antibody library).
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules.
- scFv single chain Fv
- scFv single chain Fv
- scFv single chain Fv
- These antibody fragments are obtained using conventional techniques known to those of ordinary skill in the art, and the fragments are screened for utility in the same manner as are intact antibodies.
- An“isolated antibody” or“isolated antigen-binding protein” is one which has been identified and separated and/or recovered from a component of its natural environment.
- “Synthetic antibodies” or “recombinant antibodies” are generally generated using recombinant technology or using peptide synthetic techniques known to those of skill in the art.
- the term“single-chain variable fragment” or“scFv” is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of an immunoglobulin (e.g, mouse or human) covalently linked to form a VH:VL heterodimer.
- the heavy (VH) and light chains (VL) are either joined directly or joined by a peptide- encoding linker (e.g, about 10, 15, 20, 25 amino acids), which connects the N-terminus of the VH with the C-terminus of the VL, or the C-terminus of the VH with the N-terminus of the VL.
- the linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility.
- the linker can link the heavy chain variable region and the light chain variable region of the extracellular antigen binding domain.
- Single chain Fv polypeptide antibodies can be expressed from a nucleic acid comprising VH- and VL-encoding sequences as described by Huston, et al. (Proc. Nat. Acad. Sci. USA, 85:5879-5883 (1988)). See, also, U.S. Patent Nos. 5,091,513, 5,132,405 and 4,956,778; and U.S. Patent Publication Nos. 20050196754 and 20050196754.
- Antagonistic scFvs having inhibitory activity have been described (see, e.g., Zhao et al, Hybridoma (Larchmt) 27(6):455-5l (2008); Peter et al, J Cachexia Sarcopenia Muscle (2012); Shieh et al, J Imunol l83(4):2277-85 (2009); Giomarelli et al, Thromb Haemost 97(6):955-63 (2007); Fife eta., J Clin Invst H6(8):2252- 61 (2006); Brocks et al, Immunotechnology 3(3): 173-84 (1997); Moosmayer et al, Ther Immunol 2(l0):3 l- 40 (1995) Agonistic scFvs having stimulatory activity have been described (see, e.g., Peter et al, J Biol Chem 25278(38):36740-7 (2003); Xie et al, Nat Biotech
- F(ab) refers to a fragment of an antibody structure that binds to an antigen but is monovalent and does not have a Fc portion, for example, an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g, a heavy (H) chain constant region; Fc region that does not bind to an antigen).
- an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g, a heavy (H) chain constant region; Fc region that does not bind to an antigen).
- “F(ab')2” refers to an antibody fragment generated by pepsin digestion of whole IgG antibodies, wherein this fragment has two antigen binding (ab 1 ) (bivalent) regions, wherein each (ab 1 ) region comprises two separate amino acid chains, a part of a H chain and a light (L) chain linked by an S-S bond for binding an antigen and where the remaining H chain portions are linked together.
- A“F(ab')2” fragment can be split into two individual Fab' fragments.
- CDRs are defined as the complementarity determining region amino acid sequences of an antibody which are the hypervariable regions of immunoglobulin heavy and light chains. See, e.g, Kabat et al, Sequences of Proteins of Immunological Interest, 4th U. S. Department of Health and Human Services, National Institutes of Health (1987). Generally, antibodies comprise three heavy chain and three light chain CDRs or CDR regions in the variable region. CDRs provide the majority of contact residues for the binding of the antibody to the antigen or epitope. In certain embodiments, the CDRs regions are delineated using the Rabat system (Rabat, E. A., et al. Sequences of Proteins of Immunological Interest, Fifth Edition, ET.S. Department of Health and Human Services, NIH Publication No. 91-3242(1991)).
- the constant region is an antibody portion, e.g., a carboxyl terminal portion of a light and/or heavy chain which is not directly involved in binding of an antibody to antigen but which can exhibit various effector functions, such as interaction with the Fc receptor.
- the constant region of an immunoglobulin molecule generally has a more conserved amino acid sequence relative to an immunoglobulin variable domain.
- an "epitope” is a term in the art and can refer to a localized region of an antigen to which an antibody can immunospecifically bind.
- An epitope can be, e.g, contiguous amino acids of a polypeptide (linear or contiguous epitope) or an epitope can, e.g, come together from two or more noncontiguous regions of a polypeptide or polypeptides (conformational, non-linear, discontinuous, or non-contiguous epitope).
- the term“ligand” refers to a molecule that binds to a receptor.
- the ligand binds a receptor on another cell, allowing for cell-to-cell recognition and/or interaction.
- affinity is meant a measure of binding strength. Without being bound to theory, affinity depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, and on the distribution of charged and hydrophobic groups. Affinity also includes the term“avidity,” which refers to the strength of the antigen- antibody bond after formation of reversible complexes (e.g., either monovalent or multivalent). Methods for calculating the affinity of an antibody for an antigen are known in the art, comprising use of binding experiments to calculate affinity. Antibody activity in functional assays (e.g, flow cytometry assay) is also reflective of antibody affinity.
- Nucleic acid molecules useful in the presently disclosed subject matter include any nucleic acid molecule that encodes a polypeptide or a fragment thereof.
- nucleic acid molecules useful in the presently disclosed subject matter include nucleic acid molecules that encode an antibody or an antigen-binding portion thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity.
- Polynucleotides having“substantial homology” or“substantial identity” to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule.
- hybridize is meant pair to form a double-stranded molecule between complementary polynucleotide sequences ( e.g ., a gene described herein), or portions thereof, under various conditions of stringency. (See, e.g., Wahl, G. M. and S. L. Berger, Methods Enzymol. 152:399 (1987); Kimmel, A. Vi. Methods Enzymol. 152:507 (1987)).
- the terms “immunospecifically binds,” “immunospecifically recognizes,” “specifically binds,” and “specifically recognizes” are analogous terms in the context of antibodies and refer to antibodies and antigen-binding fragments thereof that bind to an antigen (e.g, epitope or immune complex) via the anti gen -binding sites as understood by one skilled in the art, and does not exclude cross-reactivity of the antibody or antigen binding fragment with other antigens.
- substantially homologous or “substantially identical” mean a polypeptide or nucleic acid molecule that exhibits at least 50% or greater homology or identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
- a reference amino acid sequence for example, any one of the amino acid sequences described herein
- nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
- such a sequence is at least about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, about 95% or about 99% homologous or identical at the amino acid level or nucleic acid to the sequence used for comparison (e.g., a wild-type, or native, sequence).
- a substantially homologous or substantially identical polypeptide contains one or more amino acid amino acid substitutions, insertions, or deletions relative to the sequence used for comparison. In some embodiments, a substantially homologous or substantially identical polypeptide contains one or more non-natural amino acids or amino acid analogs, including, D-amino acids and retroinverso amino, to replace homologous sequences.
- Sequence homology or sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs).
- Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
- a BLAST program may be used, with a probability score between e 3 and e 100 indicating a closely related sequence.
- analog refers to a structurally related polypeptide or nucleic acid molecule having the function of a reference polypeptide or nucleic acid molecule.
- a conservative sequence modification refers to an amino acid modification that does not significantly affect or alter the binding characteristics of the presently disclosed anti-LGALS3 antibody or an antigen-binding fragment thereof comprising the amino acid sequence.
- Conservative modifications can include amino acid substitutions, additions and deletions. Modifications can be introduced into the human scFv of the presently disclosed anti-LGALS3 antibody or an antigen-binding fragment thereof by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Amino acids can be classified into groups according to their physicochemical properties such as charge and polarity. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid within the same group.
- amino acids can be classified by charge: positively-charged amino acids include lysine, arginine, histidine, negatively-charged amino acids include aspartic acid, glutamic acid, neutral charge amino acids include alanine, asparagine, cysteine, glutamine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine.
- positively-charged amino acids include lysine, arginine, histidine
- negatively-charged amino acids include aspartic acid
- glutamic acid neutral charge amino acids include alanine, asparagine, cysteine, glutamine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine.
- amino acids can be classified by polarity: polar amino acids include arginine (basic polar), asparagine, aspartic acid (acidic polar), glutamic acid (acidic polar), glutamine, histidine (basic polar), lysine (basic polar), serine, threonine, and tyrosine; non-polar amino acids include alanine, cysteine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, and valine.
- one or more amino acid residues within a CDR region can be replaced with other amino acid residues from the same group and the altered antibody can be tested for retained function (i.e ., the functions set forth in (c) through (1) above) using the functional assays described herein.
- no more than one, no more than two, no more than three, no more than four, no more than five residues within a specified sequence or a CDR region are altered.
- heterologous nucleic acid molecule or polypeptide refers to a nucleic acid molecule (e.g ., a cDNA, DNA or RNA molecule) or polypeptide that is not normally present in a cell or sample obtained from a cell.
- This nucleic acid may be from another organism, or it may be, for example, an mRNA molecule that is not normally expressed in a cell or sample.
- modulate refers positively or negatively alter.
- exemplary modulations include an about 1%, about 2%, about 5%, about 10%, about 25%, about 50%, about 75%, or about 100% change.
- the term“increase” refers to alter positively by at least about 5%, including, but not limited to, alter positively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
- the term“reduce” refers to alter negatively by at least about 5% including, but not limited to, alter negatively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
- an "isolated" polynucleotide or nucleic acid molecule is one which is separated from other nucleic acid molecules which are present in the natural source (e.g., in a mouse or a human) of the nucleic acid molecule.
- an "isolated" nucleic acid molecule such as a cDNA molecule, can be substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized.
- the language “substantially free” includes preparations of polynucleotide or nucleic acid molecule having less than about 15%, 10%, 5%, 2%), 1%), 0.5%), or 0.1%) of other material, e.g, cellular material, culture medium, other nucleic acid molecules, chemical precursors and/or other chemicals.
- an“effective amount” is an amount sufficient to affect a beneficial or desired clinical result upon treatment.
- An effective amount can be administered to a subject in one or more doses.
- an effective amount is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease (e.g ., a neoplasia), or otherwise reduce the pathological consequences of the disease (e.g., a neoplasia).
- the effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art. Several factors are typically taken into account when determining an appropriate dosage to achieve an effective amount. These factors include age, sex and weight of the subject, the condition being treated, the severity of the condition and the form and effective concentration of the engineered immune cells administered.
- Neoplasia refers to a disease characterized by the pathological proliferation of a cell or tissue and its subsequent migration to or invasion of other tissues or organs. Neoplasia growth is typically uncontrolled and progressive, and occurs under conditions that would not elicit, or would cause cessation of, multiplication of normal cells.
- Neoplasia can affect a variety of cell types, tissues, or organs, including but not limited to an organ selected from the group consisting of bladder, colon, bone, brain, breast, cartilage, glia, esophagus, fallopian tube, gallbladder, heart, intestines, kidney, liver, lung, lymph node, nervous tissue, ovaries, pleura, pancreas, prostate, skeletal muscle, skin, spinal cord, spleen, stomach, testes, thymus, thyroid, trachea, urogenital tract, ureter, urethra, uterus, and vagina, or a tissue or cell type thereof.
- Neoplasia include cancers, such as sarcomas, carcinomas, or plasmacytomas (malignant tumor of the plasma cells).
- the term“treating” or“treatment” refers to clinical intervention in an attempt to alter the disease course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology.
- Therapeutic effects of treatment include, without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastases, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- a treatment can prevent deterioration due to a disorder in an affected or diagnosed subject or a subject suspected of having the disorder, but also a treatment may prevent the onset of the disorder or a symptom of the disorder in a subject at risk for the disorder or suspected of having the disorder.
- the term “subject” refers to any animal (e.g ., a mammal), including, but not limited to, humans, non-human primates, rodents, and the like (e.g., which is to be the recipient of a particular treatment, or from whom cells are harvested).
- Galectin-3 is a B-galactoside-binding protein that is secreted from many cells although the protein lacks a signal sequence for transfer into the endoplasmic reticulum and Golgi compartments and entry into classical secretory pathways. LGALS3is found in cellular and extracellular locations of the cell and has pleiotropic biological functions such as cell growth, cell adhesion and cell-cell interaction. It may exhibit anti or pro-apoptotic activity depending on its localization and post-translational modifications, such as cleavage and phosphorylation. Cleavage of galectin-3 was reported to be involved with angiogenic potential and apoptotic resistance. Phosphorylation of galectin-3 regulates its sugar-binding ability.
- LGALS3 plays an essential role of the growth, spread and invasive properties of ovarian cancer (Rao, et al. (2017) ACS Chem. Biol. 12 (8): 2085-2096, which is incorporated by reference in its entirety).
- This work utilized both knockdown shRNA suppression of LGALS3 and chimeric antibodies in which the native, low affinity LGALS3 carbohydrate binding domain replaced the antibody variable region.
- tumor expression of LGALS3 is required for the oncogene activating effects of the ovarian cancer mucin MUC16/CA125 (FIG. 2A).
- LGALS3 knockdown cells When LGALS3 knockdown cells were transplanted in nude mice, they had very limited growth, confirming the essential role of LGALS3 for in vivo tumor growth (FIG. 2D). It was further demonstrated that growth/invasion enhancement by LGALS3 is extracellular. In invasion studies, it was shown that Matrigel invasion of ovarian cancer cells is dependent on LGALS3. Low affinity chimeric antibodies comprising a fusion protein of the unmodified carbohydrate binding domain of LGALS3 linked to an Fc backbone, can block LGALS3 function and prevent Matrigel gel invasion while chimeric blocking antibodies for Galectin-l were ineffective (FIG. 2B).
- chimeric anti-LGALS3 blocking antibodies reduce in vivo growth of xenografts in mice (FIG. 2C). These chimeric antibodies had no notable adverse effects on the host mice, consistent with the reported minimal effect of LGAL33 knockouts (Wright et aL (2017) J Leukoc Biol 101(3): 717-726.
- LGALS3 carbohydrate binding domain
- FIG. 4 The box depicts C, D and E domains of the CBD, which are important for lactosamine binding.
- the highly conserved amino acids are underlined.
- Rl86(*) is important to the functions of GAL3.
- the GAL3 CBD sequence is highly homologous to the murine Galectin-3 but differs from GAL1, GAL7 and GAL9. While each of these family members have similar sugar binding domains, LGALS3 is the only lectin with the polymerization domain.
- mice were immunized with peptides and/or fusion constructs containing the LGALS3 CBD, or portions thereof.
- anti-LGALS3 CBD antibodies were screened against whole proteins CBD and whole proteins for GAL1, LGALS3, GAL7 and GAL9 for antibody selection.
- the isolated antibodies bind to native human LGALS3 and the mouse homolog Lgal3. In addition, the antibodies exhibited functional inhibition
- LGALS3 binding to polylactosamine on laminin were further shown to inhibit tumor cell invasion as assessed by a Matrigel gel invasion assay and increase survival in a mouse ovarian cancer xenograft model.
- LGALS3 A variety of studies have demonstrated a role for LGALS3 in tumor biology and inflammation. A partial list of effects and the anticipated result of LGALS3 targeting are shown in FIG. 3. Many of the anticipated effects are expected beneficial in a cancer treatment. Although the effects of LGALS3 are protean, even complete loss of LGALS3 in a knockout mouse model is consistent with nearly normal development, and some
- the antibodies provided herein are expected to be useful therapeutics for the treatment of a LGALS3 -mediated diseases and conditions, including but not limited to cancer and inflammation.
- antibodies and antigen-binding fragments thereof and polypeptides including such antibodies or fragments, such as fusion proteins, conjugates, and/or chimeric antigen receptors, as well as cells expressing the same.
- the antibodies and fragments are those that specifically bind to epitopes of a LGALS3 protein.
- Such antibodies are referred to herein as“anti-LGALS3 antibodies.”
- Such epitopes are typically epitopes within or substantially within a carbohydrate binding portion (CBD) of a LGALS3 molecule.
- the epitope is within or includes amino acid residues 117-244 of LGALS3 (SEQ ID NO: 1).
- the antibody or fragment binds to an epitope within or that includes amino acid residues 117-244 of LGALS3 (SEQ ID NO: 1). In some embodiments, the epitope is within or includes amino acid residues 152-195 of LGALS3 (SEQ ID NO: 1). In some embodiments, the antibody or fragment binds to an epitope within or that includes amino acid residues 152-195 of LGALS3 (SEQ ID NO: l). In some embodiments, the epitope is within or includes amino acid residues 170-186 of LGALS3 (SEQ ID NO: 1). In some embodiments, the antibody or fragment binds to an epitope within or that includes amino acid residues 170-186 of LGALS3 (SEQ ID NO: l). In some embodiments, the epitope is portion of the CBD comprising the sequence
- the antibody or fragment binds to an epitope within or that includes CNTKLDNNWGREERQSVFPFESG (SEQ ID NO: 2).
- the epitope is within or includes domains C, D, and E of the CBD of LGALS3.
- the antibody or fragment binds to an epitope within or that includes amino acid residues 170-186 of LGALS3 (SEQ ID NO: 1). ⁇ 0090]
- the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit laminin binding by LGALS3.
- the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit binding of LGALS3 to lactosamine.
- the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit or treat cancer. In some embodiments, the anti- LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit invasion and growth of tumor cells. In some embodiments, the anti-LGALS3 antibodies and antigen binding fragments thereof described herein inhibit tumor angiogenesis. In some embodiments,
- the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit metastasis. In some embodiments, the anti-LGALS3 antibodies and antigen binding fragments thereof described herein inhibit growth of a metastatic tumor. In some embodiments, the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit activation of cancer-related signaling molecules, such as AKT or ERK.
- the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit induction of T-cell apoptosis by LGALS3.
- the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit immunosuppression of T-cells.
- the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit or treat cardiovascular disease. In some embodiments, the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit or treat heart failure, coronary heart disease or myocardial infarction.
- the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit or treat pulmonary fibrosis.
- the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit or treat renal disease. In some embodiments, the anti-LGALS3 antibodies and antigen-binding fragments thereof described herein inhibit or treat glomerulonephritis. In some embodiments, the anti-LGALS3 antibodies and antigen binding fragments thereof described herein inhibit or treat renal cell carcinoma.
- polynucleotides e.g ., isolated polynucleotides
- nucleic acid sequences e.g., complementary DNA (cDNA)
- vectors e.g, expression vectors
- cells e.g, isolated cells or ex vivo cells
- polynucleotides e.g, isolated polynucleotides
- nucleic acid sequences e.g, complementary DNA (cDNA)
- cDNA complementary DNA
- kits, and diagnostic methods are also provided.
- LGALS3 As used herein, the term“LGALS3,”“LGALS3 polypeptide,”“LGALS3 peptide” “Gal-3,”“Gal-3 polypeptide,” or“Gal-3 peptide” are used interchangeable herein to refer to Galectin-3 and functional homologs and fragments thereof that bind to b-galactosides.
- GenBankTM accession number NM 002306.3 (SEQ ID NO: 3) provides an exemplary human LGALS3 nucleic acid sequence.
- GenBankTM accession number NP 002297.2 (SEQ ID NO: 4) provides an exemplary human LGALS3 amino acid sequence.
- Anti-LGALS3 antibodies or antigen-binding fragments thereof can include, e.g., monoclonal antibodies, polyclonal antibodies, recombinantly produced antibodies, monospecific antibodies, multispecific antibodies (including bispecific antibodies), human antibodies, humanized antibodies, chimeric antibodies, immunoglobulins, synthetic antibodies, tetrameric antibodies comprising two heavy chain and two light chain molecules, an antibody light chain monomer, an antibody heavy chain monomer, an antibody light chain dimer, an antibody heavy chain dimer, an antibody light chain- antibody heavy chain pair, intrabodies, single domain antibodies, monovalent antibodies, single chain antibodies or single-chain variable fragments (scFv), camelized antibodies, affybodies, and disulfide-linked Fvs (dsFv), or fragments thereof.
- Such antibodies can be made by methods known in the art.
- a multispecific antibody or fragment thereof refers to an antibody or fragment thereof that can bind simultaneously to at least two targets that are of different structure, e.g, two different antigens, two different epitopes on the same antigen, or a hapten and an antigen or epitope.
- targets e.g, two different antigens, two different epitopes on the same antigen, or a hapten and an antigen or epitope.
- One specificity could be for, for example, a B-cell, T-cell, myeloid-, plasma-, or mast- cell antigen or epitope, such as, for example CD3.
- Another specificity could be to a different antigen on the same or different cell type, such as for example, LGALS3.
- Multispecific, multivalent antibodies are constructs that have more than one binding site, and the binding sites are of different specificity, for example, a bispecific diabody, where one binding site reacts with one antigen and the other with another antigen.
- a bispecific antibody is an antibody that can bind simultaneously to two targets which are of different structure.
- Bispecific antibodies (bsAb) and bispecific antibody fragments (bsFab) have at least one arm that immunospecifically binds to a first target, for example, LGALS3, and at least one other arm that immunospecifically binds to a second target, such as, for example, CD3.
- bsAb bispecific antibodies
- bsFab bispecific antibody fragments
- a variety of bispecific fusion proteins can be produced using molecular engineering.
- the bispecific fusion protein is divalent, consisting of, for example, (i) a scFv with a single binding site for one antigen and (ii) an antibody or a Fab fragment with a single binding site for a second antigen.
- the bispecific fusion protein is tetravalent, consisting of, for example, an IgG with two binding sites for one antigen and two identical scFv for a second antigen. See, for example, International
- Recent methods for producing bispecific monoclonal antibodies include the use of engineered recombinant monoclonal antibodies which have additional cysteine residues so that they crosslink more strongly than the more common immunoglobulin isotypes. See, e.g., FitzGerald et al ., Protein Eng. 10(10): 1221-1225, 1997. Another approach is to engineer recombinant fusion proteins linking two or more different single-chain antibody or antibody fragment segments with the needed dual specificities. See, e.g, Coloma el al. , Nature Biotech. 15: 159-163, 1997. A variety of bispecific fusion proteins can be produced using molecular engineering.
- Bispecific fusion proteins linking two or more different single-chain antibodies or antibody fragments can be produced in similar manner. Recombinant methods can be used to produce a variety of fusion proteins.
- a flexible linker connects an scFv (e.g, an scFv targeting CD3) to the constant region of the light chain of a monoclonal antibody (e.g, an anti-LGALS3 antibody described herein).
- Appropriate linker sequences necessary for the in-frame connection of the heavy chain Fc to the scFv are introduced into the VL and Vkappa domains through PCR reactions. The DNA fragment encoding the scFv is then ligated into a staging vector containing a DNA sequence encoding the CHI domain.
- the resulting construct is excised and ligated into a vector containing a DNA sequence encoding the VH region of the antibody (e.g, the anti-LGALS3 antibody).
- the resulting vector can be used to transfect an appropriate host cell, such as a mammalian cell for the expression of the bispecific fusion protein.
- the anti-LGALS3 antibodies described herein and fragments thereof in certain embodiments can also be used to prepare functional bispecific single-chain antibodies (bscAb), also called diabodies, and can be produced in mammalian cells using recombinant methods.
- bscAb can be produced by joining two single- chain Fv fragments via a glycine-serine linker using recombinant methods.
