WO2019135921A1 - Anticorps bispécifiques neutralisants hiv-1 - Google Patents

Anticorps bispécifiques neutralisants hiv-1 Download PDF

Info

Publication number
WO2019135921A1
WO2019135921A1 PCT/US2018/066643 US2018066643W WO2019135921A1 WO 2019135921 A1 WO2019135921 A1 WO 2019135921A1 US 2018066643 W US2018066643 W US 2018066643W WO 2019135921 A1 WO2019135921 A1 WO 2019135921A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
imab
seq
amino acid
acid sequence
Prior art date
Application number
PCT/US2018/066643
Other languages
English (en)
Inventor
David D. Ho
Yaoxing Huang
Jian Yu
Original Assignee
Aaron Diamond Aids Research Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US15/850,832 external-priority patent/US10308707B2/en
Application filed by Aaron Diamond Aids Research Center filed Critical Aaron Diamond Aids Research Center
Priority to AU2018399587A priority Critical patent/AU2018399587A1/en
Priority to EP18898849.7A priority patent/EP3728311A4/fr
Priority to US16/770,840 priority patent/US12098187B2/en
Priority to CN201880089788.4A priority patent/CN111819196B/zh
Priority to JP2020535114A priority patent/JP7345861B2/ja
Priority to CA3085351A priority patent/CA3085351A1/fr
Publication of WO2019135921A1 publication Critical patent/WO2019135921A1/fr

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • C07K16/1036—Retroviridae, e.g. leukemia viruses
    • C07K16/1045—Lentiviridae, e.g. HIV, FIV, SIV
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A61P31/18—Antivirals for RNA viruses for HIV
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2812—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD4
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2866—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567—Framework region [FR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the present invention relates generally to using bispecific antibodies in the prevention and treatment of HIV.
  • Abs Passive immunization with antibodies
  • This approach may involve preparing human immunoglobulins from donors who recovered from an infectious disease and utilizing such preparations, containing Abs specific for the infectious organism, to protect a recipient against the same disease.
  • therapeutic antibodies can be made by immunizing mice with an antigen, and then engineering/humanizing the mouse Ab into a human version.
  • Monoclonal antibodies (mAbs) are homogeneous in terms of physical characteristics and immunochemical reactivity, and so offer the possibility of absolute specific activity.
  • bispecific mAbs composed of fragments of two different mAbs and which bind to two different types of antigen. This facilitates binding to antigens expressed only weakly, for example.
  • Some bispecific mAbs can stimulate strong immune responses, limiting their clinical application.
  • One recent approach to ameliorating this effect is“CrossMab” methodology, a bispecific antibody format that adopts a more native antibody-like structure.
  • the present invention pertains to a bispecific antibody for neutralizing HIV.
  • the bispecific antibody includes portions of a first and a second antibody, in which the first antibody binds to a HIV envelope protein.
  • the first antibody is selected from PGT145, PG9, PGT128, PGT121, 10-1074, 3BNC117, VRC01, PGT151, 4E10, 10E8 and a variant thereof.
  • the bispecific antibody includes portions of a second antibody, in which the second antibody binds to a cell membrane protein.
  • the second antibody binds to a cell receptor protein or a cell membrane co-receptor protein.
  • the second antibody is selected from a CD4 antibody, a CCR5 antibody and a CXCR4 antibody, such as Pro 140, ibalizumab, 515H7, or a variant thereof.
  • the bispecific antibody has a CrossMab format.
  • the present invention provides a bispecific antibody including portions of a first antibody and a second antibody, wherein the first antibody binds to a HIV envelope protein and the second antibody binds to a cell membrane protein.
  • the bispecific antibody has a CrossMab format.
  • compositions including the bispecific antibodies disclosed herein are also provided.
  • the pharmaceutical composition may be formulated for oral, intranasal, pulmonary, intradermal, transdermal, subcutaneous, intramuscular, intraperitoneal, or intravenous delivery.
  • methods for neutralizing HIV include the steps of contacting an antigen binding site with a bispecific antibody that binds a HIV envelope protein and contacting another antigen binding site with a bispecific antibody that binds a cell membrane protein.
  • methods for treating a patient infected with HIV include administering to the patient any of the bispecific antibodies or pharmaceutical compositions as disclosed herein. In an embodiment, the patient is human.
  • Figure l is a diagram illustrating a CrossMab antibody derived from two IgG monoclonal antibodies.
  • Figure 2A is a diagram illustrating an iMab antibody (shorthand for the monoclonal antibody ibalizumab) that targets CD4 and a Pro 140 antibody that targets CCR5.
  • iMab antibody shorthand for the monoclonal antibody ibalizumab
  • Pro 140 antibody that targets CCR5.
  • Figure 2B is a diagram illustrating mAbs that target the HIV envelope gpl20.
  • Figure 3 is a graph comparing the maximum percentage inhibition (MPI) against cell-to-cell HIV transmission using a combination of iMab and 10E8 antibodies with CrossMab bispecific l0E8/iMab antibodies. Except otherwise stated, all iMab-based bispecific antibodies were constructed using the MV 1 variant.
  • Figures 4A-J are a series of graphs comparing the inhibition of various strains of X4 and dual- tropic HIV using varying concentrations of 10E8, Pro 140 or 10E8/P140 antibodies.
  • P140 is shorthand for Pro 140.
  • Figures 5A-G are a series of graphs comparing the inhibition of various strains of HIV using varying concentrations of 10E8, Pro 140, 10E8/P140 or a combination of the individual 10E8 and Pro 140 monoclonal antibodies.
  • Figures 6A-D are a series of graphs comparing the inhibition of various strains of HIV using varying concentrations of 10E8, X19, 10E8/X19 or 10E8/P140 antibodies.