- the VL and VH domains of two antibodies of interest are isolated using standard PCR methods known in the art.
- Bispecific single-chain antibodies and bispecific fusion proteins are included within the scope of the present invention.
- anti-LGALS3 antibodies or antigen-binding fragments thereof described herein refer to scFvs.
- a scFv is an art-recognized term.
- An scFv comprises a fusion protein of the variable regions of the heavy (VH) and light (VL) chains of an immunoglobulin, wherein the fusion protein retains the same antigen specificity as the whole immunoglobulin.
- the VH is fused to the VL via a peptide linker.
- the peptide linker is between 5 and 25, 5 and 15, 10 and 20, 10 and 15, or 15 and 25 amino acid residues in length.
- the scFv peptide linker displays one or more characteristics suitable for a peptide linker known to one of ordinary skill in the art.
- the scFv peptide linker comprises amino acids that allow for scFv peptide linker solubility, such as, for example, serine and threonine.
- the scFv peptide linker comprises amino acids that allow for scFv peptide linker flexibility, such as, for example, glycine.
- the scFv peptide linker connects the N- terminus of the VH to the C-terminus of the VL.
- the scFv peptide linker can connect the C- terminus of the VH to the N-terminus of the VL.
- anti-LGALS3 antibodies or antigen-binding fragments thereof described herein refer to chimeric antigen receptors (CARs).
- CAR chimeric antigen receptors
- a CAR is an art- recognized term.
- a CAR can be targeted to a tumor associated antigen (e.g LGALS3).
- CARs as provided herein typically are composed of a scFv derived from a LGALS3
- Antibody a transmembrane domain, which in some embodiments is a T cell co stimulatory molecule-derived transmembrane domain (for example, a transmembrane domain derived from CD28, CD8, CD38, OX-40, or 4- IBB), and a primary signaling domain, such as the T cell receptor (TCR) zeta (Q chain cytoplasmic signaling domain.
- TCR T cell receptor
- the CAR further includes one or more additional regions or domains such as one or more spacer or linker, including an extracellular spacer, such as one derived from an antibody or other cell-surface molecule, such as a spacer containing gone or more of antibody CH2, CH3, and/or hinge regions, or a spacer derived from a CD28 molecule or a CD8 molecule, or other spacer.
- additional regions or domains such as one or more spacer or linker, including an extracellular spacer, such as one derived from an antibody or other cell-surface molecule, such as a spacer containing gone or more of antibody CH2, CH3, and/or hinge regions, or a spacer derived from a CD28 molecule or a CD8 molecule, or other spacer.
- cells such as T cells engineered to express such CARs, such as those recombinantly expressing such a CAR.
- a CAR-expressing T cell upon recognition of a LGALS3 expressing tumor, preferably induces T cell activation, proliferation, and
- Anti-LGALS3 antibodies can be of any type (e.g, IgG, IgE, IgM, IgD, IgA or IgY), any class (e.g, IgGl, IgG2, IgG3, IgG4, IgAl or IgA2), or any subclass (e.g, IgG2a or IgG2b) of immunoglobulin molecule.
- antibodies described herein are IgG antibodies, or a class or subclass thereof.
- antibodies described herein are IgGl antibodies.
- antibodies described herein are IgG2 antibodies.
- antibodies described herein are IgG2a antibodies.
- antibodies described herein are IgG2b antibodies. In certain embodiments, antibodies described herein are IgG3 antibodies. In certain embodiments, antibodies described herein are IgG4 antibodies. In certain embodiments, antibodies described herein are a mixture of antibody types or a mixture of subclasses. In certain embodiments, antibodies described herein are a mixture of IgG2a and IgG2b antibodies. In a specific embodiment, the antibody is a humanized form of a rodent monoclonal antibody.
- Antigen binding fragments of anti-LGALS3 antibodies can be Fab fragments, F(ab')2 fragments, or a portion of anti-LGALS3 antibody which comprises the amino acid residues that confer on the anti-LGALS3 antibody its specificity for the antigen (e.g, the complementarity determining regions (CDR)).
- the anti-LGALS3 antibody can be derived from any animal species, such as rodents (e.g, mouse, rat or hamster) and humans.
- variable region typically refers to a portion of an antibody, generally, a portion of a light or heavy chain, typically about the amino- terminal 110 to 120 amino acids in a mature heavy chain and about the amino-terminal 90 to 100 amino acids in a mature light chain, which differs extensively in sequence among antibodies and is used in the binding and specificity of a particular antibody for its particular antigen.
- the variability in sequence is concentrated in those regions called complementarity determining regions (CDRs) while the more highly conserved regions in the variable domain are called framework regions (FR). CDRs are flanked by FRs.
- the variable region is a rodent (e.g ., mouse or rat) variable region.
- the variable region is a human variable region.
- the variable region comprises rodent (e.g., mouse or rat) CDRs and human framework regions (FRs).
- variable region is a primate (e.g, non- human primate) variable region.
- variable region comprises rodent or murine CDRs and primate (e.g, non-human primate) framework regions (FRs).
- j 01121 CDRs are defined in various ways in the art, including the Rabat, Chothia, and
- the Rabat definition is based on sequence variability (Rabat, Elvin A. et /., Sequences of Proteins of Immunological Interest. Bethesda: National Institutes of Health, 1983).
- the VH CDR1 is typically present at amino acid positions 31 to 35 of the heavy chain, which can optionally include one or two additional amino acids following amino acid position 35 (referred to in the Rabat numbering scheme as 35 A and 35B);
- the VH CDR2 is typically present at amino acid positions 50 to 65 of the heavy chain; and
- the VH CDR2 is typically present at amino acid positions 95 to 102 of the heavy chain (Rabat, Elvin A.
- the VL CDR1 is typically present at amino acid positions 24 to 34 of the light chain;
- the VL CDR2 is typically present at amino acid positions 50 to 56 of the light chain; and
- the VL CDR3 is typically present at amino acid positions 89 to 97 of the light chain (Rabat, Elvin A. et al, Sequences of Proteins of
- the actual linear amino acid sequence of the antibody variable domain can contain fewer or additional amino acids due to a shortening or lengthening of a FR and/or CDR and, as such, an amino acid's Rabat number is not necessarily the same as its linear amino acid number.
- Chothia definition is based on the location of the structural loop regions (Chothia et al. (1987) J Mol Biol 196: 901-917; and U.S. Patent No. 7,709,226).
- the term "Chothia CDRs,” and like terms are recognized in the art and refer to antibody CDR sequences as determined according to the method of Chothia and Lesk (1987) J. Mol. Biol. 196:901-917, which will be referred to herein as the "Chothia CDRs" (see also, e.g, ET.S. Patent No.
- the VH CDR1 is typically present at amino acid positions 26 to 32 or 34 of the heavy chain;
- the VH CDR2 is typically present at amino acid positions 52 to 56 (in one embodiment, CDR2 is at positions 52A-56, wherein 52A follows position 52) of the heavy chain;
- the VH CDR3 is typically present at amino acid positions 95 to 102 of the heavy chain (in one embodiment, there is no amino acid at positions numbered 96-100).
- the VL CDR1 is typically present at amino acid positions 26 to 33 of the light chain;
- the VL CDR2 is typically present at amino acid positions 50 to 52 of the light chain; and
- the VL CDR3 is typically present at amino acid positions 91 to 96 of the light chain.
- the VL CDR1 is typically present at amino acid positions 24 to 34 of the light chain; (ii) the VL CDR2 is typically present at amino acid positions 50 to 56 of the light chain; and (iii) the VL CDR3 is typically present at amino acid positions 89 to 97 of the light chain (in one embodiment, there is no amino acid at positions numbered 96-100).
- Chothia CDR positions may vary depending on the antibody, and can be determined according to methods known in the art.
- IMGT The international trademark of EVIGT.
- the VH CDR1 is typically present at amino acid positions 25 to 35 of the heavy chain; (ii) the VH CDR2 is typically present at amino acid positions 51 to 57 of the heavy chain; and (iii) the VH CDR2 is typically present at amino acid positions 93 to 102 of the heavy chain.
- the VL CDR1 is typically present at amino acid positions 27 to 32 of the light chain; (ii) the VL CDR2 is typically present at amino acid positions 50 to 52 of the light chain; and (iii) the VL CDR3 is typically present at amino acid positions 89 to 97 of the light chain.
- an anti-LGALS3 antibody or antigen binding fragment thereof which comprises VH CDRs of any of the anti-LGALS3 antibodies provided herein, e.g., as set forth in Figs. l2a, l2b and 13A-0.
- an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VH CDR1 of an anti-LGALS3 antibody as set forth in FIG. l2a.
- an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VH CDR2 of an anti-LGALS3 antibody as set forth in FIG. l2a.
- an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VH CDR3 of an anti-LGALS3 antibody as set forth in FIG. l2a. In certain embodiments, an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein comprises one, two or all three of VH CDRs of an anti-LGALS3 antibody as set forth in Table FIG. l2a.
- an anti-LGALS3 antibody or antigen binding fragment thereof which comprises VL CDRs of any of the anti-LGALS3 antibodies provided herein, e.g, as set forth in FIGs. 12 and 13.
- an anti- LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VL CDR1 of an anti-LGALS3 antibody as set forth in FIG. l2b.
- an anti- LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VL CDR2 of an anti-LGALS3 antibody as set forth in FIG. l2b.
- an anti- LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VL CDR3 of an anti-LGALS3 antibody as set forth in FIG. l2b.
- an anti- LGALS3 antibody or antigen-binding fragment thereof provided herein comprises one, two or all three of VL CDRs of an anti-LGALS3 antibody in FIG. l2b.
- an anti-LGALS3 antibody or antigen binding fragment thereof which comprises VH CDRs of any of the anti-LGALS3 antibodies provided herein, e.g., as set forth in FIGs. 13A-C.
- an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VH CDR1 of an anti-LGALS3 antibody as set forth in FIGs. 13A-C.
- an anti- LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VH CDR2 of an anti-LGALS3 antibody as set forth in FIGs. 13A-C.
- an anti-LGALS3 antibody or antigen- binding fragment thereof provided herein comprises the VH CDR3 of an anti-LGALS3 antibody as set forth in FIGs. 13A-C.
- an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein comprises one, two or all three of VH CDRs of an anti-LGALS3 antibody as set forth in FIGs. 13A-C.
- an anti-LGALS3 antibody or antigen binding fragment thereof which comprises VL CDRs of any of the anti-LGALS3 antibodies provided herein, e.g, as set forth in FIGs. 13A-C.
- an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VH CDR1 of an anti-LGALS3 antibody as set forth in FIGs. 13A-C.
- an anti- LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VH CDR2 of an anti-LGALS3 antibody as set forth in FIGs. 13A-C. In certain embodiments, an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein comprises the VH CDR3 of an anti-LGALS3 antibody as set forth in FIGs. 13A-C. In certain embodiments, an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein comprises one, two or all three of VL CDRs of an anti-LGALS3 antibody in FIGs. 13A-C.
- an anti-LGALS3 antibody or antigen-binding fragment thereof described herein comprises a VH which comprises: (a) a VH CDR1 comprising the amino acid sequence SYGVH (SEQ ID NO: 5); (b) a VH CDR2 comprising the amino acid sequence VIWSDGSTTYNSTLKS (SEQ ID NO: 6); and (c) a VH CDR3 comprising the amino acid sequence HISNYGTMDY (SEQ ID NO: 7).
- an anti-LGALS3 antibody or antigen-binding fragment thereof comprises a VH which comprises a VH CDR1 comprising the amino acid sequence of SEQ ID NO: 11 or 17, a VH CDR2 comprising the amino acid sequence of SEQ ID NO: 12 or 18, and a VH CDR3 comprising the amino acid sequence of SEQ ID NO: 13 or 19.
- an anti-LGALS3 antibody or antigen-binding fragment thereof comprises a VL which comprises: (a) a VL CDR1 comprising the amino acid sequence RASQDIRNYLN (SEQ ID NO: 8) (b) a VL CDR2 comprising the amino acid sequence YTSRLHS (SEQ ID NO: 9); and (c) a VL CDR3 comprising the amino acid sequence QHFNTLPPT (SEQ ID NO: 10).
- an anti-LGALS3 antibody or antigen-binding fragment thereof described herein comprises a VL which comprises a VL CDR1 comprising the amino acid sequence of SEQ ID NO: 14 or 20, a VL CDR2 comprising the amino acid sequence of SEQ ID NO: 15 or 21, and a VL CDR3 comprising the amino acid sequence of SEQ ID NO: 16 or 22.
- an anti-LGALS3 antibody or antigen-binding fragment thereof described herein comprises: (i) a VH which comprises: (a) a VH CDR1 comprising the amino acid sequence SYGVH (SEQ ID NO: 5); (b) a VH CDR2 comprising the amino acid sequence VIWSDGSTTYNSTLKS (SEQ ID NO: 6); and (c) a VH CDR3 comprising the amino acid sequence HISNYGTMDY (SEQ ID NO: 7); and (ii) a VL which comprises: (a) a VL CDR1 comprising the amino acid sequence RASQDIRNYLN (SEQ ID NO: 8); (b) a VL CDR2 comprising the amino acid sequence YTSRLHS (SEQ ID NO: 9); and (c) a VL CDR3 comprising the amino acid sequence QHFNTLPPT (SEQ ID NO: 10).
- an anti-LGALS3 antibody or antigen-binding fragment thereof described herein comprises a VH region comprising:
- an anti-LGALS3 antibody or antigen-binding fragment thereof described herein comprises a VL region comprising:
- an anti-LGALS3 antibody or antigen-binding fragment thereof described herein comprises a VH region comprising a heavy chain set forth in any of FIGs 13D-0.
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein comprises a VL region comprising a light chain set forth in any of FIGs 13D-0.
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein can be described by its VH domain alone, or its VL domain alone, or by its three VH CDRs alone, or by its three VL CDRs alone.
- Rader C et al. (1998) PNAS 95: 8910-8915, which is incorporated herein by reference in its entirety, which describes the humanization of the mouse anti-avP3 antibody by identifying a complementing light chain or heavy chain, respectively, from a human light chain or heavy chain library, resulting in humanized antibody variants having affinities as high or higher than the affinity of the original antibody. See also, Clackson T et al.
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein can be a humanized antibody, for example, a humanized form of a rodent antibody.
- Humanized antibodies can be produced using a variety of techniques known in the art, including but not limited to, CDR-grafting (European Patent No. EP 239,400; International publication No. WO 91/09967; and U.S. Patent Nos. 5,225,539, 5,530, 101, and 5,585,089), chain shuffling (U.S. Patent No. 5,565,332), veneering or resurfacing (European Patent Nos.
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein is a composite human antibody.
- a composite human antibody can be generated by, e.g, designing variable region sequences from fragments of multiple human antibody variable region sequences in a manner that avoids T cell epitopes, thereby minimizing the immunogenicity of the resulting antibody (see, e.g., Baker et al. (2010) Self Nonself ⁇ (4):314-322; Bryson et al. (2010) BioDrugs 24(1): 1-8; and Jones et al. (2009) Methods Mol Biol. 525:405-23).
- Such antibodies can comprise human constant region sequences, e.g, human light chain and/or heavy chain constant regions.
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein can be a deimmunized antibody.
- a deimmunized antibody is an antibody in which T-cell epitopes have been removed. Methods for making deimmunized antibodies have been described. See, e.g, Jones et al. Methods Mol Biol. 2009;525:405-23, xiv, and De Groot et al. (2006) Cell. Immunol. 244: 148-153).
- an anti-LGALS3 antibody or antigen-binding fragment thereof described herein is a humanized immunoglobulin that comprises the 3 VH CDRs and the 3 VL CDRs (i.e., VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and VL CDR3) of any of the antibodies in Figs. 12 and 13, human-derived framework regions, and human derived constant regions.
- human framework regions are described in the art, e.g, see Rabat et al. (1991) Sequences of Proteins of Immunological Interest Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein comprises framework regions (e.g, framework regions of the VL domain and/or VH domain) that are human framework regions or derived from human framework regions.
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein comprises framework regions (e.g, framework regions of the VL domain and/or VH domain) that are primate (e.g., non-human primate) framework regions or derived from primate (e.g, non-human primate) framework regions.
- CDRs from antigen-specific non -human antibodies are grafted onto homologous human or non-human primate (e.g, Old World apes, e.g, Pan troglodytes , Pan paniscus or Gorilla , Pan troglodytes , Old World monkeys, e.g., from the genus Macaca, or the cynomolgus monkey Macaca cynomolgus).
- non-human primate framework sequences are described in U.S. Patent Application Publication No. US
- the position of VH CDR1, VH CDR2, and/or VH CDR3 in the VH region and/or the position of VL CDR1, VL CDR2, and/or VL CDR2 in the VL region of an anti-LGALS3 antibody or antigen binding fragment thereof described herein may vary by 1, 2, 3, 4, 5, 6, or more amino acid positions so long as immunospecific binding to LGALS3 or a portion thereof containing the carbohydrate binding domain is maintained (e.g, by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- the length of VH CDR1, VH CDR2, and/or VH CDR3 in the VH region and/or the length of VL CDR1, VL CDR2, and/or VL CDR2 in the VL region of an anti-LGALS3 antibody or antigen binding fragment thereof described herein may vary (e.g, be shorter or longer) by 1, 2, 3, 4, 5, 6, or more amino acids, so long as immunospecific binding to LGALS3 or a portion thereof containing the carbohydrate binding domain is maintained (e.g, by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- the amino terminus and/or the carboxy terminus of a VH CDR1, VH CDR2, VH CDR3, VL CDR1, VL CDR2, and/or VL CDR3 described herein can be extended or shortened by 1, 2, 3, 4, 5, 6, or more amino acids compared to one or more of the CDRs described herein so long as immunospecific binding to LGALS3 or a portion thereof containing the carbohydrate binding domain is maintained (e.g, by at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%).
- an anti-LGALS3 antibody or antigen binding fragment thereof comprising an antibody heavy chain and/or light chain, e.g., a heavy chain alone, a light chain alone, or both a heavy chain and a light chain.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a heavy chain wherein the amino acid sequence of the variable region of the heavy chain comprises a VH CDR1, VH CDR2, and VH CDR3 of any one of antibodies listed in Fig, 12 or 13, and wherein the constant region of the heavy chain is a human heavy chain constant region.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a heavy chain wherein the amino acid sequence of the variable region of the heavy chain comprises a VH CDR1, VH CDR2, and VH CDR3 having the amino acid sequences of SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7, respectively, wherein the constant region of the heavy chain is a human heavy chain constant region.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a heavy chain wherein the amino acid sequence of the variable region of the heavy chain comprises the amino acid sequence of SEQ ID NO: 24, and wherein the constant region of the heavy chain is a human heavy chain constant region.
- Non-limiting examples of human constant region sequences have been described in the art, e.g, see Rabat EA et al. (1991) supra.
- the heavy chain of an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein can be an alpha (a), delta (d), epsilon (e), gamma (g) or mu (m) heavy chain.
- the heavy chain of an anti-LGALS3 antibody or antigen binding fragment thereof described can comprise a human alpha (a), delta (d), epsilon (e), gamma (g) or mu (m) heavy chain.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a heavy chain wherein the amino acid sequence of the variable region of the heavy chain comprises a VH CDR1, VH CDR2, and VH CDR3 of any one of antibodies listed in Fig, 12 or 13, and wherein the constant region of the heavy chain is an alpha (a), delta (d), epsilon (e), gamma (g) or mu (m) heavy chain.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a heavy chain wherein the amino acid sequence of the variable region of the heavy chain comprises a VH CDR1, VH CDR2, and VH CDR3 having the amino acid sequences of SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7, respectively, wherein the constant region of the heavy chain is a human an alpha (a), delta (d), epsilon (e), gamma (g) or mu (m) heavy chain.
- the amino acid sequence of the variable region of the heavy chain comprises a VH CDR1, VH CDR2, and VH CDR3 having the amino acid sequences of SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7, respectively, wherein the constant region of the heavy chain is a human an alpha (a), delta (d), epsilon (e), gamma (g) or mu (m) heavy chain.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a heavy chain wherein the amino acid sequence of the variable region of the heavy chain comprises the amino acid sequence of SEQ ID NO: 24, and wherein the constant region of the heavy chain is a human an alpha (a), delta (d), epsilon (e), gamma (g) or mu (m) heavy chain.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprises a VL CDR1, VL CDR2, and VL CDR3 of any one of antibodies listed in Fig, 12 or 13 and wherein the constant region of the light chain is a human light chain constant region.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprises a VL CDR1, VL CDR2, and VL CDR3 having the amino acid sequences of antibody SEQ ID NO: 8, SEQ ID NO: 8, and SEQ ID NO: 10, respectively, and wherein the constant region of the light chain is a human light chain constant region.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprises the amino acid sequence of SEQ ID NO: 26, and wherein the constant region of the light chain is a human light chain constant region.
- the light chain of an anti-LGALS3 antibody or an antigen binding fragment thereof described herein is a kappa light chain.
- the light chain of an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein is a lambda light chain.
- the light chain of an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein is a human kappa light chain or a human lambda light chain.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprises a VL CDR1, VL CDR2, and VL CDR3 of any one of antibodies listed in Fig, 12 or 13 and wherein the constant region of the light chain is a kappa (K) or a lambda (l) light chain constant region.
- an anti-LGALS3 antibody or an antigen binding fragment thereof described herein comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprises a VL CDR1, VL CDR2, and VL CDR3 having the amino acid sequences of antibody SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 10, respectively, and wherein the constant region of the light chain is a kappa or lambda light chain constant region.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein comprises a light chain wherein the amino acid sequence of the variable region of the light chain comprises the amino acid sequence of SEQ ID NO: 26, and wherein the constant region of the light chain is a kappa or lambda light chain constant region.
- an anti-LGALS3 antibody or antigen-binding fragment thereof described herein comprises a heavy chain variable region (VH) and a light chain variable region (VL) as described herein, and wherein the constant regions are of the type found in an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, or a human IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule.
- an anti- LGALS3 antibody or antigen-binding fragment thereof described herein comprises a VH and a VL comprising any amino acid sequences described herein, and wherein the constant regions are of the type found in an IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class ( e.g . , IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), or any subclass (e.g., IgG2a and IgG2b) of immunoglobulin molecule.
- the constant regions are of the type found in a human IgG, IgE, IgM, IgD, IgA or IgY immunoglobulin molecule, any class (e.g, IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), or any subclass (e.g, IgG2a and IgG2) of immunoglobulin molecule.
- the epitope of an antibody can be determined by, e.g, NMR spectroscopy, X-ray diffraction crystallography studies, ELISA assays,
- crystallization can be accomplished using any of the known methods in the art (e.g, Giege R et al. (1994) Acta Crystallogr D Biol Crystallogr 50(Pt 4): 339-350; McPherson A (1990) Eur J Biochem 189: 1- 23; Chayen NE (1997) Structure 5: 1269-1274; McPherson A (1976) J Biol Chem 251 : 6300- 6303).
- Antibody antigen crystals can be studied using well known X-ray diffraction techniques and can be refined using computer software such as X-PLOR (Yale University, 1992, distributed by Molecular Simulations, Inc.; see e.g., Meth Enzymol (1985) volumes 114 & 115, eds WyckoffHW et al., ; U.S. Patent Application No. 2004/0014194), and BUSTER (Bricogne G (1993) Acta Crystallogr D Biol Crystallogr 49(Pt 1): 37-60; Bricogne G (1997) Meth Enzymol 216N. 361-423, ed Carter CW; Roversi P et al. (2000) Acta
- Competition binding assays also can be used to determine whether two antibodies have similar binding specificity for an epitope.
- Competitive binding can be determined in an assay in which the immunoglobulin under test inhibits immunospecific binding of a reference antibody to a common antigen.
- Numerous types of competitive binding assays are known, e.g.: solid phase direct or indirect radioimmunoassay (RIA), solid phase direct or indirect enzyme immunoassay (EIA), sandwich competition assay (see Stahli C et al. (1983) Methods Enzymol 9: 242-253); solid phase direct biotin-avidin EIA (see Kirkland TN et al.
- solid phase direct labeled assay solid phase direct labeled sandwich assay (see Harlow E & Lane D, (1988) Antibodies: A Laboratory Manual, Cold Spring Harbor Press); solid phase direct label RIA using 1-125 label (see Morel GA et al. (1988) Mol Immunol 25(1): 7-15); solid phase direct biotin-avidin EIA (Cheung RC et al. (1990) Virology 176: 546-52); and direct labeled RIA. (Moldenhauer G et al. (1990) Scand J Immunol 32: 77-82).
- such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabeled test immunoglobulin and a labeled reference immunoglobulin.
- immunoglobulin is present in excess. Usually, when a competing antibody is present in excess, it will inhibit immunospecific binding of a reference antibody to a common antigen by at least 50-55%, 55-60%, 60-65%, 65-70%) 70- 75%) or more.
- a competition binding assay can be configured in a large number of different formats using either labeled antigen or labeled antibody. In a common version of this assay, the antigen is immobilized on a 96-well plate. The ability of unlabeled antibodies to block the binding of labeled antibodies to the antigen is then measured using radioactive or enzyme labels. For further details, see, e.g., Wagener C et al.
- competition binding assays can be used to determine whether an antibody is competitively blocked, e.g, in a dose dependent manner, by another antibody e.g, an antibody binds essentially the same epitope, or overlapping epitopes, as a reference antibody, when the two antibodies recognize identical or sterically overlapping epitopes in competition binding assays such as competition ELISA assays, which can be configured in all number of different formats, using either labeled antigen or labeled antibody.
- an antibody can be tested in competition binding assays with an anti-LGALS3 antibody or antigen binding fragment thereof described herein (e.g, a murine IgG antibody containing the variable region of 14D11).
- antibodies that compete (e.g, in a dose dependent manner) for binding to LGALS3 with an anti-LGALS3 antibody or antigen binding fragment thereof described herein (e.g, a murine IgG antibody containing the variable region of 14D11), as determined using assays known to one of skill in the art or described herein (e.g, ELISA).
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein e.g, a murine IgG antibody containing the variable region of 14D11
- antibodies that competitively inhibit (e.g, in a dose dependent manner) an anti-LGALS3 antibody or antigen binding fragment thereof described herein (e.g, a murine IgG antibody containing the variable region of 14D11) from binding to LGALS3, as determined using assays known to one of skill in the art or described herein (e.g, ELISA).
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein e.g, a murine IgG antibody containing the variable region of 14D11
- an antibody that competes with an antibody described herein for binding to the same extent that an anti-LGALS3 antibody or antigen binding fragment thereof described herein self-competes for binding to LGALS3.
- a first antibody that competes with an anti-LGALS3 antibody or antigen binding fragment thereof described herein for binding to LGALS3, wherein the competition is exhibited as reduced binding of the first antibody to the epitope by more than 80% (e.g., 85%, 90%, 95%, or 98%, or between 80% to 85%, 80% to 90%, 85% to 90%, or 85% to 95%).
- an anti-LGALS3 antibody or antigen binding fragment thereof which competes (e.g, in a dose dependent manner) for immunospecific binding to LGALS3, with an anti-LGALS3 antibody or antigen binding fragment thereof comprising a VH comprising a VH CDR1, a VH CDR2, and/or a VH CDR3 comprising amino acid sequences as described in FIG. 12 or 13 and/or a VL comprising a VL CDR1, a VL CDR2, and/or a VL CDR3 comprising amino acid sequences as described in FIG. 12 or 13.
- an anti-LGALS3 antibody or antigen binding fragment thereof which competes (e.g, in a dose dependent manner) for
- an anti-LGALS3 antibody or antigen binding fragment thereof which binds to the same or an overlapping epitope of antibody comprising a VH comprising a VH CDR1, a VH CDR2, and/or a VH CDR3 comprising amino acid sequences as described in FIG. 12 or 13 and/or a VL comprising a VL CDR1, a VL CDR2, and/or a VL CDR3 comprising amino acid sequences as described in FIG. 12 or 13.
- an anti-LGALS3 antibody or antigen binding fragment thereof that binds to the same or an overlapping epitope of antibody comprising a VH domain having an amino acid sequence as described in FIG. l2a and/or a VL as described in FIG. l2b.
- Assays known to one of skill in the art or described herein can be used to determine if two antibodies bind to the same epitope. Affinity can be measured and/or expressed in a number of ways known in the art, including, but not limited to, equilibrium dissociation constant (KD), and equilibrium association constant (KA). The KD can be determined by techniques known to one of ordinary skill in the art, such as biolayer interferometry.
- KD equilibrium dissociation constant
- KA equilibrium association constant
- the epitope to which the an anti-LGALS3 antibody or antigen binding fragment thereof described herein binds is used as an immunogen to produce antibodies. In some embodiments, comprises all or a portion of the carbohydrate binding domain of LGALS3.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein binds to LGALS3 with a kd of less than or about 0.5xl0 3 /s, lxl0 3 /s, l .5xl0 3 /s, 2xl0 3 /s, 2.5xl0 3 /s, 3xl0"7s, 4xl0 3 /s, 5xl0 3 /s, 6xl0 3 /s, 7xl0 3 /s, 8xl0 3 /s, 9xl0 3 /s, lxlO Vs, 2xl0 4 /s, 3xl0 4 /s, 4xl0 4 /s, 5xl0 4 /s, 6xl0 4 /s, 7xl0 4 /s, or 8xl0 4 /s.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein binds to LGALS3 with a ka of at least or about 2.5xl0 4 /s, 3xl0 4 /s, 3.5xl0 4 /s, 4xl0 4 /s, 4.5xl0 4 /s, 5xl0 4 /s, 5.5xl0 4 /s, 6xl0 4 /s, 6.5xl0 4 /s, 7xl0 4 /s, 7.5xl0 4 /s, 8xl0 4 /s, 9xl0 4 /s, or 9xl0 5 /s.
- an anti-LGALS3 antibody or an antigen binding fragment thereof described herein binds to LGALS3 with a ka of at least or about 2.5xl0 4 /s to 9xl0 5 /s.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein binds to LGALS3 with a KD of less than or about 1000 nM, 500 nM, 100 nM, 50 nM, 25 nM, 20 nM, 15 nM, 10 nM, 5 nM, 4 nM, 3 nM, 2 nM, 1 nM, 0.5 nM, 0.1 nM, or 0.05 nM.
- an anti-LGALS3 antibody or an antigen- binding fragment thereof described herein binds to LGALS3 with a KD of about 10 nM to about 1000 nM.
- an anti-LGALS3 antibody or an antigen binding fragment thereof described herein binds LGALS3 with a KD of about 100 nM to about 1000 nM. In some embodiments, an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein binds LGALS3 with a KD of about 500 nM to about 1000 nM.
- the anti-LGALS3 antibody or antigen-binding fragment thereof provided herein binds to LGALS3at least 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 250, 500, or 1000 fold more than an isotype control antibody binds to LGALS3.
- An isotype control antibody is an art-recognized term the refers to an antibody that lacks specificity to the target, but match the class and type of the primary antibody (e.g., an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein). Isotype controls are used as negative controls to help differentiate non-specific background signal from specific antibody signal.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein binds to LGALS3 with a 100-1,000 fold increased affinity over the natural ligand binding.
- Assays to determine the anti-LGALS3 antibody- or antigen-binding fragment- mediated inhibition of Matrigel invasion are known to a person skilled in the art.
- BD BioCoatTM MatrigelTM Invasion Inserts or Chambers catalog # 354480 in 24 well plate
- Control Inserts catalog # 354578 in 24 well plate
- Matrigel Invasion assay can be performed as per manufacturer's protocol. Briefly, the Matrigel chambers in 24 well plates (stored at -20°C) and control inserts (stored at 4°C) are allowed to come to room temperature.
- Both inserts are rehydrated with 0.5 mL of serum free medium in the insert as well as in the outside well of the 24 well plate, for 2 hrs at 37°C 5% CO2 humidified incubator.
- Cultured SKOV3 cells are trypsinized and washed with culture medium. A million cells are separated into another centrifuge tube and washed 3 times with serum free medium. These cells are later adjusted to give 5,000 cells in 0.5 mL serum free medium.
- the medium in the rehydrated inserts are removed and the insert was transferred into a new 24 well plate containing 0.75 mL of 10% Fetal Bovine Serum (FBS) containing culture medium in the well which serves as a chemo attractant.
- FBS Fetal Bovine Serum
- the insert 0.5 mL of the cells (5,000 cells) in serum free medium is added to the insert. Proper care is taken to see that there is no air bubble is trapped in the insert and the outside well.
- the 24 well plate is incubated at 37°C 5% CO2 humidified incubator for 48 hrs. After incubation, the non invading cells are removed from the upper surface of the membrane by "scrubbing" by inserting a cotton tipped swab into Matrigel or control insert and gently applied pressure while moving the tip of the swab over the membrane surface. The scrubbing is repeated with a second swab moistened with medium.
- the inserts are stained in a new 24 well plate containing 0.5 mL of 0.5% crystal violet stain in distilled water for 30 minutes. Following staining the inserts are rinsed in 3 beakers of distilled water to remove excess stain. The inserts are air dried for in a new 24 well plate. The invaded cells are hand counted under an inverted microscope at 200X magnification. Several fields of triplicate membranes were counted and recorded in the figure.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein is capable of inhibiting or reducing metastasis, inhibiting tumor growth or inducing tumor regression in mouse model studies.
- tumor cell lines can be introduced into athymic nude mice, and the athymic mice can be administered anti-LGALS3 antibodies described herein one or more times, and tumor progression of the injected tumor cells can be monitored over a period of weeks and/or months.
- administration of the anti-LGALS3 antibodies or antigen-binding fragments thereof to the athymic nude mice can occur prior to introduction of the tumor cell lines.
- SKOV3 cells are utilized for the mouse xenograft models described herein.
- anti-LGALS3 antibodies or antigen-binding fragments thereof described herein inhibit tumor growth or induce tumor regression in a mouse model by at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, 99%, or 100% as assessed by methods described herein or known to one of skill in the art, as compared to mock treated mice.
- anti-LGALS3 antibodies or antigen-binding fragments thereof described herein inhibit tumor growth or induce tumor regression in a mouse model by at least about 25% or 35%), optionally to about 75%, as assessed by methods described herein or known to one of skill in the art, as compared to mock-treated mice.
- anti- LGALS3 antibodies or antigen-binding fragments thereof described herein inhibit tumor growth or induce tumor regression in a mouse model by at least about 1 fold, 1.2 fold, 1.3 fold, 1.4 fold, 1.5 fold, 2 fold, 2.5 fold, 3 fold, 3.5 fold, 4 fold, 4.5 fold, 5 fold, 6 fold, 7 fold,
- Mock-treated mice can, for example, be treated with phosphate buffered saline or a control (e.g anti-IgG antibody).
- Determining tumor growth inhibition or tumor regression can be assessed, for example, by monitoring tumor size over a period of time, such as by physical measurement of palpable tumors, or other visual detection methods.
- tumor cell lines can be generated to recombinantly express a visualization agent, such as green fluorescent protein (GFP) or luciferase, then in vivo visualization of GFP can be carried out by microscopy, and in vivo visualization of luciferase can be carried out by administering luciferase substrate to the xenograft mice and detecting luminescent due to the luciferase enzyme processing the luciferase substrate. The degree or level of detection of GFP or luciferase correlates to the size of the tumor in the xenograft mice.
- a visualization agent such as green fluorescent protein (GFP) or luciferase
- anti-LGALS3 antibodies or antigen-binding fragments thereof described herein can increase survival of animals in tumor xenograft models as compared to mock-treated mice.
- anti-LGALS3 antibodies or antigen-binding fragments thereof described herein increase survival of mice in tumor xenograft models by at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99% as assessed by methods described herein or known to one of skill in the art, as compared to mock-treated mice.
- anti-LGALS3 antibodies or antigen-binding fragments thereof described herein increase survival of mice in tumor xenograft models by at least about 25% or 35%, optionally to about 75%), as assessed by methods described herein or known to one of skill in the art, as compared to mock-treated mice in tumor xenograft models.
- anti-LGALS3 antibodies or antigen-binding fragments thereof described herein increase survival of mice in tumor xenograft models by at least about 1 fold, 1.2 fold, 1.3 fold, 1.4 fold, 1.5 fold, 2 fold, 2.5 fold, 3 fold, 3.5 fold, 4 fold, 4.5 fold, 5 fold, 6 fold, 7 fold, 8 fold, 9 fold, 10 fold, 15 fold, 20 fold, 30 fold, 40 fold, 50 fold, 60 fold, 70 fold, 80 fold, 90 fold, or 100 fold as assessed by methods described herein or known to one of skill in the art, as compared to mock- treated mice in tumor xenograft models.
- Survival can, for example, be determined by plotting a survival curve of number of surviving mice against time ( e.g ., days or weeks) after tumor cell line injection.
- Mock-treated mice can, for example, be treated with phosphate buffered saline or a control (e.g., anti-IgG antibody).
- an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein is conjugated to another molecule, such as an organic moiety, a detectable label, and/or an isotope.
- anti-LGALS3 antibodies or antigen binding fragment thereof conjugates wherein said anti-LGALS3 antibody or antigen-binding fragment thereof is conjugated to one or more agents, e.g., an imaging agent or a cytotoxic agent.
- agents e.g., an imaging agent or a cytotoxic agent.
- bispecific antibody conjugates wherein said bispecific antibody is conjugated to one or more agent, e.g, an imaging agent or a cytotoxic agent.
- antibody heavy chain conjugates wherein said antibody heavy chain is conjugated to one or more agent, e.g, an imaging agent or a cytotoxic agent.
- antibody light chain conjugates wherein said antibody light chain is conjugated to one or more agent, e.g, an imaging agent or a cytotoxic agent.
- fusion protein conjugates wherein said fusion protein is conjugated to an agent, e.g, an imaging agent or a cytotoxic agent.
- the agent is conjugated covalently or non-covalently.
- the imaging agent is a detectable label, such as, a chromogenic, enzymatic, radioisotopic, isotopic, fluorescent, toxic,
- Non-limiting examples of suitable chromogenic labels include diaminobenzidine and 4-hydroxyazo-benzene-2-carboxylic acid.
- Non-limiting examples of suitable enzyme labels include malate dehydrogenase, staphylococcal nuclease, delta-5-steroid isomerase, yeast-alcohol dehydrogenase, alpha- glycerol phosphate dehydrogenase, triose phosphate isomerase, peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta-galactosidase, ribonuclease, urease, catalase, glucose-6- phosphate dehydrogenase, glucoamylase, and acetylcholine esterase.
- Non-limiting examples of suitable radioisotopic labels include 3 H, U1 ln, 125 I, 131 I, 32 P, 35 S, 14 C, 51 Cr, 57 To, 58 Co, 59 Fe, 75 Se, 152 Eu, 90 Y, 67 Cu, 217 Ci, 211 At, 212 Pb, 47 Sc, 223 Ra,
- U1 ln is used for in vivo imaging as it avoids the problem of dehalogenation of 125 I or 131 I -labeled anti-LGALS3 antibodies or antigen-binding fragments thereof in the liver.
- U1 ln has a more favorable gamma emission energy for imaging (Perkins et al. (1985) Eur. J. Nucl. Med. 70:296-301;
- Non-limiting examples of suitable non-radioactive isotopic labels include 157 Gd, 55 Mn, 162 Dy, 52 Tr, and 56 Fe.
- suitable fluorescent labels include a 152 Eu label, a fluorescein label, an isothiocyanate label, a rhodamine label, a phycoerythrin label, a phycocyanin label, an allophycocyanin label, a Green Fluorescent Protein (GFP) label, an o- phthaldehyde label, and a fluorescamine label.
- GFP Green Fluorescent Protein
- Non-limiting examples of chemiluminescent labels include a luminol label, an isoluminol label, an aromatic acridinium ester label, an imidazole label, an acridinium salt label, an oxalate ester label, a luciferin label, a luciferase label, and an aequorin label.
- Non-limiting examples of nuclear magnetic resonance contrasting agents include heavy metal nuclei such as Gd, Mn, and iron.
- Non-limiting examples of cytotoxic agents include a cytostatic or cytocidal agent, a radioactive metal ion, e.g., alpha-emitters, and toxins, e.g, pseudomonas exotoxin, abrin, cholera toxin, ricin A, and diphtheria toxin.
- cytotoxic agents include a cytostatic or cytocidal agent, a radioactive metal ion, e.g., alpha-emitters, and toxins, e.g, pseudomonas exotoxin, abrin, cholera toxin, ricin A, and diphtheria toxin.
- the agent is a diagnostic agent.
- a diagnostic agent is an agent useful in diagnosing or detecting a disease by locating the cells containing the antigen.
- useful diagnostic agents include, but are not limited to, radioisotopes, dyes (such as with the biotin-streptavidin complex), contrast agents, fluorescent compounds or molecules and enhancing agents (e.g, paramagnetic ions) for magnetic resonance imaging (MRI).
- MRI magnetic resonance imaging
- U.S. Pat. No. 6,331,175 describes MRI technique and the preparation of antibodies conjugated to a MRI enhancing agent and is incorporated in its entirety by reference.
- the diagnostic agents are selected from the group consisting of radioisotopes, enhancing agents for use in magnetic resonance imaging, and fluorescent compounds.
- Such a tail can be a polymer such as a polylysine, polysaccharide, or other derivatized or derivatizable chain having pendant groups to which can be bound chelating groups such as, for example, ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTP A), porphyrins, polyamines, crown ethers, bis- thiosemicarbazones, polyoximes, and like groups known to be useful for this purpose.
- EDTA ethylenediaminetetraacetic acid
- DTP A diethylenetriaminepentaacetic acid
- porphyrins porphyrins
- polyamines crown ethers
- bis- thiosemicarbazones polyoximes, and like groups known to be useful for this purpose.
- Chelates are coupled to the antibodies using standard chemistries.
- the chelate is normally linked to the antibody by a group which enables formation of a bond to the molecule with minimal loss of immunoreactivity and minimal aggregation and/or internal cross-linking other, more unusual, methods and reagents for conjugating chelates to antibodies are disclosed in U.S. Pat. No. 4,824,659 to Hawthorne, entitled “Antibody Conjugates,” issued Apr. 25, 1989, the disclosure of which is incorporated herein in its entirety by reference.
- Particularly useful metal-chelate combinations include 2- benzyl-DTPA and its monomethyl and cyclohexyl analogs, used with diagnostic isotopes for radio-imaging.
- chelates when complexed with non-radioactive metals, such as manganese, iron and gadolinium are useful for MRI, when used along with an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein.
- Macrocyclic chelates such as NOTA, DOTA, and TETA are of use with a variety of metals and radiometals, most particularly with radionuclides of gallium, yttrium and copper, respectively.
- metal- chelate complexes can be made very stable by tailoring the ring size to the metal of interest.
- Other ring-type chelates such as macrocyclic polyethers, which are of interest for stably binding nuclides, such as 223Ra for RAIT are encompassed herein.
- the agent is an organic agent.
- organic agents can produce a conjugate with improved pharmacokinetic properties (e.g ., increased in vivo serum half-life).
- the organic moiety can be a hydrophilic polymeric group, fatty acid group, or fatty acid ester group.
- fatty acid encompasses mono-carboxylic acids and di-carboxylic acids.
- a hydrophilic polymeric group refers to an organic polymer that is more soluble in water than in octane, e.g., polylysine.
- Hydrophilic polymers suitable for modifying an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein can be linear or branched and include, for example, polyalkane glycols (e.g, polyethylene glycol, (PEG), monomethoxy-polyethylene glycol, and polypropylene glycol), carbohydrates (e.g, dextran, cellulose, oligosaccharides, and polysaccharides), polymers of hydrophilic amino acids (e.g polylysine, polyarginine, and polyaspartate), polyalkane oxides (e.g, polyethylene oxide and polypropylene oxide) and polyvinyl pyrolidone.
- polyalkane glycols e.g, polyethylene glycol, (PEG), monomethoxy-polyethylene glycol, and polypropylene glycol
- carbohydrates e.g, dextran, cellulose, oligosaccharides, and polysaccharides
- polymers of hydrophilic amino acids e.g poly
- the hydrophilic polymer that modifies an anti-LGALS3 antibody or antigen binding fragment thereof, a bispecific antibody, an antibody heavy chain, an antibody light chain, or a fusion protein provided herein has a molecular weight of about 800 to about 150,000 Daltons as a separate molecular entity.
- PEGsooo and PEG2o,ooo wherein the subscript is the average molecular weight of the polymer in Daltons, can be used.
- the hydrophilic polymeric group can be substituted with one to about six alkyl, fatty acid or fatty acid ester groups. Hydrophilic polymers that are substituted with a fatty acid or fatty acid ester group can be prepared by employing suitable methods.
- a polymer comprising an amine group can be coupled to a carboxylate of the fatty acid or fatty acid ester, and an activated carboxylate (e.g, activated with N,N-carbonyl diimidazole) on a fatty acid or fatty acid ester can be coupled to a hydroxyl group on a polymer.
- an activated carboxylate e.g, activated with N,N-carbonyl diimidazole
- Fatty acids and fatty acid esters suitable for modifying an anti-LGALS3 antibody or antigen-binding fragment thereof, a bispecific antibody, an antibody heavy chain, an antibody light chain, or a fusion protein provided herein can be saturated or can contain one or more units of unsaturation.
- Fatty acids that are suitable for modifying an anti-LGALS3 antibody or antigen-binding fragment thereof, a bispecific antibody, an antibody heavy chain, an antibody light chain, or a fusion protein provided herein include, for example, n- dodecanoate, n- tetradecanoate, n-octadecanoate, n-eicosanoate, n-docosanoate, n- triacontanoate, n- tetracontanoate, cis-delta-9-octadecanoate, all cis-delta-5, 8, 11, 14- eicosatetraenoate, octanedioic acid, tetradecanedioic acid, octadecanedioic acid,
- Suitable fatty acid esters include mono-esters of
- dicarboxylic acids that comprise a linear or branched lower alkyl group.