  • Figures 7A-H are a series of graphs comparing the inhibition of various strains of HIV using varying concentrations of 10E8, Pro 140, 10E8/P140 and lOE8/aHer2 antibodies.
  • Figure 8 A is a graph comparing the binding of CrossMab bispecific antibodies l0E8/iMab and D 10E8/iMab to the HIV-l glycoprotein MPER.
  • Figures 8B-E are a series of graphs comparing the inhibition percentages of 10E8 (light gray lines) and D10E8 (dark gray lines) against iMab resistant R5 viruses ( Figure 8B) and X4 viruses ( Figure 8C), as well as the inhibition percentages of l0E8/iMab (light gray lines) and
  • Figures 9A-G are a series of graphs comparing the inhibition of various strains of HIV using varying concentrations of 10E8, D10E8, 4E10, 10E8/P140, D10E8/R140 and 4E10/P140 antibodies.
  • Figure 10 is a graph comparing the antiviral coverage of the CrossMab antibodies l0E8/Prol40 and l0E8/iMab, their parental monoclonal antibodies 10E8, Pro 140 and iMab, and various other HIV envelope-targeting monoclonal antibodies against a large panel of HIV envelope pseudotyped viruses.
  • Figures 11 A-E are a series of graphs comparing the maximum percentage inhibition (MPI) of a large panel of HIV envelope pseudotyped viruses with the monoclonal antibody iMab (grey bars in all panels) and the CrossMab antibodies PGTl45/ibalizumab (l45/iMab; Figure 11 A), PGTl28/ibalizumab (l28/iMab; Figure 11B), PGTl5l/ibalizumab (l5l/iMab; Figure 11C), 3BNC1 l7/ibalizumab (H7/iMab; Figure 11D) and l0E8/ibalizumab (l0E8/iMab; Figure 11E).
  • MPI maximum percentage inhibition
  • Figures 12A-E are a series of graphs comparing the maximum percentage inhibition (MPI) and IC80 antibody concentrations of the CrossMab antibodies PGTl45/ibalizumab (l45/iMab; Figure 12 A), PGTl28/ibalizumab (l28/iMab; Figure 12B), PGTl5l/ibalizumab (l5l/iMab;
  • MPI maximum percentage inhibition
  • FIG. 12C 3BNC1 l7/ibalizumab (H7/iMab; Figure 12D) and l0E8/ibalizumab (l0E8/iMab; Figure 12E) against a large panel of HIV envelope pseudotyped viruses.
  • Figures 13 A-E are a series of graphs comparing the IC80 antibody concentrations for iMab- and Prol40-based CrossMab bispecific antibodies and their parent antibodies for PGTl45/iMab and PGT145/Pro 140 (Figure 13A), 3BNCl l7/iMab and 3BNC117/Pro 140 ( Figure 13B), PGTl28/iMab and PGTl28/Prol40 ( Figure 13C), PGTl5l/iMab and PGTl5l/Prol40 ( Figure 13D) and lOE8/iMab and l0E8/Prol40 ( Figure 13E).
  • Figures 14A-E are a series of graphs comparing the IC50 antibody concentrations for iMab- and Prol40-based CrossMab bispecific antibodies and their parent antibodies for PGTl45/iMab and PGT145/Pro 140 ( Figure 14 A), 3BNCl l7/iMab and 3BNC117/Pro 140 ( Figure 14B),
  • Figures 15A-E are graphs displaying the IC80 antibody concentrations for iMab-based
  • Figure 16 is a graph displaying the maximum percent inhibition (MPI) of CrossMab bispecific antibodies and parental antibodies against cell-to-cell transmission of HIV.
  • Figure 17A is a graph comparing the inhibition of an HIV strain against varying concentrations of 10E8, Pro 140, 10E8/P140 CrossMab bispecific antibody, and a combination of individual 10E8 and Pro 140 monoclonal antibodies.
  • Figure 17B is a graph comparing the inhibition of an HIV strain against varying concentrations of iMab, 10E8, l0E8/iMab CrossMab bispecific antibody, and a combination of individual 10E8 and iMab monoclonal antibodies.
  • Figures 18A-D are a series of graphs comparing the inhibition of various HIV R5 strains against varying concentrations of 10E8, Prol40, 10E8/P140 and 10E8/515H7 antibodies.
  • Figures 18E-H are a series of graphs comparing the inhibition of various HIV X4 strains against various concentrations of 10E8, 515H7 and 10E8/515H7 antibodies.
  • Figures 19A-B are a series of graphs comparing inhibition of various HIV strains against varying concentrations of l0E8/Prol40, l0E8/iMab, 10E8/515H7 and 10E8/X19 antibodies.
  • Figure 19C indicates the density of CD4, CCR5 and CXCR4 receptors present on TZM-bl cells.
  • Figure 20 compares the binding of CrossMab bispecific antibodies l0E8/Prol40, D10E8/RGO140 and 4E10/Pro 140 to the HIV-l glycoprotein MPER.
  • Figures 21A-G are a series of graphs comparing the inhibition of various strains of HIV against varying concentrations of 4E10, Prol40 and 4E10/P140 and 10E8/P140 antibodies.
  • Figure 22A is size exclusion chromatography analysis of the CrossMab antibodies l0E8/iMab, 10E8/P140 and 3BNC1 l7/iMab.
  • Figure 22B is size exclusion chromatography analysis of the monoclonal antibodies iMab, 10E8 and Pro 140.
  • Figure 23 is size exclusion chromatography analysis of monoclonal antibody 10E8 and a chimeric antibody comprised of the 10E8 heavy chain paired with the 4E10 light chain.