- the lower alkyl group can comprise from one to about twelve, preferably one to about six, carbon atoms.
- the conjugates provided herein can be prepared using suitable methods, such as by reaction with one or more modifying agents.
- an "activating group” is a chemical moiety or functional group that can, under appropriate conditions, react with a second chemical group thereby forming a covalent bond between the modifying agent and the second chemical group.
- amine-reactive activating groups include electrophilic groups such as, for example, tosylate, mesylate, halo (chloro, bromo, fluoro, iodo), N- hydroxysuccinimidyl esters (NHS), and the like.
- Activating groups that can react with thiols include, for example, maleimide, iodoacetyl, acrylolyl, pyridyl disulfides, 5-thiol-2- nitrobenzoic acid thiol (TNB- thiol), and the like.
- An aldehyde functional group can be coupled to amine- or hydrazide- containing molecules, and an azide group can react with a trivalent phosphorous group to form phosphoramidate or phosphorimide linkages.
- Suitable methods to introduce activating groups into molecules are known in the art (see, for example, Hernanson, G. T., Bioconjugate Techniques , Academic Press: San Diego, Calif. (1996)).
- An activating group can be bonded directly to the organic group (e.g. , hydrophilic polymer, fatty acid, fatty acid ester), or through a linker moiety, for example a divalent C1-C12 group, wherein one or more carbon atoms can be replaced by a heteroatom such as oxygen, nitrogen or sulfur.
- Suitable linker moieties include, for example, tetraethylene glycol, (CH 2 )3, and NH.
- Modifying agents that comprise a linker moiety can be produced, for example, by reacting a mono-Boc-alkyldiamine (e.g, mono-Boc- ethylenediamine or mono-Boc-diaminohexane) with a fatty acid in the presence of l-ethyl-3-(3- dimethylaminopropyl)carbodiimide (EDC) to form an amide bond between the free amine and the fatty acid carboxylate.
- a mono-Boc-alkyldiamine e.g, mono-Boc- ethylenediamine or mono-Boc-diaminohexane
- EDC l-ethyl-3-(3- dimethylaminopropyl)carbodiimide
- the Boc protecting group can be removed from the product by treatment with trifluoroacetic acid (TFA) to expose a primary amine that can be coupled to another carboxylate as described, or can be reacted with maleic anhydride and the resulting product cyclized to produce an activated maleimido derivative of the fatty acid.
- TFA trifluoroacetic acid
- a "modifying agent” can refer to a suitable organic group (e.g, hydrophilic polymer, a fatty acid, and a fatty acid ester) that comprises an activating group.
- the organic moieties can be bonded to the anti-LGALS3 antibody or antigen-binding fragment thereof in a non-site specific manner by employing an amine-reactive modifying agent, for example, an N-hydroxysuccinimide ester of PEG.
- a modified the anti-LGALS3 antibody or antigen-binding fragment thereof can also be prepared by reducing disulfide bonds (e.g, intra- chain disulfide bonds) of the anti-LGALS3 antibody or antigen-binding fragment thereof, bispecific antibody, antibody heavy chain, antibody light chain, or fusion protein.
- the reduced anti-LGALS3 antibody or antigen-binding fragment thereof, bispecific antibody, antibody heavy chain, antibody light chain, or fusion protein can then be reacted with a thiol -reactive modifying agent to produce the conjugates provided herein.
- Conjugates comprising an organic moiety that is bonded to specific sites of an anti-LGALS3 antibody or antigen-binding fragment thereof provided herein can be prepared using suitable methods, such as reverse proteolysis (Fisch et al. (1992) Bioconjugate Chem ., 3: 147-153; Werlen et al. (1994) Bioconjugate Chem., 5 :4l 1-417; Kumaran et al. (1997) Protein Sci . 6(l0):2233- 2241; Itoh et al. (1996) Bioorg. Chem., 24(1): 59-68; Capellas et al. (1997) Biotechnol.
- suitable methods such as reverse proteolysis (Fisch et al. (1992) Bioconjugate Chem ., 3: 147-153; Werlen et al. (1994) Bioconjugate Chem., 5 :4l 1-417; Kumaran et al. (1997) Protein Sci . 6(l0):
- antibodies or antigen-binding fragments thereof described herein can be produced by any method known in the art for the synthesis of antibodies, e.g, by chemical synthesis or by recombinant expression techniques.
- the methods described herein employs, unless otherwise indicated, conventional techniques in molecular biology, microbiology, genetic analysis, recombinant DNA, organic chemistry, biochemistry, PCR, oligonucleotide synthesis and modification, nucleic acid hybridization, and related fields within the skill of the art. These techniques are described, e.g, in the references cited herein and are fully explained in the literature.
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein is an antibody (e.g, recombinant antibody) prepared, expressed, created or isolated by any means that involves creation, e.g, via synthesis, genetic
- an anti- LGALS3 antibody or antigen binding fragment thereof described herein is made by a method comprising using the carbohydrate binding domain of LGALS3 or a portion thereof. See, e.g., Example 3 for a detailed description of an exemplary method for how to produce antibodies described herein.
- an immunogenic peptide comprising CNTKLDNNW GREERQ S VFPFE S G (SEQ ID NO: 2).
- an immunogenic peptide comprising a Fc- fusion protein comprising amino acids 117-224 of LGALS3 linked to the Fc region (CH2 and CH3 domains) of the human IgGl heavy chain and the hinge region.
- Amino acids 117-224 of LGALS3 is represented by the following amino acid sequence:
- amino acids 117-224 of LGALS3 can be encoded by the following exemplary nucleotide sequence:
- the immunogenic peptide is conjugated to an
- immunogenic carrier protein In most cases, small antigens (e.g, short peptides or small haptens) are not sufficiently complex to elicit the production of antibodies.
- the immunogenic carrier proteins because of their large size and complex structure, may confer
- immunogenicity to conjugated small antigens, resulting in antibodies being produced against epitopes on the small antigens and the immunogenic carrier proteins. Therefore, small antigens are always chemically conjugated with immunogenic carrier proteins to intensify the immune response for successful production of antibodies.
- immunogenic carrier proteins include, but are not limited to, keyhole limpet hemocyanin (KLH),
- the immunogenic peptide is conjugated to KLH.
- KLH is a copper-containing polypeptide that belongs to a group of non-heme proteins called hemocyanins, which are found in arthropods and mollusks.
- KLH is isolated from keyhole limpets (Megathura crenulata). Because of its evolutionary distance from mammals, high molecular weight, complex structure, and a large surface containing several hundred lysine groups that provide primary amines as targets for conjugation, KLH is an extremely immunogenic and effective carrier protein in mammals.
- the immunogenic peptide is 10 to 60 amino acid residues in length. In some embodiments, the immunogenic peptide is 10 to 30 amino acid residues in length. In some embodiments, the immunogenic peptide is 15 to 25 amino acid residues in length. In some embodiments, the immunogenic peptide is 15 to 20 amino acid residues in length. In specific embodiments, the immunogenic peptide is 15 to 18 amino acid residues in length.
- the immunogenic peptide comprises an at least 10 amino acid portion of the LGALS3 CBD domain. In certain embodiments, the immunogenic peptide comprises an at least 10 amino acid portion of the amino acid sequence of SEQ ID NO: 27. In certain other embodiments, the immunogenic peptide comprises an at least 15, 20, 25, or 30 amino acid portion of the amino acid sequence of SEQ ID NO: 27. In specific embodiments, the immunogenic peptide consists of 15 to 30 consecutive amino acid residues of SEQ ID NO: 27.
- a method of generating an antibody or an antigen-binding fragment thereof that immunospecifically binds to a LGALS3, comprising immunizing a subject with an immunogenic peptide as described above.
- the subject immunized in accordance with the methods described herein can be, but is not limited to, a goat, a sheep, a donkey, a chicken, a guinea pig, a rat, a rabbit, or a mouse.
- the subject immunized in accordance with the methods described herein is a rat, a rabbit, or a mouse.
- the subject immunized in accordance with the methods described herein is a mouse.
- the subject immunized in accordance with the methods described herein is a transgenic mouse that expresses chimeric forms of various immunoglobulin chains.
- the transgenic mouse expresses human variable region linked to a mouse constant region.
- Immunization of the subject can be performed by any method known in the art, for example, by administering the immunogenic peptide and an adjuvant to the subject as described in Example 3.
- the method of preparing the immunogenic peptide comprises synthesizing the peptide moiety.
- the peptide moiety of the immunogenic peptide can be synthesized by any method known in the art, for example, by Fmoc solid- phase peptide synthesis.
- anti-LGALS3 antibodies or antigen-binding fragments thereof described herein can be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567.
- the one or more DNAs encoding an anti-LGALS3 antibody or antigen- binding fragment thereof provided herein can be readily isolated and sequenced using conventional procedures ( e.g by using
- oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies, or such chains from human, humanized, or other sources).
- the DNA can be placed into expression vectors, which are then transformed into host cells such as NSO cells, Simian COS cells, Chinese hamster ovary (CHO) cells, yeast cells, algae cells, eggs, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of the anti-LGALS3 antibody or antigen binding fragment thereof in the recombinant host cells.
- the DNA also can be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains of a desired species in place of the homologous human sequences (U.S.
- non-immunoglobulin polypeptide can be substituted for the constant domains of an anti- LGALS3 antibody or antigen-binding fragment thereof provided herein.
- the DNA encoding anti-LGALS3 antibodies or antigen-binding fragments thereof provided herein can also be prepared using at least one anti-LGALS3 antibody- or antigen- binding fragment thereof-encoding polynucleotide to provide transgenic animals or mammals, such as goats, cows, horses, sheep, and the like, that produce such antibodies in their milk.
- Such animals can be provided using known methods. See, for example, but not limited to, U.S. Pat. Nos. 5,827,690; 5,849,992; 4,873,316; 5,849,992; 5,994,616, 5,565,362; 5,304,489, and the like, each of which is entirely incorporated herein by reference.
- anti-LGALS3 antibodies or antigen-binding fragments thereof provided herein can additionally be prepared using at least one anti-LGALS3 antibody - or antigen-binding fragment thereof-encoding polynucleotide provided herein to provide transgenic plants and cultured plant cells (for example, but not limited to tobacco and maize) that produce such antibodies, specified portions or variants in the plant parts or in cells cultured there from.
- transgenic tobacco leaves expressing recombinant proteins have been successfully used to provide large amounts of recombinant proteins, for example, using an inducible promoter. See, for example, Cramer et al. (1999) Curr. Top. Microbol. Immunol.
- transgenic maize has been used to express mammalian proteins at commercial production levels, with biological activities equivalent to those produced in other recombinant systems or purified from natural sources. See , for example, Hood et al. (1999) Adv. Exp. Med. Biol. 464: 127-147 and references cited therein.
- Antibodies have also been produced in large amounts from transgenic plant seeds including antibody fragments, such as scFvs, including tobacco seeds and potato tubers. See , for example, Conrad et al. (1998) Plant Mol. Biol. 38: 101-109 and references cited therein.
- anti-LGALS3 antibodies or antigen-binding fragments thereof can also be produced using transgenic plants, according to known methods. See also, for example, Fischer et al. (1999) Biotechnol. Appl. Biochem. 30:99-108, Ma et al. (1995) Trends Biotechnol. 13 :522-7; Ma et al, (1995) Plant Physiol. 109:341-6; Whitelam et al. (1994) Biochem Soc. Trans. 22:940- 944; and references cited therein. Each of the above references is entirely incorporated herein by reference.
- anti-LGALS3 antibodies or antigen-binding fragments thereof provided herein can be prepared using at least one anti-LGALS3 antibody- or antigen-binding fragment thereof-encoding polynucleotide provided herein to provide bacteria that produce such anti-LGALS3 antibodies or antigen-binding fragments.
- E. coli expressing recombinant proteins has been successfully used to provide large amounts of recombinant proteins. See , for example, Verma et al. (1998) 216(1- 2): 165-181 and references cited therein.
- anti-LGALS3 antibodies or antigen-binding fragments thereof provided herein are utilized in the generation of bispecific antibodies.
- Bispecific antibodies can be made by fusing two hybridomas to create hybrid immunoglobulin molecules with two binding sites. Bispecific antibodies not only handcuff tumors to T-cells; they cross-link CD3 on T-cells and initiate the activation cascade. This way, T cell receptor- based cytotoxicity is redirected to desired tumor targets bypassing MHC restrictions.
- ATC polyclonally activated T cells
- BsAb or BiTE can arm ex vivo expanded activated T cells before infusion into a patient. This strategy converts every ATC into a specific CTL (Thakur and Lum (2010) Curr OpinMol Ther 12, 340-349; Grabert et al. (2006) Clin Cancer Res 12, 569-576).
- Bispecific binding molecules can be comprised of an anti-LGALS3 antibody, wherein the anti-LGALS3 antibody is an immunoglobulin, wherein each light chain of the immunoglobulin is a fusion protein, wherein the fusion protein is the immunoglobulin light chain linked via a peptide linker to a scFv targeting CD3.
- a N297A mutation in the CH2 domain results in a glycosylation leading to no FcR or Clq binding.
- CARs are most commonly composed of a single chain variable fragment length antibody (scFv), such as one derived from a monoclonal antibody targeting a given tumor associated antigen and/or variant thereof, a transmembrane domain (for example, a transmembrane domain derived from a T Cell surface molecule such as a costimulatory molecule such as CD8, CD28, OX-40, and 4-1BB), a signaling portion of a TCR complex, such as an intracellular domain and/or additional portion(s) of a TCR zeta (z) chain, such as a cytoplasmic signaling domain thereof.
- scFv single chain variable fragment length antibody
- a transmembrane domain for example, a transmembrane domain derived from a T Cell surface molecule such as a costimulatory molecule such as CD8, CD28, OX-40, and 4-1BB
- signaling portion of a TCR complex such as an intracellular domain and/or additional portion(s) of
- the heavy and light chain variable regions of a monoclonal anti-LGALS3 antibody described herein are isolated from a hybridoma cell line which generates a monoclonal anti-LGALS3 antibody.
- RNA is extracted from the hybridoma cell line and cDNA is generated from the RNA by reverse transcription PCR.
- the VH and VL chain variable regions are cloned by standard PCR utilizing primers specific for such variable regions.
- the resulting VH and VL fragments are subcloned into a shuttle vector, such as, for example TopoTA PCR 2.1 cloning vector (Invitrogen), and sequenced.
- VH and VL fragments are subsequently ligated to a (Gly4Ser)3 spacer domain, generating an anti-LGALS3 antibody scFv and fused to the human CD8 leader peptide (CD8L) (CD8L-anti-LGALS3 antibody scFv) by overlapping PCR (see, e.g., Maher et al. (2002) Nat Biotechnol 20(1): 70-5 and Gong et al. (1999) Neoplasia 1(2): 123-7).
- the coding region of the CD8L-anti-LGALS3 antibody scFv is fused to the human CD8 hinge and transmembrane domains, or alternatively to the CD28 transmembrane and cytoplasmic signaling domains, fused to the T cell receptor 0)3-z signaling domain (see, e.g, Maher et al. (2002) Nat Biotechnol 20(l):70-5; Brentjens el al. (2003) Nat Med 9(3):279-86; and Brentjens et al. (2007) Clin Cancer Res 13(18 Pt l):5426-35).
- a T cell expressing a CAR described herein.
- Methods for the generation of a T cell expressing a CAR are known in the art.
- a CAR construct can be sub-cloned into a modified MMLV retroviral vector SFG (see, e.g, Riviere et al. (1995) Proc Natl Acad Sci USA 92(l5):6733-7) or other suitable retroviral vectors.
- the retroviral vector is a lentiviral vector, for example, an HIV-based vector.
- VSV-G pseudotyped retroviral supernatants derived from transduced gpg29 fibroblasts can be used to construct stable PG13 gibbon ape leukemia virus (GaLV) envelope-pseudotyped retroviral producing cell lines (see, e.g, Gong et al. (1999) Neoplasia 1(2): 123-7).
- Isolated healthy donor peripheral blood mononuclear cells (PBMCs) can be activated with phytohemagglutinin (PHA) at 2pg/ml (Sigma. St. Louis, MO) and retrovirally transduced on retronectin coated non- tissue culture plates (Quintas-Cardama A, et al. (2007) Hum Gene Ther 18(12): 1253-60) to generate the T cell recombinantly expressing the CAR.
- PHA phytohemagglutinin
- Single domain antibodies e.g, antibodies lacking the light chains
- Single domain antibodies can be produced by methods well known in the art. See, e.g, Riechmann and Muyldermans (1999) J Immunol 231 : 25-38; Nuttall SD et al. (2000) Curr Pharm Biotechnol 1(3): 253-263;
- an anti-LGALS3 antibody or antigen binding fragment thereof described herein which binds to the same or an overlapping epitope as an anti- LGALS3 antibody described herein, is a human anti-LGALS3 antibody or antigen-binding fragment thereof.
- Human antibodies can be produced using any method known in the art.
- transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes, can be used.
- the human heavy and light chain immunoglobulin gene complexes can be introduced randomly or by homologous recombination into mouse embryonic stem cells.
- the human variable region, constant region, and diversity region can be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes.
- the mouse heavy and light chain immunoglobulin genes can be rendered non functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the JH region prevents endogenous antibody production.
- the modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice.
- the chimeric mice are then bred to produce homozygous offspring which express human antibodies.
- the transgenic mice are immunized in the normal fashion with a selected antigen, e.g., all or a portion of an antigen.
- Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology.
- the human immunoglobulin transgenes harbored by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation.
- mice capable of producing human antibodies include the XenomouseTM (Abgenix, Inc.; ET.S. Patent Nos.
- human antibodies can be produced using mouse-human hybridomas.
- human peripheral blood lymphocytes transformed with Epstein- Barr virus (EBV) can be fused with mouse myeloma cells to produce mouse-human hybridomas secreting human monoclonal antibodies, and these mouse-human hybridomas can be screened to determine ones which secrete human monoclonal antibodies that immunospecifically bind to a target antigen.
- EBV Epstein- Barr virus
- Such methods are known and are described in the art, see, e.g., Shinmoto H et al. (2004) Cytotechnology 46: 19-23; Naganawa Y et al. (2005) Human Antibodies 14: 27-31.
- the mouse-human hybridomas are generated from mice immunize with an immunogenic peptide of LGALS3 or a chimeric fusion protein as described in Example 3.
- the monoclonal antibodies secreted by the hybridomas are screened for binding to the LGALS3 carbohydrate binding domain peptide (CBD), full-length LSGAL3 protein.
- CBD carbohydrate binding domain peptide
- the LGALS3 N- terminus, which contains the polymerization domain is employed as a control.
- the monoclonal antibodies are further screened against Murine Gal3 CBD (mCBD3) or other members of the galectin family, such as, for example, LGAL1, LGAL7, LGAL8, and LGAL9.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein can be purified by any method known in the art for purification of an immunoglobulin molecule, e.g, by chromatography (e.g, ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column
- antibodies described herein can be fused to heterologous polypeptide sequences described herein or otherwise known in the art to facilitate purification.
- an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein is isolated or purified.
- an isolated antibody is one that is substantially free of other antibodies with different antigenic specificities than the isolated antibody.
- a preparation of an anti-LGALS3 antibody or antigen binding fragment thereof described herein is substantially free of cellular material and/or chemical precursors.
- substantially free of cellular material includes preparations of an anti-LGALS3 antibody or antigen binding fragment thereof in which the antibody is separated from cellular components of the cells from which it is isolated or recombinantly produced.
- an anti-LGALS3 antibody or antigen binding fragment thereof that is substantially free of cellular material includes preparations of antibody having less than about 30%, 20%, 10%, 5%, 2%, 1%, 0.5%, or 0.1% (by dry weight) of heterologous protein (also referred to herein as a "contaminating protein") and/or variants of an anti-LGALS3 antibody or antigen binding fragment thereof, e.g., different post- translational modified forms of an anti-LGALS3 antibody or antigen binding fragment thereof or other different versions of an anti-LGALS3 antibody or antigen binding fragment thereof (e.g, antibody fragments).
- heterologous protein also referred to herein as a "contaminating protein”
- variants of an anti-LGALS3 antibody or antigen binding fragment thereof e.g., different post- translational modified forms of an anti-LGALS3 antibody or antigen binding fragment thereof or other different versions of an anti-LGALS3 antibody or antigen binding fragment thereof (e.g, antibody fragments).
- the antibody When the antibody is recombinantly produced, it is also generally substantially free of culture medium, i.e., culture medium represents less than about 20%, 10%, 2%, 1%, 0.5%, or 0.1% of the volume of the protein preparation.
- culture medium represents less than about 20%, 10%, 2%, 1%, 0.5%, or 0.1% of the volume of the protein preparation.
- the antibody When the antibody is produced by chemical synthesis, it is generally substantially free of chemical precursors or other chemicals, i.e., it is separated from chemical precursors or other chemicals which are involved in the synthesis of the protein. Accordingly, such preparations of the antibody have less than about 30%, 20%, 10%, or 5% (by dry weight) of chemical precursors or compounds other than the antibody of interest.
- antibodies described herein are isolated or purified.
- polynucleotides comprising a nucleotide sequence encoding an anti-LGALS3 antibody or antigen-binding fragment thereof. Also provided herein are vectors comprising such polynucleotides. Also provided herein are polynucleotides encoding antigens of the anti-LGALS3 antibody or antigen-binding fragment thereof described herein. Also provided herein are polynucleotides that hybridize under stringent or lower stringency hybridization conditions to polynucleotides that encode an anti- LGALS3 antibody or antigen-binding fragment thereof described herein.
- the language “purified” includes preparations of polynucleotide or nucleic acid molecule having less than about 15%, 10%, 5%, 2%, 1%, 0.5%, or 0.1% (in particular less than about 10%)) of other material, e.g., cellular material, culture medium, other nucleic acid molecules, chemical precursors and/or other chemicals.
- a nucleic acid molecule(s) encoding an anti-LGALS3 antibody or antigen-binding fragment thereof described herein is isolated or purified.
- Nucleic acid molecules provided herein can be in the form of RNA, such as mRNA, hnRNA, tRNA or any other form, or in the form of DNA, including, but not limited to, cDNA and genomic DNA obtained by cloning or produced synthetically, or any combinations thereof.
- the DNA can be triple-stranded, double-stranded or single-stranded, or any combination thereof. Any portion of at least one strand of the DNA or RNA can be the coding strand, also known as the sense strand, or it can be the non-coding strand, also referred to as the anti-sense strand.
- a polynucleotide comprising nucleotide sequences encoding anti-LGALS3 antibody or antigen-binding fragment thereof described herein.
- polynucleotides comprising nucleotide sequences encoding anti-LGALS3 antibodies or antigen-binding fragments thereof, which immunospecifically bind to LGALS3, and comprise an amino acid sequence as described herein, as well as antibodies which compete with such anti-LGALS3 antibody or antigen-binding fragment thereof for binding to LGALS3, or which binds to the same epitope as that of such antibodies.