  • Figures 24A-C are a series of size exclusion chromatography graphs of: the monoclonal antibodies 10E8 and 4E10 and a chimeric antibody comprised of the 10E8 heavy chain paired with the 4E10 light chain ( Figure 24A), the monoclonal antibody 10E8 and 10E8 mutants with potentially stabilizing mutations genetically engineered in the 10E8 light chain ( Figure 24B), and the monoclonal antibody 10E8 and 10E8 mutants genetically grafted with the kappa light chain of non-l0E8 antibodies ( Figure 24C).
  • Figure 25 is a size exclusion chromatography graph of the monoclonal antibody 4E10 and 4E10 mutants genetically grafted with the light regions of 10E8 that included the CDR1 region, CDR2 region, CDR3 region, or combined CDR1, CDR2 and CDR3 regions.
  • Figure 26A is a size exclusion chromatography graph of 10E8 chimeric antibodies.
  • CDR123 is a chimeric antibody of the 10E8 heavy chain paired with a 10E8 light chain genetically grafted with the 10E8 antibody germline CDR region sequences.
  • FW123 is a chimeric antibody of the 10E8 heavy chain paired with a 10E8 light chain genetically grafted with the 10E8 antibody germline framework region sequences.
  • Figure 26B is a table indicating the expression, HIV MPER binding ability, size exclusion chromatography profile, and HIV neutralization profile of the CDR123 and FW123 antibodies.
  • Figure 27 is a size exclusion chromatography graph of monoclonal antibody 10E8, its somatic variant H6L10, and a CrossMab bispecific antibody consisting of H6L10 paired with Prol40.
  • Figure 28 is a graph depicting the pharmacokinetics profiles of 10E8, H6LlO/Pro 140 and its parental antibodies in a mouse model.
  • Figure 29 is a graph comparing the potency of l0E8 v i.o/iMab or P140 CrossMab antibodies with l0E8/iMab or P 140 antibodies.
  • Figure 30 is a graph depicting the pharmacokinetics of 10E8 and CrossMab antibodies derived from several 10E8 variants and iMab or P 140 in a mouse model.
  • Figures 31A-B are a series of graphs depicting the HIV viral coverage of 10E8 n i.i/R140 and lOE8v2.o/iMab antibodies.
  • Figures 31C-D are a series of graphs depicting size exclusion chromatography stability graphs of 10E8n ⁇ . i/R140 and lOE8 V2. o/iMab antibodies.
  • Figures 32A-B are a series of graphs depicting the size exclusion stability graphs of
  • Figures 34A-C are a series of graphs comparing the activity of 10E8 n i.i/R140 and lOE8 V2. o/iMab on a HIV Clade C panel, and the IC50 and IC80 activities of the antibodies.
  • Figures 35 and 36 are graphs comparing the potency of 10E8 n i.i/R140, lOE8 V2. o/iMab, and various monoclonal antibodies against HIV.
  • Figures 37A-C demonstrate that a select number of l0E8V2.0/iMab (also referred to as lOE8.2/iMab) variants retained functional antiviral activity and increased solubility.
  • Figure 37A demonstrates that some of the lOE8.2/iMab variants retained functional activity in an in vitro HIV-l neutralization assay.
  • Figure 37B shows that lOE8.2/iMab and some of the lOE8.2/iMab variants have similar in vivo pharmacokinetic profiles.
  • Figure 37C shows the precipitation profiles of lOE8.2/iMab and some of the lOE8.2/iMab variants under thermal stress-inducing conditions.
  • Figures 38A-B show the results of size exclusion chromatography, which was used to identify lOE8.2/iMab variants with the least aggregation after thermal stress-inducing conditions.
  • Figures 39A-B illustrate the solubility of lOE8.2/iMab and the lOE8.4/iMab variant at 4°C after ultracentrifugati on .
  • Figure 40 demonstrates the turbidity of lOE8.2/iMab and the lOE8.4/iMab variant at different concentrations over time.
  • Figure 41 shows the thermostability of lOE8.2/iMab and the lOE8.4/iMab variant as assessed by differential scanning calorimetry.
  • Figure 42 demonstrates the turbidity of lOE8.2/iMab and the lOE8.4/iMab variant after forced degradation at 50°C for six days.
  • the bars from left to right represent lOE8.2/iMab (pre-centrifugation), lOE8.4/iMab (pre-centrifugation), lOE8.2/iMab (post- centrifugation), and lOE8.4/iMab (post-centrifugation).
  • Figure 43 shows the anti-HIV coverage of lOE8.2/iMab and the lOE8.4/iMab variant.
  • Figure 44 is a graph showing the in vivo antiviral activity of lOE8.2/iMab and the lOE8.4/iMab variant in a humanized mouse model of HIV-l infection.
  • Figure 45A shows a sequence alignment of the light chains of lOE8.2/iMab (SEQ ID NO:33) and the lOE8.4/iMab variant (SEQ ID NO:44).
  • Figure 45B shows a sequence alignment of the heavy chains of lOE8.2/iMab (SEQ ID NO:34) and the lOE8.4/iMab variant (SEQ ID NO:42).
  • ETnderlined sequences denote CDR1, CDR2, and CDR3. Italicized sequences denote constant light chain or constant heavy chain sequences.
  • Figure 46 is a graph showing exemplary variants of 10E8 antibodies that are stable while retaining anti-HIV activity.
  • Embodiments of the present invention provide for inhibition of HIV.
  • bispecific antibodies are formed, each including heavy chain and light chain components from two different parent antibodies.
  • one parent antibody specifically binds HIV, for example, the HIV envelope protein Env.
  • the other parent antibody specifically binds a cell membrane protein, for example CD4 and CCR5.
  • the bispecific antibody e.g ., a HIV CrossMab antibody
  • the bispecific antibody has the natural architecture of an IgG molecule, but with bispecificity.