- polynucleotides provided herein can be obtained by any method known in the art. For example, if the nucleotide sequence encoding an anti-LGALS3 antibody or antigen binding fragment thereof described herein is known, a polynucleotide encoding the anti- LGALS3 antibody or antigen-binding fragment thereof can be can be assembled from chemically synthesized oligonucleotides (e.g, as described in Kutmeier et al. (1994)
- oligonucleotides containing portions of the sequence encoding the antibody annealing and ligating of those oligonucleotides, and then amplification of the ligated oligonucleotides by PCR.
- a polynucleotide encoding an anti-LGALS3 antibody or antigen binding fragment thereof can be generated from nucleic acid from a suitable source. If a clone containing a nucleic acid encoding a particular anti-LGALS3 antibody or antigen-binding fragment thereof is not available, but the sequence of the anti-LGALS3 antibody or antigen binding fragment thereof is known, a nucleic acid encoding the anti-LGALS3 antibody or antigen-binding fragment thereof can be chemically synthesized or obtained from a suitable source (e.g ., an antibody cDNA library, or a cDNA library generated from, or nucleic acid, preferably poly A+ RNA, isolated from, any tissue or cells expressing the antibody, such as hybridoma cells selected to express an anti-LGALS3 antibody or antigen binding fragment thereof provided herein) by PCR amplification using synthetic primers that hybridize to the 3' and 5' ends of the sequence or by cloning using an oli
- Amplified nucleic acids generated by PCR may then be cloned into replicable cloning vectors using any method well known in the art.
- a polynucleotide encoding such an anti-LGALS3 antibody or antigen-binding fragment thereof can be manipulated using methods well known in the art for the manipulation of nucleotide sequences, e.g., recombinant DNA techniques, site directed mutagenesis, PCR, etc. (see, for example, the techniques described in Sambrook et /. (19900 Molecular Cloning, A
- Isolated nucleic acid molecules can include nucleic acid molecules comprising an open reading frame (ORF), optionally with one or more introns, for example, but not limited to, at least one specified portion of at least one complementarity determining region (CDR), as CDR1, CDR2 and/or CDR3 of at least one heavy chain or light chain; nucleic acid molecules comprising the coding sequence for an anti-LGALS3 antibody or variable region; and nucleic acid molecules which comprise a nucleotide sequence substantially different from those described above but which, due to the degeneracy of the genetic code, still encode at least one anti-LGALS3 antibody or antigen-binding fragment thereof as described herein.
- ORF open reading frame
- introns for example, but not limited to, at least one specified portion of at least one complementarity determining region (CDR), as CDR1, CDR2 and/or CDR3 of at least one heavy chain or light chain
- CDR complementarity determining region
- nucleic acid molecules comprising the coding sequence for
- nucleic acids that hybridize under selective hybridization conditions to a polynucleotide disclosed herein.
- the polynucleotides of this embodiment can be used for isolating, detecting, and/or quantifying nucleic acids comprising such polynucleotides.
- polynucleotides provided herein can be used to identify, isolate, or amplify partial or full-length clones in a deposited library.
- the polynucleotides are genomic or cDNA sequences isolated, or otherwise complementary to, a cDNA from a human or mammalian nucleic acid library.
- the nucleic acids can conveniently comprise sequences in addition to a polynucleotide provided herein.
- a multi-cloning site comprising one or more endonuclease restriction sites can be inserted into the nucleic acid to aid in isolation of the polynucleotide.
- translatable sequences can be inserted to aid in the isolation of the translated polynucleotide provided herein.
- a hexa-histidine marker sequence provides a convenient means to purify the polypeptides provided herein.
- the nucleic acid provided herein— excluding the coding sequence— is optionally a vector, adapter, or linker for cloning and/or expression of a polynucleotide provided herein.
- Additional sequences can also be added to such cloning and/or expression sequences to optimize their function in cloning and/or expression, to aid in isolation of the polynucleotide, or to improve the introduction of the polynucleotide into a cell.
- Use of cloning vectors, expression vectors, adapters, and linkers is well known in the art. (See, e.g., Ausubel, supra; or Sambrook, supra).
- one or more of the CDRs of an anti-LGALS3 antibody or antigen binding fragment thereof described herein can be inserted within known framework regions.
- the framework regions can be naturally occurring or consensus framework regions, and preferably human framework regions (see, e.g., Chothia el al. , (1998) J. Mol. Biol. 278: 457-479 for a listing of human framework regions).
- the polynucleotide generated by the combination of the framework regions and CDRs encodes an anti-LGALS3 antibody or antigen binding fragment thereof that immunospecifically binds LGALS3.
- One or more amino acid substitutions can be made within the framework regions, and, preferably, the amino acid substitutions improve binding of the antibody to its antigen. Additionally, such methods can be used to make amino acid substitutions or deletions of one or more variable region cysteine residues participating in an intrachain disulfide bond to generate antibody molecules lacking one or more intrachain disulfide bonds. Other alterations to the polynucleotide are provided herein and within the skill of the art.
- the isolated or purified nucleic acid molecule, or fragment thereof, upon linkage with another nucleic acid molecule can encode a fusion protein.
- the generation of fusion proteins is within the ordinary skill in the art and can involve the use of restriction enzyme or recombinant cloning techniques (see, for example, GatewayTM (Invitrogen)). See, also, U.S. Pat. No. 5,314,995.
- a polynucleotide provided herein is in the form of a vector (e.g ., expression vector).
- a vector e.g ., expression vector.
- polynucleotides comprising a nucleotide sequence encoding an anti-LGALS3 antibody or antigen binding fragment thereof described herein or an antigen-binding fragment thereof (e.g., a variable light chain region and/or variable heavy chain region) that immunospecifically binds to LGALS3, and vectors, e.g, vectors comprising such polynucleotides for their efficient expression in host cells (e.g, E. coli and mammalian cells).
- a polynucleotide is isolated or purified.
- polynucleotides comprising nucleotide sequences encoding anti-LGALS3 antibodies or antigen binding fragments thereof and comprise an amino acid sequence as described herein, as well as antibodies which compete with such antibodies for binding to LGALS3 (e.g, in a dose-dependent manner), or which binds to the same or an overlapping epitope as that of such antibodies.
- polynucleotides comprising a nucleic acid sequence encoding the light chain or heavy chain of an anti-LGALS3 antibody or antigen binding fragment thereof described herein.
- the polynucleotides can comprise nucleotide sequences encoding a heavy chain comprising the VH CDRs described herein (see, e.g, FIG. 12 and 13).
- the polynucleotides can comprise nucleotide sequences encoding a light chain comprising the VL CDRs described herein (see, e.g., FIG. 12 and 13).
- polynucleotides comprising a nucleotide sequence encoding an anti-LGALS3 antibody comprising three VH CDRs, e.g, containing VH CDR1, VH CDR2, and VH CDR3 as described in FIG. 12 and 13, wherein the antibody immunospecifically binds to LGALS3.
- a polynucleotide described herein encodes a VH CDR1, a VH CDR2, and a VH CDR3 of the 14D11 antibody (. i.e ., SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7, respectively), wherein the antibody immunospecifically binds to LGALS3.
- a polynucleotide described herein comprises a nucleotide sequence encoding an anti-LGALS3 antibody described herein comprising a heavy chain variable region that comprises an amino acid sequence described herein (e.g, SEQ ID NO: 24), wherein the antibody immunospecifically binds to LGALS3.
- polynucleotides comprising a nucleotide sequence encoding an anti-LGALS3 antibody comprising three VL CDRs, e.g, containing VL CDR1, VL CDR2, and VL CDR3 as described in FIG. 12 and 13, wherein the antibody immunospecifically binds to LGALS3.
- a polynucleotide described herein encodes a VL CDR1, a VL CDR2, and a VL CDR3 of the 14D11 antibody (i.e., SEQ ID NO: 8, SEQ ID NO: 9, and SEQ ID NO: 10, respectively), wherein the antibody immunospecifically binds to LGALS3.
- a polynucleotide described herein comprises a nucleotide sequence encoding an anti-LGALS3 antibody described herein comprising a light chain variable region that comprises an amino acid sequence described herein (e.g, SEQ ID NO: 26), wherein the antibody immunospecifically binds to LGALS3.
- a polynucleotide described herein comprises a nucleotide sequence encoding an anti-LGALS3 antibody described herein comprising a heavy chain variable region that comprises an amino acid sequence described herein (e.g, SEQ ID NO:
- a light chain variable region that comprises an amino acid sequence described herein (e.g, SEQ ID NO: 26), wherein the antibody immunospecifically binds to LGALS3.
- a polynucleotide comprising a nucleotide sequence encoding an anti-LGALS3 antibody or antigen binding fragment thereof comprising a light chain and a heavy chain, e.g, a separate light chain and heavy chain.
- a polynucleotide provided herein comprises a nucleotide sequence encoding an alpha (a), delta (d), epsilon (e), gamma (g) or mu (m) heavy chain.
- a polynucleotide provided herein comprises a nucleotide sequence encoding a kappa (K) or a lambda (l) light chain.
- cells e.g, isolated or ex vivo cells
- vectors comprising nucleotide sequences encoding an anti-LGALS3 antibody or antigen-binding fragment thereof described herein for recombinant expression in host cells, preferably in mammalian cells.
- cells e.g, isolated or ex vivo cells
- methods for producing an anti-LGALS3 antibody or antigen-binding fragment thereof described herein comprising expressing such anti-LGALS3 antibody or antigen-binding fragment thereof from a cell (e.g, isolated or ex vivo cells).
- a vector e.g, expression vector
- a vector is a DNA molecule comprising a gene that is expressed in a cell (e.g, ex vivo cell). Typically, gene expression is placed under the control of certain regulatory elements, including constitutive or inducible promoters, tissue-specific regulatory elements and enhancers. Such a gene is said to be "operably linked to" the regulatory elements, e.g, a promoter.
- a recombinant host can be any prokaryotic or eukaryotic cell that contains either a cloning vector or expression vector.
- This term also includes those prokaryotic or eukaryotic cells, as well as a transgenic animal, that have been genetically engineered to contain the cloned gene(s) in the chromosome or genome of the host cell or cells of the host cells (e.g, ex vivo cells).
- the promoter is the CMV promoter.
- a vector comprising one or more polynucleotide as described herein.
- a polynucleotide as described herein can be cloned into a suitable vector and can be used to transform or transfect any suitable host.
- Vectors and methods to construct such vectors are known to one of ordinary skill in the art and are described in general technical references (see, in general,
- the vector comprises regulatory sequences, such as transcription and translation initiation and termination codons, which are specific to the type of host (e.g ., bacterium, fungus, plant, insect, or mammal) into which the vector is to be introduced, as appropriate and taking into consideration whether the vector is DNA or RNA.
- the vector comprises regulatory sequences that are specific to the genus of the host.
- the vector comprises regulatory sequences that are specific to the species of the host.
- the vector comprises one or more marker genes, which allow for selection of transformed or transfected hosts.
- Non limiting examples of marker genes include biocide resistance, e.g., resistance to antibiotics, heavy metals, etc., complementation in an auxotrophic host to provide prototrophy, and the like.
- the vector comprises ampicillin and hygromycin selectable markers.
- an expression vector can comprise a native or normative promoter operably linked to a polynucleotide as described herein.
- the selection of promoters for example, strong, weak, inducible, tissue-specific and developmental-specific, is within the skill in the art.
- the combining of a nucleic acid molecule, or fragment thereof, as described above with a promoter is also within the skill in the art.
- Non-limiting examples of suitable vectors include those designed for propagation and expansion or for expression or both.
- a cloning vector can be selected from the group consisting of the pUC series, the pBluescript series (Stratagene, LaJolla, Calif), the pET series (Novagen, Madison, Wis.), the pGEX series (Pharmacia Biotech, ETppsala, Sweden), and the pEX series (Clontech, Palo Alto, Calif).
- Bacteriophage vectors such as lamda-GTIO, lamda-GTl 1, lamda-ZapII (Stratagene), lamda-EMBL4, and lamda-NMl 149, can also be used.
- plant expression vectors include pBIl 10, pBHOl.2, pBHOl.3, pBH2l and rBIN19 (Clontech).
- animal expression vectors include pEEIK-Cl, pMAM and pMAMneo (Clontech).
- the TOPO cloning system (Invitrogen, Carlsbad, Calif.) can also be used in accordance with the manufacturer's recommendations.
- the vector is a mammalian vector.
- the mammalian vector contains at least one promoter element, which mediates the initiation of transcription of mRNA, the anti-LGALS3 antibody or antigen-binding fragment thereof coding sequence, and signals required for the termination of transcription and polyadenylation of the transcript.
- the mammalian vector contains additional elements, such as, for example, enhancers, Kozak sequences and intervening sequences flanked by donor and acceptor sites for RNA splicing.
- highly efficient transcription can be achieved with, for example, the early and late promoters from SV40, the long terminal repeats (LTRS) from retroviruses, for example, RSV, HTLVI, HIVI and the early promoter of the cytomegalovirus (CMV).
- LTRS long terminal repeats
- cellular elements can also be used (e.g ., the human actin promoter).
- mammalian expression vectors include, vectors such as pIRESlneo, pRetro-Off, pRetro-On, PLXSN, or pLNCX (Clonetech Labs, Palo Alto, Calif), pcDNA3.l (+/-), pcDNA/Zeo (+/-) or pcDNA3.
- Non limiting example of mammalian host cells that can be used in combination with such mammalian vectors include human Hela 293, H9 and Jurkat cells, mouse NIH3T3 and C127 cells, Cos 1, Cos 7 and CV 1, quail QC1-3 cells, mouse L cells and Chinese hamster ovary (CHO) cells.
- the vector is a viral vector, for example, retroviral vectors, parvovirus-based vectors, e.g., adeno-associated virus (AAV)-based vectors, AAV- adenoviral chimeric vectors, and adenovirus-based vectors, and lentiviral vectors, such as Herpes simplex (HSV)-based vectors.
- the viral vector is manipulated to render the virus replication deficient.
- the viral vector is manipulated to eliminate toxicity to the host.
- These viral vectors can be prepared using standard recombinant DNA techniques described in, for example, Sambrook et al. , Molecular Cloning, a Laboratory Manual, 2d edition, Cold Spring Harbor Press, Cold Spring Harbor,
- a vector or polynucleotide described herein can be transferred to a cell (e.g, an ex vivo cell) by conventional techniques and the resulting cell can be cultured by conventional techniques to produce an anti-LGALS3 antibody or antigen binding fragment thereof described herein.
- a cell e.g, an ex vivo cell
- the resulting cell can be cultured by conventional techniques to produce an anti-LGALS3 antibody or antigen binding fragment thereof described herein.
- cells comprising a polynucleotide encoding an anti-LGALS3 antibody or antigen-binding fragment thereof, a heavy or light chain thereof, or a light chain fusion polypeptide thereof, operably linked to a promoter for expression of such sequences in the host cell.
- a vector encoding the heavy chain operably linked to a promoter and a vector encoding the light chain operably linked to a promoter can be co-expressed in the cell for expression of the entire anti- LGALS3 antibody.
- a vector encoding a heavy chain operably linked to a promoter and a vector encoding a light chain fusion polypeptide operably linked to a promoter can be co-expressed in the cell for expression of an entire bispecific binding molecule.
- a cell comprises a vector comprising a polynucleotide encoding both the heavy chain and the light chain polypeptide of an anti-LGALS3 antibody described herein operably linked to a promoter.
- a cell comprises a vector comprising a polynucleotide encoding both the heavy chain and the light chain fusion polypeptide of a bispecific binding molecule described herein operably linked to a promoter.
- a cell comprises two different vectors, a first vector comprising a polynucleotide encoding a heavy chain operably linked to a promoter, and a second vector comprising a polynucleotide encoding a light chain polypeptide operably linked to a promoter.
- a cell comprises two different vectors, a first vector comprising a polynucleotide encoding a heavy chain operably linked to a promoter, and a second vector comprising a polynucleotide encoding a light chain fusion polypeptide operably linked to a promoter.
- a first cell comprises a first vector comprising a polynucleotide encoding a heavy chain of an anti-LGALS3 antibody described herein
- a second cell comprises a second vector comprising a polynucleotide encoding a light chain polypeptide of an anti-LGALS3 antibody described herein.
- a first cell comprises a first vector comprising a polynucleotide encoding a heavy chain of a bispecific binding molecule described herein
- a second cell comprises a second vector comprising a polynucleotide encoding a light chain fusion polypeptide of a bispecific binding molecule described herein.
- a mixture of cells comprising such first cell and such second cell.
- the cell expresses the vector or vectors such that the polynucleotide is both transcribed and translated efficiently by the cell. ⁇ 0231 ]
- the cell expresses the vector, such that the polynucleotide, or fragment thereof, is both transcribed and translated efficiently by the cell.
- the cell is present in a host, which can be an animal, such as a mammal.
- a host can be an animal, such as a mammal.
- Examples of cells include, but are not limited to, a human cell, a human cell line, E. coli (e.g E. coli TB-l, TG-2, DH5a, XL-Blue MRF (Stratagene), SA2821 and Y1090), B. subtilis , P. aerugenosa, S. cerevisiae, N. crassa, insect cells (e.g, Sf9, Ea4) and others set forth herein below.
- the cell is a CHO cell.
- the cell is a CHO-S cell.
- a polynucleotide described herein can be expressed in a stable cell line that comprises the polynucleotide integrated into a chromosome by introducing the polynucleotide into the cell.
- the polynucleotide is introduced into the cell by, for example, electroporation.
- the polynucleotide is introduced into the cell by, for example, transfection of a vector comprising the polynucleotide into the cell.
- the vector is co-transfected with a selectable marker such as DHFR, GPT, neomycin, or hygromycin to allow for the identification and isolation of the transfected cells.
- the transfected polynucleotide can also be amplified to express large amounts of the encoded anti-LGALS3 antibody or antigen-binding fragment thereof.
- the DHFR (dihydrofolate reductase) marker can be utilized to develop cell lines that carry several hundred or even several thousand copies of the polynucleotide of interest.
- Another example of a selection marker is the enzyme glutamine synthase (GS) (Murphy, et a/., Biochem. J. 227:277-279 (1991); Bebbington, et /., Bio/TechnoZogy 10: 169-175). ETsing these markers, the cells are grown in selective medium and the cells with the highest resistance are selected.
- GS glutamine synthase
- CHO Chinese hamster ovary
- NSO cells are often used for the production of antibodies.
- the vector comprises (i) a first polynucleotide sequence encoding an immunoglobulin light chain that binds to LGALS3, operably linked to a first promoter and (ii) a second polynucleotide encoding an immunoglobulin heavy chain that binds to LGALS3, operably linked to a second promoter.
- the vector is a viral vector.
- the vector comprises (i) a first polynucleotide sequence encoding a light chain fusion polypeptide comprising an immunoglobulin light chain fused to a scFv, via a peptide linker, wherein the light chain binds to LGALS3 and wherein the scFv binds to CD3, operably linked to a first promoter and (ii) a second polynucleotide encoding an immunoglobulin heavy chain that binds to LGALS3 operably linked to a second promoter.
- the vector is a viral vector.
- compositions e.g, pharmaceutical compositions
- kits comprising a pharmaceutically effective amount of one or more anti- LGALS3 antibodies or antigen-binding fragments thereof.
- the pharmaceutical compositions comprise immune cells, for example T cells, recombinantly expressing an antibody, antigen-binding fragment thereof, and/or CAR described herein.
- Compositions can be used in the preparation of individual, single unit dosage forms.
- compositions provided herein can be formulated for parenteral, subcutaneous, intramuscular, intravenous, intrarticular, intrabronchial, intraabdominal, intracapsular, intracartilaginous, intracavitary, intracelial, intracerebellar, intracerebroventricular, intra-Ommaya, intraocular, intravitreous, intracolic, intracervical, intragastric, intrahepatic, intramyocardial, intraosteal, intrapelvic, intrapericardiac, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrarectal, intrarenal, intraretinal, intraspinal, intrasynovial, intrathoracic, intrauterine, intravesical, bolus, vaginal, rectal, buccal, sublingual, intranasal, intrathecal, intraventricular in the brain, intraparenchymal in the brain, or transdermal administration.
- compositions comprising one or more polynucleotide comprising nucleotide sequences encoding an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein.
- a composition comprising a cell, wherein the cell comprises one or more polynucleotides comprising nucleotide sequences encoding an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein.
- a composition comprising a vector, wherein the vector comprises one or more polynucleotide comprising nucleotide sequences encoding an anti-LGALS3 antibody or an antigen- binding fragment thereof described herein.
- composition comprising a cell, wherein the cell comprises a vector, wherein the vector comprises one or more polynucleotide comprising nucleotide sequences encoding an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein.
- a composition described herein is a stable or preserved formulation.
- the stable formulation comprises a phosphate buffer with saline or a chosen salt.
- a composition described is a multi-use preserved formulation, suitable for pharmaceutical or veterinary use.
- a composition described herein comprises a preservative. Preservatives are known to one of ordinary skill in the art.
- Non-limiting examples of preservatives include phenol, m-cresol, p- cresol, o-cresol, chlorocresol, benzyl alcohol, phenylmercuric nitrite, phenoxyethanol, formaldehyde, chlorobutanol, magnesium chloride (e.g ., hexahydrate), alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, and sodium dehydroacetate and thimerosal, or mixtures thereof in an aqueous diluent.
- preservatives include phenol, m-cresol, p- cresol, o-cresol, chlorocresol, benzyl alcohol, phenylmercuric nitrite, phenoxyethanol, formaldehyde, chlorobutanol, magnesium chloride (e.g ., hexahydrate), alkylparaben (methyl
- Any suitable concentration or mixture can be used as known in the art, such as 0.001-5%, or any range or value therein, such as, but not limited to 0.001, 0.003, 0.005, 0.009, 0.01, 0.02, 0.03, 0.05, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.3, 4.5, 4.6, 4.7, 4.8, 4.9 %, or any range or value therein.
- Non-limiting examples include, no preservative, 0.1-2% m-cresol (e.g., 0.2, 0.3. 0.4, 0.5, 0.9, 1.0%), 0.1-3% benzyl alcohol (e.g, 0.5, 0.9, 1.1, 1.5, 1.9, 2.0, 2.5%), 0.001-0.5% thimerosal (e.g, 0.005, 0.01), 0.001-2.0% phenol (e.g, 0.05, 0.25, 0.28, 0.5, 0.9, 1.0%), 0.0005-1.0% alkylparaben(s) (e.g, 0.00075, 0.0009, 0.001, 0.002, 0.005, 0.0075, 0.009, 0.01, 0.02, 0.05, 0.075, 0.09, 0.1, 0.2, 0.3, 0.5, 0.75, 0.9, 1.0%), and the like.