  • a bispecific antibody a heavy chain and light chain from each of two parental antibodies are combined, providing an antibody in which the antigen binding sites of fragment antigen-binding 1 (Fabl) and Fab2 have different binding specificities.
  • the bispecific antibody is a CrossMab format antibody, as shown in Figure 1.
  • a CrossMab format one heavy chain includes a“knob” structure and the other heavy chain includes a corresponding“hole” structure, and the positions of the constant domains (i.e., CL and CH1) from one parental antibody are switched, which together ensure correct pairing of heavy chains and light chains during assembly.
  • Various mAbs have been shown to block HIV infection by targeting and binding to the HIV envelope protein Env ( Figures 2B and 10). These mAbs include, for example, PGT145, PG9, PGT128, PGT121, 10-1074, 3BNC117, VRC01, PGT151, 4E10, and 10E8.
  • Figure 2B illustrates how the mAb PGT145 targets the V 1/V2 epitope on the HIV viral envelope gpl20; how mAb PGT128 targets the glycan on the V3 stem region of HIV gpl20; how mAb 3BNC117 targets the CD4 binding site of HIV gpl20; how mAb 10E8 targets the membrane proximal external region (MPER) of HIV gp4l; and how mAb PGT151 targets an epitope on both HIV gpl20 and HIV gp4l.
  • MPER membrane proximal external region
  • Pro 140 P140
  • Ibalizumab Ibalizumab
  • 515H7 monoclonal antibodies
  • P140 P140
  • Ibalizumab Ibalizumab
  • 515H7 monoclonal antibodies
  • Figure 2A shows how iMab targets CD4, the primary receptor for HIV-l entry that is expressed on human T-cells; and how Pro 140 targets CCR5, a co-receptor for HIV-l entry by CCR5 tropic HIV-l.
  • the present invention provides bispecific antibodies that target and bind to the HIV Env protein as well as the cell membrane proteins CCR5, CD4 and/or CXCR4.
  • the bispecific antibodies include sequences (for example, heavy and light chain sequences) derived from, but not limited to, the PGT145, PG9, PGT128, PGT121, 10-1074, 3BNC117, VRC01, PGT151, 4E10, and/or 10E8 antibodies and variants thereof.
  • amino acid sequences defining the heavy and light chains of the PGT145 antibody can be found, for example, at www.ncbi.nlm.nih.gov/protein/3UlS_H and http://www.ncbi.nlm.nih.gov/protein/3UlS_L, respectively, the entire contents of which are incorporated herein by reference.
  • amino acid sequences defining the heavy and light chains of the PG9 antibody can be found, for example, at www dot ncbi dot nlm dot nih dot gov/protein/3U4E_H and www dot ncbi dot nlm dot nih dot gov/protein/3MUH_L, respectively, the entire contents of which are incorporated herein by reference.
  • amino acid sequences defining the heavy and light chains of the PGT128 antibody can be found, for example, at www dot ncbi dot nlm dot nih dot gov /protein/3 TYG H and www dot ncbi dot nlm dot nih dot gov protein/3 TYG L, respectively, the entire contents of which are incorporated herein by reference.
  • the amino acid sequences defining the heavy and light chains of the PGT121 antibody can be found, for example, at www dot ncbi dot nlm dot nih dot gov /protein/4FQC_H and www dot ncbi dot nlm dot nih dot gov/protein/4FQC_L, respectively, the entire contents of which are incorporated herein by reference.
  • the amino acid sequences defining the heavy and light chains of the 10-1074 antibody can be found, for example, in Mouquet FL, et al. , (2012) PNAS, 109(47): E3268-77 (including supplementary information), the entire contents of which are incorporated herein by reference.
  • amino acid sequences defining the heavy and light chains of the 3BNC117 antibody can be found, for example, at www dot ncbi dot nlm dot nih dot gov/protein/4LSV_H and www dot ncbi dot nlm dot nih dot gov/protein/4LSV_L, respectively, the entire contents of which are incorporated herein by reference.
  • amino acid sequences defining the heavy and light chains of the VRC01 antibody can be found, for example, at www dot ncbi dot nlm dot nih dot gov/protein/4LST_H and www dot ncbi dot nlm dot nih dot gov/protein/4LST_L, respectively, the entire contents of which are incorporated herein by reference.
  • amino acid sequences defining the heavy and light chains of the PGT151 antibody can be found, for example, at www dot ncbi dot nlm dot nih dot gov/protein/4NUG_H and www dot ncbi dot nlm dot nih dot gov/protein/4NUG_L, respectively, the entire contents of which are incorporated herein by reference.
  • amino acid sequences defining the heavy and light chains of the 4E10 antibody can be found, for example, at www dot ncbi dot nlm dot nih dot gov/protein/4LLV_H and www dot ncbi dot nlm dot nih dot gov/protein/4LLV_L, respectively, the entire contents of which are incorporated herein by reference.
  • amino acid sequences defining the heavy and light chains of the 10E8 antibody can be found, for example, at www dot ncbi dot nlm dot nih dot gov/protein/4G6F_B and www dot ncbi dot nlm dot nih dot gov/protein/4G6F_D, respectively, the entire contents of which are incorporated herein by reference.
  • the bispecific antibodies include sequences (for example, heavy and light chain sequences) derived from, but not limited to, the P140, iMab (or the MV1 variant) and/or 515H7 antibodies and variants thereof.
  • sequences for example, heavy and light chain sequences
  • the heavy and light chain sequences of the Pro 140, iMab (or its MV1 variant), and 515H7 antibodies are further described, for example, in Olson, W. C. et al. , (1999) J Virol., 73(5):4l45-55, Trkola, A. et al. , (2001) J Virol., 75(2):579- 88, U.S. Patent No. 7,122,185, Burkly L. C. et al.
  • Retroviruses 13(11):933-43, International Patent Publication No. W02014100139, and
  • EP2246364 the entire contents of all of which are incorporated herein by reference.
  • an antibody“variant” refers to an antibody which has an amino acid sequence which differs from the amino acid sequence of a parent antibody from which it is derived.
  • the variant has one or more amino acid alterations with respect to the parent antibody.
  • the bispecific antibody of the present invention includes a heavy and light chain sequence from the PGT145, PG9, PGT128, PGT121, 10-1074, 3BNC117, VRC01, PGT151, 4E10, or 10E8 antibody or a variant thereof and a heavy and light chain sequence from the P140, iMab (or the MV1 variant), or 515H7 antibody or a variant thereof.
  • a series of HIV CrossMab antibodies have been constructed including but not limited to, for example, 145/MV1, 117/MV1, 128/MV1, 10E8/MV1, 145/P140, 128/P140, 117/P140, 10E8/P140, lOE8/alpha-Her2, 10E8/X19, and 4E10/P140.
  • PGT145 (“145”), 3BNC117 (“117”), PGT128 (“128”), and 10E8 are four different HIV envelope antibodies.
  • Pro 140 (“P140”) is a mAb that binds to the cell surface receptor CCR5.
  • MV1 is a CD4 antibody that is a modified variant of the mAb Ibalizumab (“iMab”; see, for example, International Patent Publication No. W02014100139, incorporated herein by reference in its entirety).
  • XI 9 is one of the antibody variants of the anti-cell surface receptor CXCR4 (see, for example, U.S. Patent No. 8,329,178, incorporated herein by reference in its entirety) that does not bind to cells expressing CXCR4 (and is therefore used as a non-surface binding control).
  • Alpha-Her2 is a mAb that binds to the Her2 receptor expressed on cells. Many of these
  • CrossMab antibodies increase the breadth of HIV neutralization as compared to their parental antibodies (i.e., monoclonal antibodies MV1, 145, 117 or 10E8).
  • the bispecific antibodies of the invention significantly increase the potency of neutralization against HIV as compared to their parental antibodies.
  • Amino acid sequence defining the MV1 derived light chain of the 145/MV 1 antibody - MV1- VLCH1 (SEQ ID NO:l): DIVMTQSPDSLAVSLGERVTMNCKSSQSLLYSTNQKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFSG SGSGTDFTLT I S SVQAEDVAVYYCQQYY SYRT FGGGTKLE IKSSASTKGPSVFPLAPS SKST SGGTAALG CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK
  • Amino acid sequence defining the MV1 derived heavy chain of the 145/MV 1 antibody - MV1- HC-Hole-Cross (SEQ ID NO:2): QVQLQQSGPEVVKPGASVKMSCKASGYTFTSYVIHWVRQKPGQGLDWIGYINPYNDGTDYDEKFKGKATL TSDTSTSTAYMELSSLRSEDTAVYYCAREKDNYATGAWFAYWGQGTLVTVSSASTAAPSVFI FPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGECDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKT
  • Amino acid sequence defining the PGT145 derived heavy chain of the 145/MV1 antibody - PGTl45-HC-Knob (SEQ ID NO:4): QVQLVQSGAEVKKPGSSVKVSCKASGNSFSNHDVHWVRQATGQGLEWMGWMSHEGDKTGLAQKFQGRVTI TRDSGASTVYMELRGLTADDTAIYYCLTGSKHRLRDYFLYNEYGPNYEEWGDYLATLDVWGHGTAVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPASIE
  • 117/MV 1 antibody Amino acid sequence defining the MV1 derived light chain of the 117/MV 1 antibody - MV1- VLCH1 (SEQ ID NO:!):
  • Amino acid sequence defining the MV1 derived heavy chain of the 117/MV 1 antibody - MV1- HC-Hole-Cross (SEQ ID NO:2):
  • Amino acid sequence defining the 3BNC117 derived light chain of the 117/MV 1 antibody - 3BNC117-LC (SEQ ID NO: 5):
  • Amino acid sequence defining the 3BNC117 derived heavy chain of the 117/MV 1 antibody - 3BNC1 l7-HC-Knob (SEQ ID NO: 6):
  • Amino acid sequence defining the MV1 derived light chain of the 128/MV 1 antibody - MV1- VLCH1 (SEQ ID NO:l):
  • Amino acid sequence defining the PGT128 derived light chain of the 128/MV 1 antibody - PGT128-LC (SEQ ID NO: 7):
  • Amino acid sequence defining the MV1 derived light chain of the 10E8/MV1 antibody - MV1- VLCH1 (SEQ ID NO: l):
  • Amino acid sequence defining the MV1 derived heavy chain of the 10E8/MV1 antibody - MV1- HC-Hole-Cross (SEQ ID NO:2):
  • Amino acid sequence defining the 10E8 derived light chain of the 10E8/MV1 antibody - 10E8-LC (SEQ ID NO: 9):
  • Amino acid sequence defining the 10E8 derived heavy chain of the 10E8/MV1 antibody - 10E8- HC-Knob (SEQ ID NO: 10):
  • Amino acid sequence defining the MV1 derived light chain of the D 10E8/MV 1 antibody MV1- VLCH1 (SEQ ID NO: l):
  • Amino acid sequence defining the MV1 derived heavy chain of the D 10E8/MV 1 antibody MV1- HC-Hole-Cross (SEQ ID NO:2):