- 0.1-2% m-cresol e.g., 0.2, 0.3. 0.4, 0.5, 0.9, 1.0%)
- a dosage form can contain a pharmaceutically acceptable non-toxic salt of the compounds that has a low degree of solubility in body fluids, for example, (a) an acid addition salt with a polybasic acid such as phosphoric acid, sulfuric acid, citric acid, tartaric acid, tannic acid, pamoic acid, alginic acid, polyglutamic acid, naphthalene mono- or di- sulfonic acids, polygalacturonic acid, and the like; (b) a salt with a polyvalent metal cation such as zinc, calcium, bismuth, barium, magnesium, aluminum, copper, cobalt, nickel, cadmium and the like, or with an organic cation formed from e.g., N, N' -di
- a composition provided herein preferably, a relatively insoluble salt such as those just described, can be formulated in a gel, for example, an aluminum monostearate gel with, e.g, sesame oil, suitable for injection.
- Particularly particular salts are zinc salts, zinc tannate salts, pamoate salts, and the like.
- Another type of slow release depot formulation for injection would contain the compound or salt dispersed for encapsulated in a slow degrading, non-toxic, non-antigenic polymer such as a polylactic acid/polyglycolic acid polymer, for example, as described in U.S. Pat. No. 3,773,919.
- the compounds or, preferably, relatively insoluble salts such as those described above can also be formulated in cholesterol matrix silastic pellets, particularly for use in animals.
- Additional slow release, depot or implant compositions, e.g, gas or liquid liposomes are known in the literature (U.S. Pat. No.
- the range of at least one anti-LGALS3 antibody or antigen-binding fragment thereof composition provided herein includes amounts yielding upon reconstitution, if in a wet/dry system, concentrations from about 1.0 microgram/ml to about 1000 mg/ml, although lower and higher concentrations are operable and are dependent on the intended delivery vehicle, e.g, solution formulations will differ from transdermal patch, pulmonary, transmucosal, or osmotic or micro pump methods.
- compositions provided herein comprise at least one of any suitable auxiliary, such as, but not limited to, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like.
- any suitable auxiliary such as, but not limited to, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like.
- auxiliaries are particular.
- Non-limiting examples of, and methods of preparing such sterile solutions are well known in the art, such as, but not limited to, Gennaro, Ed., Remington's Pharmaceutical Sciences, 18th Edition, Mack Publishing Co. (Easton, Pa.) 1990.
- compositions provided herein contain one or more pharmaceutical excipient and/or additive.
- Non-limiting examples of pharmaceutical excipients and additives are proteins, peptides, amino acids, lipids, and carbohydrates (e.g ., sugars, including monosaccharides, di-, tri-, tetra-, and oligosaccharides; derivatized sugars such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in
- Non-limiting examples of protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like.
- Non-limiting examples of amino acid/antibody components which can also function in a buffering capacity, include alanine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
- the amino acid is glycine.
- Non-limiting examples of carbohydrate excipients include
- monosaccharides such as fructose, maltose, galactose, glucose, D-mannose, sorbose, and the like
- disaccharides such as lactose, sucrose, trehalose, cellobiose, and the like
- polysaccharides such as raffmose, melezitose, maltodextrins, dextrans, starches, and the like; and alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol), myoinositol and the like.
- the carbohydrate excipient is mannitol, trehalose, or raffmose.
- a composition provided herein includes one or more buffer or a pH adjusting agent; typically, the buffer is a salt prepared from an organic acid or base.
- buffers include organic acid salts such as salts of citric acid, ascorbic acid, gluconic acid, carbonic acid, tartaric acid, succinic acid, acetic acid, or phthalic acid; Tris, tromethamine hydrochloride, or phosphate buffers.
- the buffer is an organic acid salts such as citrate.
- Other excipients e.g., isotonicity agents, buffers, antioxidants, preservative enhancers, can be optionally and preferably added to the diluent.
- An isotonicity agent such as glycerin, is commonly used at known concentrations.
- a physiologically tolerated buffer is preferably added to provide improved pH control.
- the compositions can cover a wide range of pHs, such as from about pH 4 to about pH 10, and particular ranges from about pH 5 to about pH 9, and a most particular range of about 6.0 to about 8.0.
- the compositions provided herein have pH between about 6.8 and about 7.8.
- Preferred buffers include phosphate buffers, most preferably sodium phosphate, particularly phosphate buffered saline (PBS).
- a composition provided herein includes one or more polymeric excipient/additive such as, for example, polyvinylpyrrolidones, ficolls (a polymeric sugar), dextrates (e.g ., cyclodextrins, such as 2-hydroxypropyl-.beta.- cyclodextrin), polyethylene glycols, flavoring agents, antimicrobial agents, sweeteners, antioxidants, antistatic agents, surfactants (e.g., polysorbates such as "TWEEN 20" and 'TWEEN 80"), lipids (e.g, phospholipids, fatty acids), steroids (e.g, cholesterol), and/or chelating agents (e.g, EDTA).
- polyvinylpyrrolidones e.g ., polyvinylpyrrolidones, ficolls (a polymeric sugar), dextrates (e.g ., cyclodextrins, such as 2-hydroxypropyl-.be
- additives such as a pharmaceutically acceptable solubilizers like Tween 20 (polyoxyethylene (20) sorbitan monolaurate), Tween 40 (polyoxyethylene (20) sorbitan monopalmitate), Tween 80 (polyoxyethylene (20) sorbitan monooleate), Pluronic F68 (polyoxyethylene polyoxypropylene block copolymers), and PEG (polyethylene glycol) or non- ionic surfactants such as polysorbate 20 or 80 or poloxamer 184 or 188, Pluronic® polyls, other block co-polymers, and chelators such as EDTA and EGTA can optionally be added to the compositions to reduce aggregation. These additives are particularly useful if a pump or plastic container is used to administer the composition. The presence of a pharmaceutically acceptable solubilizers like Tween 20 (polyoxyethylene (20) sorbitan monolaurate), Tween 40 (polyoxyethylene (20) sorbitan monopalmitate),
- pharmaceutically acceptable surfactant mitigates the propensity for the protein to aggregate.
- compositions provided herein are known to one of skill in the art and are referenced in, for example, "Remington: The Science & Practice of Pharmacy", l9.sup.th ed., Williams & Williams, (1995), and in the “Physician's Desk Reference", 52nd ed., Medical Economics, Montvale, N.J. (1998), which are entirely incorporated herein by reference.
- the carrier or excipient materials are carbohydrates (e.g, saccharides and alditols) and buffers (e.g, citrate) or polymeric agents.
- the aqueous diluent optionally further comprises a pharmaceutically acceptable preservative.
- exemplary preservatives include those selected from the group consisting of phenol, m-cresol, p-cresol, o-cresol, chlorocresol, benzyl alcohol, alkylparaben (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal, or mixtures thereof.
- concentration of preservative used in the composition is a concentration sufficient to yield an anti-microbial effect. Such concentrations are dependent on the preservative selected and are readily determined by the skilled artisan.
- compositions provided herein can be prepared by a process which comprises mixing at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein and a preservative selected from the group consisting of phenol, m-cresol, p-cresol, o- cresol, chlorocresol, benzyl alcohol, alkylparaben, (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal or mixtures thereof in an aqueous diluent.
- a preservative selected from the group consisting of phenol, m-cresol, p-cresol, o- cresol, chlorocresol, benzyl alcohol, alkylparaben, (methyl, ethyl, propyl, butyl and the like), benzalkonium chloride, benzethonium chloride, sodium dehydroacetate and thimerosal
- aqueous diluent aqueous diluent
- a measured amount of at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein in buffered solution is combined with the desired preservative in a buffered solution in quantities sufficient to provide the anti- LGALS3 antibody or antigen-binding fragment thereof described herein and preservative at the desired concentrations.
- compositions provided herein can be prepared by a process that comprises mixing at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein and a selected buffer, preferably a phosphate buffer containing saline or a chosen salt. Mixing the at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein and buffer in an aqueous diluent is carried out using conventional dissolution and mixing procedures.
- a suitable composition for example, a measured amount of at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein in water or buffer is combined with the desired buffering agent in water in quantities sufficient to provide the protein and buffer at the desired concentrations. Variations of these processes would be recognized by one of ordinary skill in the art. For example, the order the components are added, whether additional additives are used, the temperature and pH at which the composition is prepared, are all factors that can be optimized for the concentration and means of administration used.
- a composition provided herein is formulated for parenteral injectable administration.
- parenteral includes intravenous, intravascular, intramuscular, intradermal, subcutaneous, and intraocular.
- the composition can be formulated as a solution, suspension, emulsion or lyophilized powder in association, or separately provided, with a
- parenteral vehicle e.g., water, saline, Ringer's solution, dextrose solution, glycerol, ethanol, and 1-10% human serum albumin.
- Liposomes and nonaqueous vehicles such as fixed oils can also be used.
- the vehicle or lyophilized powder can contain additives that maintain isotonicity (e.g ., sodium chloride, mannitol) and chemical stability (e.g., buffers and preservatives).
- the formulation is sterilized by known or suitable techniques.
- Formulations for parenteral administration can contain as common excipients sterile water or saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, hydrogenated naphthalenes and the like.
- Aqueous or oily suspensions for injection can be prepared by using an appropriate emulsifier or humidifier and a suspending agent, according to known methods.
- Agents for injection can be a non-toxic, non-orally
- administrable diluting agent such as aqueous solution or a sterile injectable solution or suspension in a solvent.
- aqueous solution or a sterile injectable solution or suspension in a solvent.
- sterile involatile oil can be used as the usable vehicle or solvent.
- any kind of involatile oil and fatty acid can be used, including natural or synthetic or semisynthetic fatty oils or fatty acids; natural or synthetic or semisynthetic mono- or di- or tri-glycerides.
- Parental administration is known in the art and includes, but is not limited to, conventional means of injections, a gas pressured needle-less injection device as described in U.S. Pat. No. 5,851, 198, and a laser perforator device as described in U.S. Pat. No. 5,839,446 entirely incorporated herein by reference.
- composition comprising an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein is formulated for pulmonary
- the composition is delivered in a particle size effective for reaching the lower airways of the lung or sinuses.
- compositions for pulmonary administration can be delivered by any of a variety of inhalation or nasal devices known in the art for administration of a therapeutic agent by inhalation.
- These devices capable of depositing aerosolized formulations in the sinus cavity or alveoli of a patient include metered dose inhalers, nebulizers, dry powder generators, sprayers, and the like.
- Other devices suitable for directing the pulmonary or nasal administration of an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein are also known in the art. All such devices use formulations suitable for the administration for the dispensing of an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein in an aerosol.
- Such aerosols can be comprised of either solution (both aqueous and nonaqueous) or solid particles.
- Metered dose inhalers like the Ventolin® metered dose inhaler, typically use a propellant gas and require actuation during inspiration (See, e.g., WO 94/16970, WO 98/35888).
- Dry powder inhalers like TurbuhalerTM (Astra), Rotahaler®. (Glaxo), Diskus® (Glaxo), devices marketed by Inhale Therapeutics, to name a few, use breath-actuation of a mixed powder (U.S. Pat. No. 4,668,218 Astra, EP 237507 Astra, WO 97/25086 Glaxo, WO 94/08552 Dura, U.S. Pat. No. 5,458,135 Inhale,
- Nebulizers like the Ultravent® nebulizer (Mallinckrodt), and the Acorn II® nebulizer (Marquest Medical Products) (U.S. Pat. No. 5,404,871 Aradigm, WO 97/22376), the above references entirely incorporated herein by reference, produce aerosols from solutions, while metered dose inhalers, dry powder inhalers, etc. generate small particle aerosols.
- Such examples of commercially available inhalation devices are non-limiting examples are not intended to be limiting in scope.
- a spray comprising an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein can be produced by forcing a suspension or solution of at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein through a nozzle under pressure.
- the nozzle size and configuration, the applied pressure, and the liquid feed rate can be chosen to achieve the desired output and particle size.
- An electrospray can be produced, for example, by an electric field in connection with a capillary or nozzle feed.
- particles of a composition comprising at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein delivered by a sprayer have a particle size less than about 10 pm, for example in the range of about 1 pm to about 5 pm, for example about 2 pm to about 3 pm.
- Formulations of a composition comprising at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein suitable for use with a sprayer typically include the at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein in an aqueous solution at a concentration of about 0.1 mg to about 100 mg per ml of solution or mg/gm, or any range or value therein, e.g., but not limited to, 0.1, 0.2, 0.3, 0.4,
- the formulation can include agents such as an excipient, a buffer, an isotonicity agent, a preservative, a surfactant, and, preferably, zinc.
- the formulation can also include an excipient or agent for stabilization of the anti-LGALS3 antibody or antigen-binding fragment thereof composition, such as a buffer, a reducing agent, a bulk protein, or a carbohydrate.
- Bulk proteins useful in formulating such a composition include albumin, protamine, or the like.
- Typical carbohydrates useful in formulating antibody composition proteins include sucrose, mannitol, lactose, trehalose, glucose, or the like.
- the composition can also include a surfactant, which can reduce or prevent surface-induced aggregation of the composition caused by atomization of the solution in forming an aerosol.
- a surfactant which can reduce or prevent surface-induced aggregation of the composition caused by atomization of the solution in forming an aerosol.
- Various conventional surfactants can be employed, such as polyoxyethylene fatty acid esters and alcohols, and polyoxy ethylene sorbitol fatty acid esters. Amounts will generally range between 0.001 and 14% by weight of the formulation.
- Preferred surfactants are polyoxyethylene sorbitan monooleate, polysorbate 80, polysorbate 20, or the like.
- the composition is administered via a nebulizer, such as jet nebulizer or an ultrasonic nebulizer.
- a nebulizer such as jet nebulizer or an ultrasonic nebulizer.
- a compressed air source is used to create a high-velocity air jet through an orifice.
- a low-pressure region is created, which draws a solution of antibody composition protein through a capillary tube connected to a liquid reservoir.
- the liquid stream from the capillary tube is sheared into unstable filaments and droplets as it exits the tube, creating the aerosol.
- a range of configurations, flow rates, and baffle types can be employed to achieve the desired performance characteristics from a given jet nebulizer.
- particles of antibody composition protein delivered by a nebulizer have a particle size less than about 10 um, preferably in the range of about 1 um to about 5 um, and most preferably about 2 um to about 3 um.
- the composition is administered via a metered dose inhaler (MDI), wherein a propellant, at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein, and any excipients or other additives are contained in a canister as a mixture including a liquefied compressed gas.
- MDI metered dose inhaler
- Actuation of the metering valve releases die mixture as an aerosol, preferably containing particles in the size range of less than about 10 um, preferably about 1 um to about 5 um, and most preferably about 2 um to about 3 um.
- the desired aerosol particle size can be obtained by employing a formulation of antibody composition protein produced by various methods known to those of skill in the art, including jet-milling, spray drying, critical point condensation, or the like.
- Preferred metered dose inhalers include those manufactured by 3M or Glaxo and employing a hydrofluorocarbon propellant.
- Formulations of an anti-LGALS3 antibody or an antigen-binding fragment thereof described herein for use with a metered-dose inhaler device will generally include a finely divided powder containing at least one Anti-IL-6 antibody as a suspension in a non-aqueous medium, for example, suspended in a propellant with the aid of a surfactant.
- the propellant can be any conventional material employed for this purpose, such as chlorofluorocarbon, a hydrochlorofluorocarbon, a hydrofluorocarbon, or a hydrocarbon, including
- the propellant is a hydrofluorocarbon.
- the surfactant can be chosen to stabilize the at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein as a suspension in the propellant, to protect the active agent against chemical degradation, and the like.
- Suitable surfactants include sorbitan trioleate, soya lecithin, oleic acid, or the like.
- solution aerosols are particular using solvents such as ethanol.
- compositions and methods of administering at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein rely on the co-administration of adjuvants such as, for example, resorcinols and nonionic surfactants such as polyoxyethylene oleyl ether and n-hexadecylpolyethylene ether, to artificially increase the permeability of the intestinal walls, as well as the co- administration of enzymatic inhibitors such as, for example, pancreatic trypsin inhibitors, diisopropylfluorophosphate (DFF) and trasylol, to inhibit enzymatic degradation.
- adjuvants such as, for example, resorcinols and nonionic surfactants such as polyoxyethylene oleyl ether and n-hexadecylpolyethylene ether
- enzymatic inhibitors such as, for example, pancreatic trypsin inhibitors, diisopropylfluorophosphate (DFF) and tras
- the active constituent compound of the solid-type dosage form for oral administration can be mixed with at least one additive, including sucrose, lactose, cellulose, mannitol, trehalose, raffmose, maltitol, dextran, starches, agar, arginates, chitins, chitosans, pectins, gum tragacanth, gum arabic, gelatin, collagen, casein, albumin, synthetic or semisynthetic polymer, and glyceride.
- at least one additive including sucrose, lactose, cellulose, mannitol, trehalose, raffmose, maltitol, dextran, starches, agar, arginates, chitins, chitosans, pectins, gum tragacanth, gum arabic, gelatin, collagen, casein, albumin, synthetic or semisynthetic polymer, and glyceride.
- These dosage forms can also contain other type(s) of additives, such as, for example, inactive diluting agent, lubricant such as magnesium stearate, paraben, preserving agent such as sorbic acid, ascorbic acid, alpha -tocopherol, antioxidant such as cysteine, disintegrator, binder, thickener, buffering agent, sweetening agent, flavoring agent, perfuming agent, etc.
- additives such as, for example, inactive diluting agent, lubricant such as magnesium stearate, paraben, preserving agent such as sorbic acid, ascorbic acid, alpha -tocopherol, antioxidant such as cysteine, disintegrator, binder, thickener, buffering agent, sweetening agent, flavoring agent, perfuming agent, etc.
- tablets and pills for oral administration can be further processed into enteric-coated preparations.
- liquid preparations for oral administration include, for example, emulsion, syrup, elixir, suspension and solution preparations allowable for medical use. These preparations can contain inactive diluting agents ordinarily used in said field, for example, water.
- Liposome preparations can be utilized for oral administration preparations, for example, as described for insulin and heparin (U.S. Pat. No. 4,239,754).
- microspheres of artificial polymers of mixed amino acids (proteinoids) can be utilized to in oral administration of pharmaceuticals, for example, as described in U.S. Pat. No. 4,925,673.
- carrier compounds such as those described in U.S. Pat. No. 5,879,681 and U.S. Pat. No. 5,871,753, are used in oral administration of biologically active agents.
- compositions provided herein are formulated for absorption through mucosal surfaces.
- compositions and methods of administering at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein include an emulsion comprising a plurality of submicron particles, a mucoadhesive macromolecule, a bioactive peptide, and an aqueous continuous phase, which promotes absorption through mucosal surfaces by achieving mucoadhesion of the emulsion particles (U.S. Pat. No. 5,514,670).
- Mucous surfaces suitable for application of the emulsions provided herein can include, for example, corneal, conjunctival, buccal, sublingual, nasal, vaginal, pulmonary, stomachic, intestinal, and rectal routes of administration.
- Formulations for vaginal or rectal can include, for example, corneal, conjunctival, buccal, sublingual, nasal, vaginal, pulmonary, stomachic, intestinal, and rectal routes of administration.
- administration for example, suppositories
- Formulations for intranasal administration can be solid and contain as excipients, for example, lactose or can be aqueous or oily solutions of nasal drops.
- excipients include, for example, sugars, calcium stearate, magnesium stearate, pregelinatined starch, and the like (U.S. Pat.
- a composition provided herein is formulated for transdermal administration.
- the composition comprises at least one anti-LGALS3 antibody or antigen-binding fragment thereof described herein encapsulated in a delivery device such as, for example, a liposome or polymeric nanoparticles, microparticle, microcapsule, or microspheres (referred to collectively as microparticles unless otherwise stated).
- microparticles made of synthetic polymers such as polyhydroxy acids such as polylactic acid, polyglycolic acid and copolymers thereof, polyorthoesters, polyanhydrides, and polyphosphazenes, and natural polymers such as collagen, polyamino acids, albumin and other proteins, alginate and other polysaccharides, and combinations thereof (U.S. Pat. No. 5,814,599).
- synthetic polymers such as polyhydroxy acids such as polylactic acid, polyglycolic acid and copolymers thereof, polyorthoesters, polyanhydrides, and polyphosphazenes
- natural polymers such as collagen, polyamino acids, albumin and other proteins, alginate and other polysaccharides, and combinations thereof
- kits comprising one or more antibodies described herein, or antigen-binding fragments thereof, or conjugates thereof.
- a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions described herein, such as one or more antibodies or an antigen-binding fragment thereof described herein.
- the kits contain a pharmaceutical composition described herein and a prophylactic or therapeutic agent.
- Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, a dosage form, and/or instructions for use thereof.
- a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, a dosage form, and/or instructions for use thereof can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, a dosage form, and/or instructions for use thereof.
- the instructions included with the kit provide guidance with respect to the dosage amounts and/or dosing regimens for administration of the pharmaceutical
- Examples of pharmaceutical packaging materials include, but are not limited to, blister packs, bottles, packets, sachets, tubes, inhalers, pumps, bags, vials, containers, syringes and any packaging material suitable for a selected pharmaceutical composition and intended mode of administration and treatment.
- Kits provided herein can further include devices that are used to administer the active ingredients.
- devices include, but are not limited to, syringes, needle- less injectors, drip bags, patches and inhalers.
- Kits provided herein can further include pharmaceutically acceptable vehicles that can be used to administer the ingredients.
- the kit can comprise a sealed container of a suitable vehicle in which the ingredient can be dissolved to form a particulate- free sterile solution that is suitable for parenteral administration or can be reconstituted as a suspension for oral administration.
- suitable vehicles include, but are not limited to: aqueous vehicles including, but not limited to, Water for Injection ETSP, Sodium Chloride Injection, Ringer's Injection, Dextrose Injection, Dextrose and Sodium
- Chloride Injection, and Lactated Ringer's Injection comprising, but not limited to, ethyl alcohol, polyethylene glycol, and polypropylene glycol; and non-aqueous vehicles including, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
- water-miscible vehicles including, but not limited to, ethyl alcohol, polyethylene glycol, and polypropylene glycol
- non-aqueous vehicles including, but not limited to, corn oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.
- LGALS3-related disease or condition comprising administering to the subject in need thereof a therapeutically effective amount of an anti-LGALS3 antibody or antigen-binding fragment thereof.
- exemplary LGALS3-related disease or conditions include, but are not limited to, cancer, tumor metastasis, tumor angiogenesis, heart failure, pulmonary fibrosis, glomerular disease of the kidney, inflammatory disease, and rheumatic diseases.
- the anti-LGALS3 antibody or antigen-binding fragment thereof is administered in combination with one or more additional therapeutic agents.
- the one or more additional therapeutic agents inhibit or treat one or more symptoms of the LGALS3-related disease or condition.
- kits for treating cancer in a subject comprising administering to the subject in need thereof a therapeutically effective amount of an anti-LGALS3 antibody or antigen-binding fragment thereof.
- the LGALS3 -positive cancer is ovarian cancer, lung cancer, pancreatic cancer, breast cancer, fallopian tube cancer, uterine (e.g, endometrial) cancer, primary peritoneum cancer or cancer of any other tissue that expresses LGALS3.
- an anti-LGALS3 antibody or fragment thereof is used that binds to LGALS3 of that particular species.