  • Amino acid sequence defining the D 10E8 derived light chain of the AlOE8/MVl antibody D10E8- LC (SEQ ID NO:2l): YELTQETGVSVALGRTVTITCRGDSLRSHYASWYQKKPGQAPILLFYGKNNRPSGVPDRFSGASGNRASL TISGAQAEDDAEYYCSSRDKSGSRLSVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDF YPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT ECS
  • Amino acid sequence defining the MV1 derived light chain of the 151/MV1 antibody - MV1- VLCH1 (SEQ ID NO: 1):
  • Amino acid sequence defining the PGT151 derived light chain of the 151/MV1 antibody PGT151- LC (SEQ ID NO:23): DIVMTQTPLSLSVTPGQPASISCKSSESLRQSNGKTSLYWYRQKPGQSPQLLVFEVSNRFSGVSDRFVGS GSGTDFTLRISRVEAEDVGFYYCMQSKDFPLTFGGGTKVDLKRTVAAPSVFI FPPSDEQLKSGTASVVCL LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV TKSFNRGEC
  • Amino acid sequence defining the Pro 140 derived heavy chain of the 145/P 140 antibody - PRO 140-HC -Hole-Cross (SEQ ID NO: 12): EVQLVESGGGLVKPGGSLRLSCAASGYTFSNYWIGWVRQAPGKGLEWIGDIYPGGNYIRNNEKFKDKTTL SADTSKNTAYLQMNSLKTEDTAVYYCGSSFGSNYVFAWFTYWGQGTLVTVSSASTAAPSVFI FPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGECDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPASIEKTISKA
  • Amino acid sequence defining the PGT145 derived heavy chain of the 145/P 140 antibody - PGTl45-HC-Knob (SEQ ID NO:4): QVQLVQSGAEVKKPGSSVKVSCKASGNSFSNHDVHWVRQATGQGLEWMGWMSHEGDKTGLAQKFQGRVTI TRDSGASTVYMELRGLTADDTAIYYCLTGSKHRLRDYFLYNEYGPNYEEWGDYLATLDVWGHGTAVTVSS ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT VPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPASIE
  • 117/P 140 antibody Amino acid sequence defining the Pro 140 derived light chain of the 117/P 140 antibody - PRO 140- VLCH1 (SEQ ID NO: 11):
  • Amino acid sequence defining the 3BNC117 derived light chain of the 117/P140 antibody - 3BNC117-LC (SEQ ID NO: 5):
  • Amino acid sequence defining the 3BNC117 derived heavy chain of the 117/P140 antibody - 3BNC1 l7-HC-Knob (SEQ ID NO: 6):
  • Amino acid sequence defining the PGT128 derived light chain of the 128/P 140 antibody - PGT128-LC (SEQ ID NO: 7):
  • Amino acid sequence defining the 10E8 derived light chain of the 10E8/P140 antibody - 10E8-LC (SEQ ID NO: 9):
  • Amino acid sequence defining the 10E8 derived heavy chain of the 10E8/P140 antibody - 10E8- HC-Knob (SEQ ID NO: 10):
  • Amino acid sequence defining the D10E8 derived light chain of the D10E8/R140 antibody - Al0E8-LC (SEQ ID NO:2l): YELTQETGVSVALGRTVTITCRGDSLRSHYASWYQKKPGQAPILLFYGKNNRPSGVPDRFSGASGNRASL TISGAQAEDDAEYYCSSRDKSGSRLSVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDF YPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT ECS
  • Amino acid sequence defining the PGT151 derived light chain of the 151/P140 antibody - PGT151-LC (SEQ ID NO:23): DIVMTQTPLSLSVTPGQPASISCKSSESLRQSNGKTSLYWYRQKPGQSPQLLVFEVSNRFSGVSDRFVGS GSGTDFTLRISRVEAEDVGFYYCMQSKDFPLTFGGGTKVDLKRTVAAPSVFI FPPSDEQLKSGTASVVCL LNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPV TKSFNRGEC
  • Amino acid sequence defining the alpha-Her2 derived light chain of the lOE8/Alpha-Her2 antibody - antiHer2-VLCHl (SEQ ID NO: 13):
  • Amino acid sequence defining the alpha-Her2 derived heavy chain of the lOE8/Alpha-Her2 antibody - antiHer2-HC -Hole-Cross (SEQ ID NO: 14):
  • Amino acid sequence defining the 10E8 derived light chain of the lOE8/Alpha-Her2 antibody - 10E8-LC (SEQ ID NO: 9):
  • Amino acid sequence defining the 10E8 derived heavy chain of the lOE8/Alpha-Her2 antibody - l0E8-HC-Knob (SEQ ID NO: 10):
  • 4E10/P140 antibody Amino acid sequence defining the Pro 140 derived light chain of the 4E10/P140 antibody - PRO140-VLCH1 (SEQ ID NO: 11):
  • Amino acid sequence defining the 4E10 derived light chain of the 4E10/P140 antibody - 4E10-LC (SEQ ID NO: 17):
  • Amino acid sequence defining the 4E10 derived heavy chain of the 4E10/P140 antibody - PGTl45-HC-Knob (SEQ ID NO: 18):
  • 10E8/X19 antibody Amino acid sequence defining the X19 derived light chain of the 10E8/X19 antibody - X19- VLCH1 (SEQ ID NO: 19):
  • Amino acid sequence defining the 515H7 derived light chain of the 10E8/515H7 antibody - 515H7-VLCH1 (SEQ ID NO:25):
  • Amino acid sequence defining the 515H7 derived heavy chain of the 10E8/515H7 antibody - 515H7 -Hole-Cross (SEQ ID NO:26):
  • Amino acid sequence defining the 10E8 derived heavy chain of the 10E8/515H7 antibody - 10E8- HC-Knob (SEQ ID NO: 10):
  • Amino acid sequence defining the MV1 derived light chain of the l0E8vl.0/MVl antibody MV1- VLCH1 (SEQ ID NO: l):
  • Amino acid sequence defining the MV1 derived heavy chain of the l0E8vl.0/MVl antibody MV 1 -HC -Hole-Cross (SEQ ID NO:2): QVQLQQSGPEVVKPGASVKMSCKASGYTFTSYVIHWVRQKPGQGLDWIGYINPYNDGTDYDEKFKGKATL TSDTSTSTAYMELSSLRSEDTAVYYCAREKDNYATGAWFAYWGQGTLVTVSSASTAAPSVFI FPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGECDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS
  • Amino acid sequence defining the lOE8vl.O derived heavy chain of the l0E8vl.0/iMab antibody - 10E8v 1.0-HC-Knob (SEQ ID NO:30): EVRLVESGGGLVKPGGSLRLSCSASGFNFDDAWMTWVRQPPGKGLEWVGRISGPGEGWSVDYAESVKGRF TISRLNSINFLYLEMNNVRTEDTGYYFCARTGKHYDFWSGYPPGEEYFQDWGQGTLVIVSSASTKGPSVF PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
  • Amino acid sequence defining the MVl derived light chain of the l0E8vl. l/iMab antibody MV1- VLCH1 (SEQ ID NO: l):
  • Amino acid sequence defining the MV1 derived heavy chain of the l0E8vl.l/iMab antibody MV 1 -HC -Hole-Cross (SEQ ID NO:2): QVQLQQSGPEVVKPGASVKMSCKASGYTFTSYVIHWVRQKPGQGLDWIGYINPYNDGTDYDEKFKGKATL TSDTSTSTAYMELSSLRSEDTAVYYCAREKDNYATGAWFAYWGQGTLVTVSSASTAAPSVFI FPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGECDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK
  • Amino acid sequence defining the l0E8vl.l derived light chain of the l0E8vl. l/iMab antibody - l0E8vl.l-LC (SEQ ID NO:3 l):
  • PTECS Amino acid sequence defining the lOE8vl.l derived heavy chain of the lOE8vl. l/iMab antibody - l0E8vl.l HC-Knob (SEQ ID NO:32):
  • Amino acid sequence defining the MV1 derived light chain of the l0E8v2.0/iMab antibody MV1- VLCH1 (SEQ ID NO: 1):
  • Amino acid sequence defining the MV1 derived heavy chain of the l0E8v2.0/iMab antibody MV 1 -HC -Hole-Cross (SEQ ID NO:2):
  • Amino acid sequence defining the 10E8n2.0 derived heavy chain of the l0E8v2.0/iMab antibody - 10E8v2.0-HC-Knob (SEQ ID NO:34):
  • Amino acid sequence defining the MV1 derived light chain of the l0E8v3.0/iMab antibody MV1- VLCH1 (SEQ ID NO: 1):
  • Amino acid sequence defining the MV1 derived heavy chain of the l0E8v3.0/iMab antibody MV 1 -HC -Hole-Cross (SEQ ID NO:2): QVQLQQSGPEVVKPGASVKMSCKASGYTFTSYVIHWVRQKPGQGLDWIGYINPYNDGTDYDEKFKGKATL TSDTSTSTAYMELSSLRSEDTAVYYCAREKDNYATGAWFAYWGQGTLVTVSSASTAAPSVFI FPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGECDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK
  • Amino acid sequence defining the 10E8n3.0 derived light chain of the l0E8v3.0/iMab antibody - l0E8v3.0-LC (SEQ ID NO: 15):
  • KVEPKSC Amino acid sequence defining the PRO140 derived heavy chain of the 10E8V1.0/P140 antibody - PRO 140-Hole-Cross (SEQ ID NO: 12):
  • Amino acid sequence defining the l0E8vl.l derived light chain of the 10E8n1.1/R140 antibody - l0E8vl.l-LC (SEQ ID NO:3 l):
  • Amino acid sequence defining the 10E8n3.0 derived heavy chain of the 10E8n3.0/R140 antibody - 10E8n3.0 HC-Knob (SEQ ID NO: 16):
  • Amino acid sequence defining the MV1 derived light chain of the lOE8.2/iMab antibody MV1- VLCH1 (SEQ ID NO: 1)
  • Amino acid sequence defining the MV1 derived heavy chain of the lOE8.2/iMab antibody MV1- HC-Hole-Cross (SEQ ID NO: 2)
  • Amino acid sequence defining the MV1 derived light chain of the lOE8.2/iMab antibody MV1- VLCH1 (SEQ ID NO: 1)
  • Amino acid sequence defining the MV1 derived heavy chain of the lOE8.2/iMab antibody MV1- HC-Hole-Cross (SEQ ID NO: 2) QVQLQQSGPEVVKPGASVKMSCKASGYTFTSYVIHWVRQKPGQGLDWIGYINPYNDGTDYDEKFKGKATL TSDTSTSTAYMELSSLRSEDTAVYYCAREKDNYATGAWFAYWGQGTLVTVSSASTAAPSVFI FPPSDEQL KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGECDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDP EVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAS
  • Amino acid sequence defining the MV1 derived light chain of the lOE8.2/iMab antibody MV1- VLCH1 (SEQ ID NO: 1)
  • KVEPKSC Amino acid sequence defining the MV1 derived heavy chain of the lOE8.2/iMab antibody MV1- HC-Hole-Cross (SEQ ID NO: 2)
  • Amino acid sequence defining the MV1 derived light chain of the lOE8.2.4/iMab antibody MV1-VLCH1-LM52 (SEQ ID NO:38) DIVMTQSPDSLAVSLGERVTMNCKSSQSLLYSTNQKNYLAWYQQKPGQSPKLLIYWANSTESGVPDRFSG SGSGTDFTLTISSVQAEDVAVYYCQQYYSYRTFGGGTKLEIKSSASTKGPSVFPLAPSSKSTSGGTAALG CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDK KVEPKSC
  • Amino acid sequence defining the MV1 derived heavy chain of the lOE8.2/iMab antibody MV1- HC-Hole-Cross (SEQ ID NO: 2)
  • Amino acid sequence defining the MV1 derived light chain of the lOE8.2/iMab antibody MV1- VLCH1 (SEQ ID NO: 1)
  • Amino acid sequence defining the MV1 derived heavy chain of the lOE8.2/iMab antibody MV1- HC-Hole-Cross (SEQ ID NO: 2)
  • Amino acid sequence defining the MV1 derived light chain of the lOE8.2/iMab antibody MV1- VLCH1 (SEQ ID NO: 1)
  • Amino acid sequence defining the MV1 derived heavy chain of the lOE8.2/iMab antibody MV1- HC-Hole-Cross (SEQ ID NO: 2)