- an anti-LGALS3 antibody or antigen-binding fragment thereof is used that binds to human LGALS3.
- the anti-LGALS3 antibody or antigen-binding fragment thereof is an immunoglobulin.
- the anti-LGALS3 antibody in certain embodiments, the constant region of an anti-LGALS3 antibody or antigen binding fragment thereof, is derived from that particular species.
- the anti-LGALS3 antibody or fragment thereof can comprise an anti-LGALS3 antibody or antigen binding fragment thereof that is an immunoglobulin, wherein the immunoglobulin comprises a human constant region.
- the subject is a human.
- treatment can be to achieve beneficial or desired clinical results including, but not limited to, alleviation of a symptom, diminishment of extent of a disease, stabilizing ( i.e ., not worsening) of state of a disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
- "treatment” can also be to prolong survival as compared to expected survival if not receiving treatment.
- the administration of an anti-LGALS3 antibody or antigen binding fragment thereof described herein, or a pharmaceutical composition described herein to a subject with cancer achieves at least one, two, three, four or more of the following effects: (i) the reduction or amelioration of the severity of one or more symptoms of cancer; (ii) the reduction in the duration of one or more symptoms associated with cancer; (iii) the prevention in the recurrence of a symptom associated with cancer; (iv) the reduction in hospitalization of a subject; (v) a reduction in hospitalization length; (vi) the increase in the survival of a subject; (vii) the enhancement or improvement of the therapeutic effect of another therapy; (viii) the inhibition of the development or onset of one or more symptoms associated
- cancer e.g ., ovarian cancer, lung cancer, pancreatic cancer, breast cancer, fallopian tube cancer, uterine (e.g., endometrial) cancer, or primary peritoneum cancer, or cancer of any other tissue that expresses LGALS3
- anti-LGALS3 antibodies or antigen-binding fragments thereof described herein can be used for diagnostic purposes to detect, diagnose, or monitor a condition described herein (e.g ., a condition involving LGALS3-positive cancer cells).
- a condition described herein e.g ., a condition involving LGALS3-positive cancer cells.
- anti-LGALS3 antibodies or antigen-binding fragments thereof for use in diagnostic purposes are labeled.
- kits for the detection of a condition described herein comprising (a) assaying the expression of LGALS3 or a fragment thereof in cells or a tissue sample of a subject using one or more anti-LGALS3 antibodies or antigen- binding fragments thereof described herein; and (b) comparing the level of LGALS3 or the fragment thereof expression with a control level, for example, levels in normal tissue samples (e.g., from a subject not having a condition described herein, or from the same patient before onset of the condition), whereby an increase or decrease in the assayed level of LGALS3 or the fragment thereof expression compared to the control level of LGALS3 or the fragment thereof expression is indicative of a condition described herein.
- a control level for example, levels in normal tissue samples (e.g., from a subject not having a condition described herein, or from the same patient before onset of the condition), whereby an increase or decrease in the assayed level of LGALS3 or the fragment thereof expression compared to the control level of LGALS3 or the fragment thereof expression
- Antibodies described herein can be used to assay the levels of LGALS3 or a fragment thereof in a biological sample using classical immunohistological methods as described herein or as known to those of skill in the art (e.g, see Jalkanen et al. , 1985, J. Cell. Biol. 101 :976-985; and Jalkanen et al. (1987) J. Cell . Biol. 105:3087-3096).
- Other antibody- based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- Suitable antibody assay labels include enzyme labels, such as, glucose oxidase; radioisotopes, such as iodine ( 125 I, 1211), carbon ( 14 C), sulfur ( 35 S), tritium (3 ⁇ 4), indium ( 121 In), and technetium ( 99 Tc); luminescent labels, such as luminol; and fluorescent labels, such as fluorescein and rhodamine, and biotin.
- enzyme labels such as, glucose oxidase
- radioisotopes such as iodine ( 125 I, 1211), carbon ( 14 C), sulfur ( 35 S), tritium (3 ⁇ 4), indium ( 121 In), and technetium ( 99 Tc)
- luminescent labels such as luminol
- fluorescent labels such as fluorescein and rhodamine, and biotin.
- monitoring of a condition described herein is carried out by repeating the method for diagnosing for a period of time after initial diagnosis.
- Presence of the labeled molecule can be detected in the subject using methods known in the art for in vivo scanning. Skilled artisans will be able to determine the appropriate method for detecting a particular label. Methods and devices that can be used in the diagnostic methods of the invention include, but are not limited to, computed tomography (CT), whole body scan such as position emission tomography (PET), magnetic resonance imaging (MRI), and sonography.
- CT computed tomography
- PET position emission tomography
- MRI magnetic resonance imaging
- sonography sonography
- An anti-LGALS3 antibody or antigen-binding fragment thereof, or composition, or cells expressing the antibodies, or antigen-binding fragments thereof, described herein can be delivered to a subject by a variety of routes. These include, but are not limited to, parenteral, intranasal, intratracheal, oral, intradermal, topical, intramuscular, intraperitoneal, transdermal, intravenous, intratumoral, conjunctival and subcutaneous routes. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent for use as a spray.
- an anti-LGALS3 antibody or antigen-binding fragment thereof, or a composition described herein is administered parenterally to a subject. In a specific embodiment, said parenteral administration is intravenous, intramuscular, or subcutaneous.
- an anti-LGALS3 antibody or antigen-binding fragment thereof, or composition which will be effective in the treatment and/or prevention of a condition will depend on the nature of the disease, and can be determined by standard clinical techniques.
- the precise dose to be employed in a composition will also depend on the route of administration, and the type of cancer, and should be decided according to the judgment of the practitioner and each subject's circumstances. For example, effective doses may also vary depending upon means of administration, target site, physiological state of the patient (including age, body weight and health), whether the patient is human or animal, other medications administered, or whether treatment is prophylactic or therapeutic. Treatment dosages are optimally titrated to optimize safety and efficacy.
- an in vitro assay is employed to help identify optimal dosage ranges.
- Effective doses can be extrapolated from dose response curves derived from in vitro or animal model test systems.
- the dosage can range from about 0.0001 to 100 mg/kg, and more usually 0.01 to 15 mg/kg, of the patient body weight.
- dosages can be 1 mg/kg body weight, 10 mg/kg body weight, or within the range of 1-10 mg/kg or in other words, 70 mg or 700 mg or within the range of 70 700 mg, respectively, for a 70 kg patient.
- human antibodies have a longer half-life within the human body than antibodies from other species due to the immune response to the foreign polypeptides. Thus, lower dosages of human antibodies and less frequent
- a subject is administered to the subject at a range of about one million to about 100 billion cells, such as, e.g., 1 million to about 50 billion cells (e.g.
- about 10 million to about 100 billion cells e.g, about 20 million cells, about 30 million cells, about 40 million cells,
- the dose of total cells and/or dose of individual sub- populations of cells is within a range of between at or about 10 4 and at or about 10 9 cells/kilograms (kg) body weight, such as between 10 5 and 10 6 cells / kg body weight, for example, at or about 1 x 10 5 cells/kg, 1.5 x 10 5 cells/kg, 2 x 10 5 cells/kg, or 1 x 10 6 cells/kg, 2 x 10 6 cells/kg, 5 x 10 6 cells/kg, or 10 x 10 6 cells/kg body weight.
- the cells are administered at, or within a certain range of error of, between at or about 10 4 and at or about 10 9 T cells/kilograms (kg) body weight, such as between 10 5 and 10 7 T cells / kg body weight.
- T cells/kilograms (kg) body weight such as between 10 5 and 10 7 T cells / kg body weight.
- Intervals between single dosages can be, for example, 1 week, 2 weeks, 3 weeks, 4 weeks, 1 month, 2 months, 3 months, 6 months, 1 year, or 2 years.
- cancer e.g ., ovarian cancer, pancreatic cancer, lung cancer, breast cancer, fallopian tube cancer, uterine (e.g., endometrial) cancer, or primary peritoneum cancer
- a subject comprising
- the additional therapeutic agent is for treating the cancer in the subject (e.g, ovarian cancer, pancreatic cancer, lung cancer, breast cancer, fallopian tube cancer, uterine (e.g, endometrial) cancer, and primary peritoneum cancer).
- the additional therapeutic agent is for treating any side effects of treatment with an anti-LGALS3 antibody or an antigen-binding fragment described herein described herein.
- the additional agent is an agent used to treat ovarian cancer. In specific embodiments, the additional agent is an agent used to treat pancreatic cancer. In specific embodiments, the additional agent is an agent used to treat lung cancer. In specific embodiments, the additional agent is an agent used to treat breast cancer. In specific embodiments, the additional agent is an agent used to treat fallopian tube cancer. In specific embodiments, the additional agent is an agent used to treat uterine (e.g, endometrial) cancer. In specific embodiments, the additional agent is an agent used to treat primary peritoneum cancer.
- An anti-LGALS3 antibody or an antigen-binding fragment thereof described herein described herein can be administered with an additional therapeutic agent concurrently or sequentially (before and/or after).
- the antibody or antigen binding fragment thereof and the additional therapeutic agent can be administered in the same or different compositions, and by the same or different routes of administration.
- a first therapy (which is an anti- LGALS3 antibody or an antigen-binding fragment thereof described herein , or the additional therapeutic agent) can be administered prior to (e.g, 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to ( e.g ., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of the second therapy (the anti-LGALS3 antibody or antigen- binding fragment thereof described herein described herein, or the additional therapeutic agent) to a subject with cancer (e.g., ovarian cancer, pancreatic cancer, lung cancer, breast cancer
- an additional therapeutic agent administered to a subject in combination with anti-LGALS3 antibody or antigen-binding fragment thereof described herein is administered in the same composition (pharmaceutical composition).
- an additional therapeutic agent administered in combination with anti-LGALS3 antibody or an antigen-binding fragment thereof described herein is administered to a subject in a different composition than the anti-LGALS3 antibody or antigen-binding fragment thereof described herein (e.g, two or more pharmaceutical compositions are used).
- a subject treated in accordance with the methods provided herein can be any mammal, such as a rodent, a cat, a canine, a horse, a cow, a pig, a monkey, a primate, or a human, etc.
- the subject is a human.
- the subject is a canine.
- the terms "subject” and "patient” are used interchangeably.
- a subject treated in accordance with the methods provided herein has been diagnosed with a LGALS3-positive cancer, including but not limited to, ovary, lung, pancreas, breast, uterine, fallopian tube, or primary peritoneum cancer, or cancer of any other tissue that expresses the LGALS3.
- a LGALS3-positive cancer including but not limited to, ovary, lung, pancreas, breast, uterine, fallopian tube, or primary peritoneum cancer, or cancer of any other tissue that expresses the LGALS3.
- Example 1 Generation of Galectin-3-Fc domain fusion protein [0298] A Galectin-3(LGALS3)-Fc domain fusion protein was generated for use as an antigen and for studying LGALS3 function.
- mucin- 16 (MUC16) ectodomain monoclonal antibodies and fusion proteins were generated using pFUSE-hIgGl-Fc2 vector (InvivoGen) that serves as a ‘dummy’ antibody with human IgGl-Fc backbone (see Rao el al. (2015) PLoS One 10, e0l2663; Rao et al. (2017) ACS Chem. Biol. 12: 2085-2096, each of which are incorporated by reference in its entirety).
- the pFUSE-hIgGl-Fc2 vector allows for the generation of a Fc- fusion protein comprising a selected antigen (e.g.
- LGALS3 linked to the Fc region (CH2 and CH3 domains) of the human IgGl heavy chain and the hinge region.
- the hinge serves as a flexible spacer between the two parts of the Fc-fusion protein, allowing each part of the molecule to function independently.
- a 20 amino acid IL-2 signal sequence is linked to the N- terminus of the selected antigen and allows for secretion of the antigenic fusion protein.
- the IL-2 signal peptide is intracellularly cleaved after Ser20.
- PCR primers were designed with the restriction enzyme site EcoRV as the forward primer and Ncol as the reverse primer to extract the DNA encoding a fragment of LGALS3 (amino acids 117-244 of SEQ ID NO: 1, underlined below), which includes the LGALS3 sugar-binding domain (FIG. 4, bolded below).
- the template employed for the PCR amplification was a LGALS3 cDNA clone BC001120.2 (MGG2058 IMAGE:3050l35 GenBank: AAH01120.1) obtained from ATCC (Manassas, VA)).
- the BC001120.2 Galectin-3 cDNA clone has the following nucleotide sequence (the full coding sequence for LGALS3 is italicized, and the amplified portion is underlined)
- the amplified portion encodes 117-244 LGALS3 having the amino acid sequence: PYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCN TKLDNNW GREERQ SVFPFESGKPFKIQ VLVEPDHFKVAVNDAHLLQYNHRVKKLNE ISKLGISGDIDLTS (SEQ ID NO: 27)
- the pFETSE-IgGl-Fc2 vector (Invivogen) has the following nucleic acid sequence
- GCTGAAT GGC A AGGAGT AC AAGT GC AAGGTCTCC A AC AAAGCCCTCCC AGCCCC
- the fusion protein was expressed in human 293 cells and purified on a protein A column for immunization.
- the expressed fusion protein has the following sequence:
- a second sugar-binding fusion protein ( u 119 LGALSl-pFEiSE) was created as a negative control with the sugar-binding domain of Galectin-l .
- FIG. 2 A illustrates LGALS3 shRNA blocking MUC16 oncogene activation, as assessed by inhibition of phosphorylation of several oncogenes, including EGFR, ART, ERK and SRC (P-EGFR, P-AKT, P-ERK, P-SRC, respectively).
- MUC16 in SKOV3 cells increased phosphorylation of pERKl/2, pSRC, and EGFR.
- shRNA knockdowns of MGAT5 shMGAT5
- Galectin-3 shLGALS3
- N A mutation ofN30 of MIJC16 all impair MUC16c 114-induced oncogene activation.
- MGAT5 mannosyl (alpha- l,6-)-gly coprotein beta-l,6-N-acetyl-glucosaminyltransferase catalyzes the formation of tetra-antennary N-glycans, binding Galectin-3 with the high affinity. Similar effects occurred in A2780-MUC16 cells. Thus, loss of LGALS3 greatly inhibits MUC16 activation
- FIG. 2B illustrates competing LGALS3 but not LGAL1 (Galectin-l) blocks Matrigel invasion of ovarian cancer cell lines, OVCAR3, OVCA-432, OVCA-433 and CAOV3. These cell lines expressed full-length MUC16 with multiple tandem repeats and released CA125 antigen into the cell culture supernatant.
- Swainsonine and Kifunensine both block the synthesis of the LGALS3 ligand, polylactosamine, and also substantially decreased Matrigel invasion.
- FIG. 2C illustrates inhibition of A2780 Ovarian Cancer in a tumor xenograft model by inhibitors of LGALS3 function.
- Cell lines were introduced into the flank of 10 athymic female nude mice per group. Loss of LGALS3 expression by shLGALS3inhibition is highly inhibitory on tumor growth. Modest inhibition of tumor growth by 117 244 LGAL3- pFEiSE was also observed.
- FIG. 2D illustrates antisense knockdowns of MGAT5 and LGALS3 inhibit tumor growth in an SKOV3 Ovarian Cancer xenograft mode.
- MUC16 overexpression expression cl 14
- enhanced tumor growth top line.
- loss of N-glycosylation sites Nl-N24-Nl3-mut cl 14
- shRNA against MGAT5 or LGALS3 reduced growth back to control levels.
- LGALS3 high-affinity anti galectin-3
- mice which showed high ELISA titers to the antigen were selected and intravenously (IV) boosted with the human LGALS3 protein at a dose of 10 pg/mouse (one mouse was planned for sacrifice while the other selected as a backup).
- IV boost intravenously
- the mouse was sacrificed; splenocytes were harvested, fused with SP2/mIL6 hybridoma fusion partner and plated in 96 well plates at 10, 1, 0.3, or 0.1 cells/well. Hybridoma supernatants were then collected and screened for LGALS3 binding. Positive supernatant hybridomas were expanded from single 96 well plates to multiple 96 well plates and then to 24 well plates. At every passage of hybridoma cells, ELISA reactivity to the antigen was tested to avoid false positives.
- a 23 -amino acid custom peptide was synthesized from the sugar binding domain of LGALS3, CNTKLDNNW GREERQ S VFPFE S G (SEQ ID NO: 2) (called Peptide 1) (Atlantic Peptides, Lewisburg, PA). The peptide sequence was chosen as it was noted to be conserved among various species and therefore represented a critical region of the protein. The peptide was then conjugated to keyhole limpet hemocyanin (KLH) using Imject
- mice were then immunized with KLH-Peptide 1 at 50 pg/mouse IP every 3 weeks for a total of 3 injections. Immune sera were collected and screened for reactivity against LGALS3 and Peptide 1 by ELISA. Following the last immunization, two mice were chosen to receive an IV boost of KLH-Peptide 1 at 10 pg/mouse and 24-hours later, one mouse was sacrificed. The splenocytes of this mouse were fused with hybridoma fusion partner as described above.
- Hybridoma supernatants were screened for immunoglobulin (Ig) isotype by ELISA and IgGl, IgG2a, and IgG2b isotypes were selected. Supernatants were also screened against mouse LGALS3 (mLGALS3), human LGALS1, human LGALS7 and human LGALS9. Hybridoma cells that were producing the desired antibodies were chosen for purification (by Bio X Cell; West Riverside, NH). [0318] Additional antibodies have also been generated using the AlivaMab mouse platform (Ablexis). The AlivaMab mouse generates chimeric antibodies having a human variable domain.
- ELISA Purified antibodies that bound to Gal3 were confirmed by ELISA. For this, two strategies were used. The first utilized a plastic 96-well microplate coated with LGALS3 protein and an isotype specific secondary antibody conjugated Horse-Radish- Peroxidase (HRP) for detection. As there was concern that LGALS3 would not retain its native confirmation on a plastic plate, for the second strategy, an LGALS3 construct was created with polyhistidine-tag at the N-terminus (Abeam, ab89487). A nickel coated 96-well microplate was used with polyhistidine-tagged LGALS3 as the primary protein. Similarly, an isotype specific secondary antibody was used for detection.
- HRP horse-Radish- Peroxidase
- SPR Antibody binding to LGALS3 was confirmed by surface plasmon resonance (SPR) assay. The antibody was captured on an anti-mouse Fc surface and an 8-pt. 2-fold dilution series of LGALS3 was flown over the antibody starting at 500nM.
- Laminin binding inhibition To check whether the LGALS3 binding to laminin could be interrupted by the antibodies, an ELISA assay was utilized. Various antibody concentrations were used against a fixed laminin concentration.
- a Maxisorb plate was coated overnight with 50m1 of Sigma Laminin (l0pg/ml in PBS) at 4 °C with orbital shaking. The next morning, the plate was equilibrated to room temperature, washed 3 times with PBS-Tween 20 (PBS-T) and blocked for 2 hours with SuperBlock (Thermo Scientific). Wells were incubated with Galectin-3 ::Biotin for 1 hour at room temperature. Wells were then washed 3 times with PBS-T and incubated with either 50m1 of Anti-Biotin-HRP (1 :5000) or streptavidin-HRP (1 : 1000) for 1 hour. Plate was then washed 3 times and incubated with IOOmI TMB-Ultra for 30 minutes followed by addition of IOOmI 2N H2SO4 and read on a plate reader at wavelength 450 nm.
- Matrigel Invasion Assay Antibody inhibition of basement membrane invasion was determined in Matrigel invasion chambers as previously described by Rao, et al. (2017) ACS Chem. Biol. 12 (8): 2085-2096, which is incorporated by reference in its entirety.
- MUC16 expressing cell lines were created by transfecting MUC16-negative human ovarian cancer cell lines (SKOV3 and A2780) with the sequence elements of the C-terminal MUC16, which are essential for tumor promoting effects, using the phrGFP vector (A2780- phrGFP-MUC 16 c344 and SKOV3-phrGFP-MUCl6 c344 ).
- transfected cells as well as wild type MUC16 expressing cells were pretreated with a selected antibody prior to exposure to the Matrigel invasion chambers. The number of invading cells was counted.
- A2780-MUCl6 c344 cells were introduced into the flank area of 16 female athymic nude mice at 2 million cells per mouse.
- control A2780-phrGFP cells were introduced into the flanks of 6 female athymic nude mice at 2 million cells per mouse.
- Eight of the mice that were implanted withA2780-MUCl6 c344 transfected cells received twice weekly antibody injections at 50 pg/mouse intravenously (i.v.). Routine animal care was provided by the MSKCC Antitumor Assessment Core Facility. Tumor measurements were taken twice a week and tumor growth recorded as per guidelines from the MSKCC Research Animal Resource Center. Animals were sacrificed after reaching a maximum tumor volume of 2000 mm 3 .
- Table 1 provides a summary of selected antibodies generated, their immunoglobulin isotypes, and their antibody antigen targets.
- LGALS3 is human Galectin-3
- Peptide-l is a 23 -amino acid constructed peptide from the conserved region of the carbohydrate binding domain of LGALS3
- mLGALS3 is mouse Galectin-3
- LGALS1 is human Galectin-l.
- Table 1 Summary of Selected Antibodies Generated, immunoglobulin isotypes, and antibody antigen targets.
- FIG. 5 shows a summary of the binding properties of the antibodies from campaign 2.
- FIG. 6 shows the ELISA results for the binding of the campaign 2 antibodies to laminin.
- FIG. 7 shows that 14D11.2D2 binds LGALS3 protein in an ELISA assay.
- FIG. 8 shows that 14D11.2D2 binds LGALS3 in an SPR assay. The antibody dissociation constant was 14.6 nM by SPR.
- FIG. 9 shows that 14D11.2D2 inhibits LGALS3 binding to laminin. At a concentration of 150 nM, 14D11.2D2 decreased galectin-3 binding to laminin by 36.6% compared to untreated control.
- FIG. 7 shows that 14D11.2D2 binds LGALS3 protein in an ELISA assay.
- FIG. 8 shows that 14D11.2D2 binds LGALS3 in an SPR assay. The antibody dissociation constant was 14.6 nM by SPR.
- FIG. 9 shows that 14D11.2D2 inhibits LGALS3 binding to laminin. At a concentration of 150 nM, 14D11.2D2 decreased galectin-3 binding to laminin by 36.6%
- FIG. 11 shows that mice immunized with 14D11.2D2 antibody are more likely to survive than mice that did not receive the antibody in the ovarian tumor xenograft mouse model described above.
- MUC16 expressing A2780 tumors showed a trend in decreased tumor growth in mice treated with Mab.
- MDA-MB-231 cell line which is an epithelial, MUC16+, human breast cancer cell line
- MDA-MB-231-TGL expresses luciferase and GFP to allow for non-invasive bioluminescence analysis (Minn et al. (2005) Nature 436:518- 524).
- MDA-MB-231-TGL shGAL is a further derivative cell line in which LGALS3 is silenced using a short hairpin RNA.
- FIG. 14A shows dorsal imaging of the injected mice at one week and 11 weeks after injection.
- FIG. 14B shows the survival curve for the experiment.
- the mice injected with the LGALS deficient cells exhibited a significant decrease in lung metastases even after establishment of the tumor at week (compare Group 1 weekl to week 11). In several mice, the tumors appeared completely eradicated (FIG. 14 A).
- mice injected with the LGALS deficient cells also exhibited significantly longer survival (FIG. 14A).
- FIG. 14C the effect of the 14D11.2D2 anti-LGALS3 antibody on metastasis was examined.
- administration of an anti-LGALS3 antibody recapitulated the effect of LGALS3 siRNA on lung metastasis.
- FIG. 14C administration of the 14D11 antibody both increased survival and eliminated cancer metastases from about 1/3 of the mice.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Cell Biology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Epidemiology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Biotechnology (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP19747986.8A EP3746123A4 (en) | 2018-02-01 | 2019-02-01 | ANTIBODIES DIRECTED AGAINST GALECTIN-3 AND THEIR METHODS OF USE |
| CA3089988A CA3089988A1 (en) | 2018-02-01 | 2019-02-01 | Antibodies to galectin-3 and methods of use thereof |
| AU2019215202A AU2019215202B2 (en) | 2018-02-01 | 2019-02-01 | Antibodies to Galectin-3 and methods of use thereof |
| US16/966,438 US12180285B2 (en) | 2018-02-01 | 2019-02-01 | Antibodies to galectin-3 and methods of use thereof |
| JP2020541938A JP7539834B2 (ja) | 2018-02-01 | 2019-02-01 | ガレクチン-3に対する抗体及びその使用方法 |
| JP2024083146A JP2024119840A (ja) | 2018-02-01 | 2024-05-22 | ガレクチン-3に対する抗体及びその使用方法 |
| US18/979,285 US20250353915A1 (en) | 2018-02-01 | 2024-12-12 | Antibodies to galectin-3 and methods of use thereof |
| JP2025245658A JP2026048820A (ja) | 2018-02-01 | 2025-12-11 | ガレクチン-3に対する抗体及びその使用方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862625166P | 2018-02-01 | 2018-02-01 | |
| US62/625,166 | 2018-02-01 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/966,438 A-371-Of-International US12180285B2 (en) | 2018-02-01 | 2019-02-01 | Antibodies to galectin-3 and methods of use thereof |
| US18/979,285 Division US20250353915A1 (en) | 2018-02-01 | 2024-12-12 | Antibodies to galectin-3 and methods of use thereof |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019152895A1 true WO2019152895A1 (en) | 2019-08-08 |
Family
ID=67479885
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/016430 Ceased WO2019152895A1 (en) | 2018-02-01 | 2019-02-01 | Antibodies to galectin-3 and methods of use thereof |
Country Status (6)
| Country | Link |
|---|---|
| US (2) | US12180285B2 (https=) |
| EP (1) | EP3746123A4 (https=) |
| JP (3) | JP7539834B2 (https=) |
| AU (1) | AU2019215202B2 (https=) |
| CA (1) | CA3089988A1 (https=) |
| WO (1) | WO2019152895A1 (https=) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112062832A (zh) * | 2020-09-24 | 2020-12-11 | 河南赛诺特生物技术有限公司 | Galectin-3抗原表位肽、抗原、抗体、杂交瘤细胞株及试剂盒 |
| WO2021113527A1 (en) * | 2019-12-06 | 2021-06-10 | Truebinding, Inc. | Antibodies that disrupt the interaction of gal3 and insulin receptor or integrins and methods of use thereof |
| WO2021146218A1 (en) * | 2020-01-13 | 2021-07-22 | Truebinding, Inc. | Anti-gal3 antibodies and methods of use |
| WO2021242776A3 (en) * | 2020-05-26 | 2022-02-10 | Truebinding, Inc. | Methods of treating inflammatory diseases by blocking galectin-3 |
| WO2022125482A1 (en) * | 2020-12-08 | 2022-06-16 | Memorial Sloan Kettering Cancer Center | Antibodies to galectin-3 and methods of use thereof |
| US11427638B2 (en) | 2019-01-30 | 2022-08-30 | Truebinding, Inc. | Anti-Gal3 antibodies and uses thereof |
| WO2023061388A1 (zh) * | 2021-10-15 | 2023-04-20 | 深圳市睿盟创新生物科技有限公司 | 半乳糖凝集素-3的免疫测定 |
| US12227567B2 (en) | 2017-07-25 | 2025-02-18 | Truebinding, Inc. | Treating cancer by blocking the interaction of TIM-3 and its ligand |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004091634A1 (en) * | 2003-04-07 | 2004-10-28 | Glycogenesys, Inc. | Composition and uses of galectin antagonists |
| US20050032673A1 (en) * | 2002-06-10 | 2005-02-10 | John Constance M. | Sustained release N-terminally truncated galectin-3 and antibodies to galectin-3 carbohydrate ligands for use in treating disease |
| WO2014089267A1 (en) * | 2012-12-05 | 2014-06-12 | Eleven Biotherapeutics, Inc. | Galectin-3 fusion proteins |
| US8765797B2 (en) * | 2010-06-21 | 2014-07-01 | Board Of Regents, The University Of Texas System | TG2 inhibitors and uses thereof |
Family Cites Families (91)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US198A (en) | 1837-05-15 | Mode of constructing boats for canals | ||
| US5569A (en) | 1848-05-16 | Corn-sheller | ||
| US825A (en) | 1838-07-09 | Bail way cooking-stove | ||
| US5851A (en) | 1848-10-17 | Machinery for doubling and twisting tarn | ||
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| FR2374910A1 (fr) | 1976-10-23 | 1978-07-21 | Choay Sa | Preparation a base d'heparine, comprenant des liposomes, procede pour l'obtenir et medicaments contenant de telles preparations |
| US4444887A (en) | 1979-12-10 | 1984-04-24 | Sloan-Kettering Institute | Process for making human antibody producing B-lymphocytes |
| US4716111A (en) | 1982-08-11 | 1987-12-29 | Trustees Of Boston University | Process for producing human antibodies |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| SE448277B (sv) | 1985-04-12 | 1987-02-09 | Draco Ab | Indikeringsanordning vid en doseringsanordning for lekemedel |
| US4824659A (en) | 1985-06-07 | 1989-04-25 | Immunomedics, Inc. | Antibody conjugates |
| US5776093A (en) | 1985-07-05 | 1998-07-07 | Immunomedics, Inc. | Method for imaging and treating organs and tissues |
| SE453566B (sv) | 1986-03-07 | 1988-02-15 | Draco Ab | Anordning vid pulverinhalatorer |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| GB8607679D0 (en) | 1986-03-27 | 1986-04-30 | Winter G P | Recombinant dna product |
| EP0545913B1 (en) | 1986-08-18 | 1999-02-24 | Emisphere Technologies, Inc. | Delivery systems for pharmacological agents |
| US5869620A (en) | 1986-09-02 | 1999-02-09 | Enzon, Inc. | Multivalent antigen-binding proteins |
| EP0279582A3 (en) | 1987-02-17 | 1989-10-18 | Pharming B.V. | Dna sequences to target proteins to the mammary gland for efficient secretion |
| US5132405A (en) | 1987-05-21 | 1992-07-21 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US5091513A (en) | 1987-05-21 | 1992-02-25 | Creative Biomolecules, Inc. | Biosynthetic antibody binding sites |
| US4873316A (en) | 1987-06-23 | 1989-10-10 | Biogen, Inc. | Isolation of exogenous recombinant proteins from the milk of transgenic mammals |
| JPS6412935A (en) | 1987-07-02 | 1989-01-17 | Mitsubishi Electric Corp | Constant-speed travel device for vehicle |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5413923A (en) | 1989-07-25 | 1995-05-09 | Cell Genesys, Inc. | Homologous recombination for universal donor cells and chimeric mammalian hosts |
| GB8928874D0 (en) | 1989-12-21 | 1990-02-28 | Celltech Ltd | Humanised antibodies |
| US5580575A (en) | 1989-12-22 | 1996-12-03 | Imarx Pharmaceutical Corp. | Therapeutic drug delivery systems |
| EP1690934A3 (en) | 1990-01-12 | 2008-07-30 | Abgenix, Inc. | Generation of xenogeneic antibodies |
| US6075181A (en) | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US5314995A (en) | 1990-01-22 | 1994-05-24 | Oncogen | Therapeutic interleukin-2-antibody based fusion proteins |
| ATE300615T1 (de) | 1990-08-29 | 2005-08-15 | Genpharm Int | Transgene mäuse fähig zur produktion heterologer antikörper |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5404871A (en) | 1991-03-05 | 1995-04-11 | Aradigm | Delivery of aerosol medications for inspiration |
| DK0575545T3 (da) | 1991-03-15 | 2003-09-15 | Amgen Inc | Pegylering af polypeptider |
| EP0519596B1 (en) | 1991-05-17 | 2005-02-23 | Merck & Co. Inc. | A method for reducing the immunogenicity of antibody variable domains |
| EP1400536A1 (en) | 1991-06-14 | 2004-03-24 | Genentech Inc. | Method for making humanized antibodies |
| US5637481A (en) | 1993-02-01 | 1997-06-10 | Bristol-Myers Squibb Company | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| WO1993000951A1 (en) | 1991-07-02 | 1993-01-21 | Inhale, Inc. | Method and device for delivering aerosolized medicaments |
| ES2136092T3 (es) | 1991-09-23 | 1999-11-16 | Medical Res Council | Procedimientos para la produccion de anticuerpos humanizados. |
| ES2341666T3 (es) | 1991-12-02 | 2010-06-24 | Medimmune Limited | Produccion de autoanticuerpos de repertorios de segmentos de anticue rpos expresados en la superficie de fagos. |
| EP1291360A1 (en) | 1991-12-13 | 2003-03-12 | Xoma Corporation | Methods and materials for preparation of modified antibody variable domains and therapeutic uses thereof |
| GB9203459D0 (en) | 1992-02-19 | 1992-04-08 | Scotgen Ltd | Antibodies with germ-line variable regions |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| AU701578B2 (en) | 1992-08-21 | 1999-02-04 | Vrije Universiteit Brussel | Immunoglobulins devoid of light chains |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| AU4829593A (en) | 1992-09-23 | 1994-04-12 | Fisons Plc | Inhalation device |
| CA2147260C (en) | 1992-10-19 | 1999-04-13 | Mark Bernard Mecikalski | Dry powder inhaler |
| US5643252A (en) | 1992-10-28 | 1997-07-01 | Venisect, Inc. | Laser perforator |
| ATE199392T1 (de) | 1992-12-04 | 2001-03-15 | Medical Res Council | Multivalente und multispezifische bindungsproteine, deren herstellung und verwendung |
| US5849695A (en) | 1993-01-13 | 1998-12-15 | The Regents Of The University Of California | Parathyroid hormone analogues useful for treatment of osteoporosis and disorders of calcium meatabolism in mammals |
| ATE172933T1 (de) | 1993-01-19 | 1998-11-15 | Glaxo Group Ltd | Aerosol-spender und verfahren zu seiner herstellung |
| CZ206195A3 (en) | 1993-02-12 | 1996-04-17 | Univ Leland Stanford Junior | Controlled transcription of target genes and other biological materials |
| WO1994025591A1 (en) | 1993-04-29 | 1994-11-10 | Unilever N.V. | PRODUCTION OF ANTIBODIES OR (FUNCTIONALIZED) FRAGMENTS THEREOF DERIVED FROM HEAVY CHAIN IMMUNOGLOBULINS OF $i(CAMELIDAE) |
| US5514670A (en) | 1993-08-13 | 1996-05-07 | Pharmos Corporation | Submicron emulsions for delivery of peptides |
| US5814599A (en) | 1995-08-04 | 1998-09-29 | Massachusetts Insitiute Of Technology | Transdermal delivery of encapsulated drugs |
| US5827690A (en) | 1993-12-20 | 1998-10-27 | Genzyme Transgenics Corporatiion | Transgenic production of antibodies in milk |
| CA2219361C (en) | 1995-04-27 | 2012-02-28 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| EP0823941A4 (en) | 1995-04-28 | 2001-09-19 | Abgenix Inc | HUMAN ANTIBODIES DERIVED FROM IMMUNIZED XENO MOUSES |
| US5989830A (en) | 1995-10-16 | 1999-11-23 | Unilever Patent Holdings Bv | Bifunctional or bivalent antibody fragment analogue |
| GB9526100D0 (en) | 1995-12-20 | 1996-02-21 | Intersurgical Ltd | Nebulizer |
| JP2000503565A (ja) | 1996-01-03 | 2000-03-28 | グラクソ、グループ、リミテッド | 吸入装置 |
| US6027947A (en) | 1996-08-20 | 2000-02-22 | Ramtron International Corporation | Partially or completely encapsulated top electrode of a ferroelectric capacitor |
| US5916771A (en) | 1996-10-11 | 1999-06-29 | Abgenix, Inc. | Production of a multimeric protein by cell fusion method |
| EP1500329B1 (en) | 1996-12-03 | 2012-03-21 | Amgen Fremont Inc. | Human antibodies that specifically bind human TNF alpha |
| US5879681A (en) | 1997-02-07 | 1999-03-09 | Emisphere Technolgies Inc. | Compounds and compositions for delivering active agents |
| US5921447A (en) | 1997-02-13 | 1999-07-13 | Glaxo Wellcome Inc. | Flow-through metered aerosol dispensing apparatus and method of use thereof |
| BRPI9809391B8 (pt) | 1997-04-14 | 2021-05-25 | Amgen Res Munich Gmbh | processo para a produção de um receptor de antígeno anti-humano, anticorpo humano e composição farmacêutica |
| US20020062010A1 (en) | 1997-05-02 | 2002-05-23 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US7951917B1 (en) | 1997-05-02 | 2011-05-31 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US6235883B1 (en) | 1997-05-05 | 2001-05-22 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
| WO1999055369A1 (en) | 1998-04-28 | 1999-11-04 | Smithkline Beecham Corporation | Monoclonal antibodies with reduced immunogenicity |
| DE60042789D1 (de) | 1999-11-29 | 2009-10-01 | Bac Ip B V | Immobilisierte antigenbindende moleküle aus einer domäne |
| US6436703B1 (en) | 2000-03-31 | 2002-08-20 | Hyseq, Inc. | Nucleic acids and polypeptides |
| US6596541B2 (en) | 2000-10-31 | 2003-07-22 | Regeneron Pharmaceuticals, Inc. | Methods of modifying eukaryotic cells |
| MXPA05000511A (es) | 2001-07-12 | 2005-09-30 | Jefferson Foote | Anticuepros super humanizados. |
| US20040014194A1 (en) | 2002-03-27 | 2004-01-22 | Schering Corporation | Beta-secretase crystals and methods for preparing and using the same |
| WO2005035575A2 (en) | 2003-08-22 | 2005-04-21 | Medimmune, Inc. | Humanization of antibodies |
| GB0624500D0 (en) * | 2006-12-07 | 2007-01-17 | Istituto Superiore Di Sanito | A novel passive vaccine for candida infections |
| US8227577B2 (en) | 2007-12-21 | 2012-07-24 | Hoffman-La Roche Inc. | Bivalent, bispecific antibodies |
| EP2346994B1 (en) | 2008-09-30 | 2022-02-16 | Ablexis, LLC | Knock-in mice for the production of chimeric antibodies |
| JP5816170B2 (ja) | 2009-06-26 | 2015-11-18 | リジェネロン・ファーマシューティカルズ・インコーポレイテッドRegeneron Pharmaceuticals, Inc. | 天然の免疫グロブリン形式を有する容易に単離される二重特異性抗体 |
| KR102203727B1 (ko) | 2010-03-31 | 2021-01-18 | 아블렉시스, 엘엘씨 | 키메라 항체의 제조를 위한 비-인간 동물의 유전적 조작 |
| DK3323830T3 (da) | 2010-06-19 | 2023-09-25 | Memorial Sloan Kettering Cancer Center | Anti-gd2 antibodies |
| CA2874083C (en) * | 2014-12-05 | 2024-01-02 | Universite Laval | Tdp-43-binding polypeptides useful for the treatment of neurodegenerative diseases |
| CN107667120B (zh) * | 2015-03-17 | 2022-03-08 | 纪念斯隆-凯特林癌症中心 | 抗muc16抗体及其应用 |
| CN107383192B (zh) | 2017-07-19 | 2018-08-24 | 深圳市倍诺博生物科技有限公司 | 半乳糖凝集素-3检测试剂盒 |
| AU2018308088B2 (en) * | 2017-07-25 | 2025-05-29 | Truebinding, Inc. | Treating cancer by blocking the interaction of TIM-3 and its ligand |
| EP3466975A1 (en) * | 2017-10-05 | 2019-04-10 | Laboratoire Français du Fractionnement et des Biotechnologies | A specific binding molecule directed against galectin-3 protein |
-
2019
- 2019-02-01 JP JP2020541938A patent/JP7539834B2/ja active Active
- 2019-02-01 WO PCT/US2019/016430 patent/WO2019152895A1/en not_active Ceased
- 2019-02-01 EP EP19747986.8A patent/EP3746123A4/en active Pending
- 2019-02-01 US US16/966,438 patent/US12180285B2/en active Active
- 2019-02-01 CA CA3089988A patent/CA3089988A1/en active Pending
- 2019-02-01 AU AU2019215202A patent/AU2019215202B2/en active Active
-
2024
- 2024-05-22 JP JP2024083146A patent/JP2024119840A/ja active Pending
- 2024-12-12 US US18/979,285 patent/US20250353915A1/en active Pending
-
2025
- 2025-12-11 JP JP2025245658A patent/JP2026048820A/ja active Pending
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20050032673A1 (en) * | 2002-06-10 | 2005-02-10 | John Constance M. | Sustained release N-terminally truncated galectin-3 and antibodies to galectin-3 carbohydrate ligands for use in treating disease |
| WO2004091634A1 (en) * | 2003-04-07 | 2004-10-28 | Glycogenesys, Inc. | Composition and uses of galectin antagonists |
| US8765797B2 (en) * | 2010-06-21 | 2014-07-01 | Board Of Regents, The University Of Texas System | TG2 inhibitors and uses thereof |
| WO2014089267A1 (en) * | 2012-12-05 | 2014-06-12 | Eleven Biotherapeutics, Inc. | Galectin-3 fusion proteins |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP3746123A1 * |
Cited By (17)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12227567B2 (en) | 2017-07-25 | 2025-02-18 | Truebinding, Inc. | Treating cancer by blocking the interaction of TIM-3 and its ligand |
| US12497458B2 (en) | 2019-01-30 | 2025-12-16 | Truebinding, Inc. | Anti-GAL3 antibodies and uses thereof |
| US11427638B2 (en) | 2019-01-30 | 2022-08-30 | Truebinding, Inc. | Anti-Gal3 antibodies and uses thereof |
| US20230094463A1 (en) * | 2019-12-06 | 2023-03-30 | Truebinding, Inc. | Antibodies that disrupt the interaction of gal3 and insulin receptor or integrins and methods of use thereof |
| WO2021113527A1 (en) * | 2019-12-06 | 2021-06-10 | Truebinding, Inc. | Antibodies that disrupt the interaction of gal3 and insulin receptor or integrins and methods of use thereof |
| CN115279789A (zh) * | 2019-12-06 | 2022-11-01 | 真和制药有限公司 | 破坏gal3和胰岛素受体或整联蛋白的相互作用的抗体及其使用方法 |
| WO2021146218A1 (en) * | 2020-01-13 | 2021-07-22 | Truebinding, Inc. | Anti-gal3 antibodies and methods of use |
| CN115427449A (zh) * | 2020-01-13 | 2022-12-02 | 真和制药有限公司 | 抗Gal3抗体和使用方法 |
| US20230036181A1 (en) * | 2020-01-13 | 2023-02-02 | Truebinding, Inc. | Anti-gal3 antibodies and methods of use |
| EP4157338A4 (en) * | 2020-05-26 | 2024-11-13 | TrueBinding, Inc. | METHOD FOR TREATING INFLAMMATORY DISEASES BY GALECTIN-3 BLOCKING |
| US12281166B2 (en) | 2020-05-26 | 2025-04-22 | Truebinding, Inc. | Methods of treating inflammatory diseases by blocking Galectin-3 |
| WO2021242776A3 (en) * | 2020-05-26 | 2022-02-10 | Truebinding, Inc. | Methods of treating inflammatory diseases by blocking galectin-3 |
| CN112062832A (zh) * | 2020-09-24 | 2020-12-11 | 河南赛诺特生物技术有限公司 | Galectin-3抗原表位肽、抗原、抗体、杂交瘤细胞株及试剂盒 |
| JP2024501581A (ja) * | 2020-12-08 | 2024-01-12 | メモリアル スローン-ケタリング キャンサー センター | ガレクチン-3に対する抗体及びその使用方法 |
| WO2022125482A1 (en) * | 2020-12-08 | 2022-06-16 | Memorial Sloan Kettering Cancer Center | Antibodies to galectin-3 and methods of use thereof |
| JP7825633B2 (ja) | 2020-12-08 | 2026-03-06 | メモリアル スローン ケタリング キャンサー センター | ガレクチン-3に対する抗体及びその使用方法 |
| WO2023061388A1 (zh) * | 2021-10-15 | 2023-04-20 | 深圳市睿盟创新生物科技有限公司 | 半乳糖凝集素-3的免疫测定 |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3089988A1 (en) | 2019-08-08 |
| JP7539834B2 (ja) | 2024-08-26 |
| EP3746123A1 (en) | 2020-12-09 |
| US20210032350A1 (en) | 2021-02-04 |
| JP2026048820A (ja) | 2026-03-17 |
| US20250353915A1 (en) | 2025-11-20 |
| AU2019215202B2 (en) | 2025-11-13 |
| US12180285B2 (en) | 2024-12-31 |
| JP2021512604A (ja) | 2021-05-20 |
| EP3746123A4 (en) | 2021-12-01 |
| JP2024119840A (ja) | 2024-09-03 |
| AU2019215202A1 (en) | 2020-08-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12466894B2 (en) | Anti-MUC16 antibodies and uses thereof | |
| US20250353915A1 (en) | Antibodies to galectin-3 and methods of use thereof | |
| US11987642B2 (en) | Bispecific HER2 and CD3 binding molecules | |
| JP7825633B2 (ja) | ガレクチン-3に対する抗体及びその使用方法 | |
| HK1249911B (en) | Anti-muc16 antibodies and uses thereof | |
| BR112017019978B1 (pt) | Anticorpo ou um fragmento de ligação com antígeno, conjugado, receptor de antígeno, polinucleotídeo, vetor, célula microbiana transgênica ex vivo, método para produzir uma célula transgênica ex vivo, método para produzir um anticorpo, composição farmacêutica e uso do anticorpo | |
| HK1238654B (en) | Bispecific her2 and cd3 binding molecules | |
| HK1238654A1 (en) | Bispecific her2 and cd3 binding molecules |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19747986 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3089988 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020541938 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2019215202 Country of ref document: AU Date of ref document: 20190201 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019747986 Country of ref document: EP Effective date: 20200901 |