  • Amino acid sequence defining the 10E8.2.6 derived heavy chain of the lOE8.2.6/iMab antibody - lOE8.2.6-HC-Knob (SEQ ID NO:4l) EVRLVESGGGLVKPGGSLRLSCSASGFNFDDAWMTWVRQPPGKGLEWVGRISGPGEGWSVDYAESVKGRF TISRDNSINTLYLEMNNVRTEDTGYYFCARTGKHYDFWSGYPPGEEYFQDWGQGTKVIVSSASTKGPSVF PLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQ TYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPEFEGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAS
  • Amino acid sequence defining the MV1 derived light chain of the lOE8.2/iMab antibody MV1- VLCH1 (SEQ ID NO: 1)
  • Amino acid sequence defining the MV1 derived heavy chain of the lOE8.2/iMab antibody MV1- HC-Hole-Cross (SEQ ID NO: 2)
  • PTECS Amino acid sequence defining the 10E8.4 derived heavy chain of the lOE8.4/iMab antibody - lOE8.4-HC-Knob (SEQ ID NO:42)
  • Amino acid sequence defining the MV1 derived light chain of the lOE8.2/iMab antibody MV1- VLCH1 (SEQ ID NO: 1)
  • Amino acid sequence defining the MV1 derived heavy chain of the lOE8.2/iMab antibody MV1- HC-Hole-Cross (SEQ ID NO: 2)
  • Amino acid sequence defining the 10E8.2 derived light chain of the lOE8.2/iMab antibody - 10E8.2-LC (SEQ ID NO: 33) ASELTQDPAVSVALKQTVTITCRGDSLRSHYASWYQKKPGQAPILLFYGKNNRPSGVPDRFSGSASGNRA SLTISGAQAEDDAEYYCSSRDKSGSRLSVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLIS DFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVA PTECS
  • Amino acid sequence defining the MV1 derived light chain of the lOE8.2/iMab antibody MV1- VLCH1 (SEQ ID NO: 1)
  • Amino acid sequence defining the MV1 derived heavy chain of the lOE8.2/iMab antibody MV1- HC-Hole-Cross (SEQ ID NO: 2)
  • Amino acid sequence defining the MV1 derived light chain of the lOE8.2/iMab antibody MV1- VLCH1 (SEQ ID NO: 1)
  • Amino acid sequence defining the MV1 derived heavy chain of the lOE8.2/iMab antibody MV1- HC-Hole-Cross (SEQ ID NO: 2)
  • Amino acid sequence defining the 10E8.4 derived heavy chain of the lOE8.4/iMab antibody - lOE8.4-HC-Knob (SEQ ID NO:47)
  • At least one of the heavy chain and/or light chain sequences derived from the PGT145, PG9, PGT128, PGT121, 10-1074, 3BNC117, VRC01, PGT151, 4E10, 10E8, P140, iMab (or the MV1 variant), 515H7 antibodies and variants thereof are paired together to form a bispecific antibody (e.g ., a HIV CrossMab antibody).
  • a bispecific antibody e.g ., a HIV CrossMab antibody
  • at least one of the disclosed heavy and light chains selected from SEQ ID NOs: 1-36 are paired together to form a bispecific antibody (e.g., a HIV CrossMab antibody).
  • amino acid sequence of the bispecific antibody e.g. HIV
  • CrossMab antibody further includes an amino acid analog, an amino acid derivative, or other non-classical amino acids.
  • the bispecific antibody e.g ., HIV CrossMab antibody
  • the bispecific antibody comprises a sequence that is at least 60% identical to a wild-type heavy or light chain sequence of the PGT145, PG9, PGT128, PGT121, 10-1074, 3BNC117, VRC01, PGT151, 4E10, or 10E8 antibody.
  • the bispecific antibody e.g., HIV CrossMab antibody
  • the bispecific antibody (e.g, HIV CrossMab antibody) comprises a sequence that is at least 60% identical to any of the sequences disclosed herein.
  • the bispecific antibody (e.g, HIV CrossMab antibody) may comprise a sequence that is at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least
  • the bispecific antibody (e.g, HIV CrossMab antibody) may comprise a sequence that is at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least
  • the bispecific antibody (e.g ., HIV CrossMab antibody) may comprise a sequence that is at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 96%, at least about 9
  • Homology or identity may be determined in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software.
  • BLAST Basic Local Alignment Search Tool
  • analysis using the algorithm employed by the programs blastp, blastn, blastx, tblastn and tblastx (Karlin et al ., (1990) PROC. NATL. ACAD. SCI. USA 87, 2264-2268; Altschul, (1993) J. MOL. EVOL. 36, 290- 300; Altschul et al., (1997) NUCLEIC ACIDS RES. 25, 3389-3402, incorporated by reference) are tailored for sequence similarity searching.
  • the approach used by the BLAST program is to first consider similar segments between a query sequence and a database sequence, then to evaluate the statistical significance of all matches that are identified and finally to summarize only those matches which satisfy a preselected threshold of significance.
  • a threshold of significance For a discussion of basic issues in similarity searching of sequence databases see Altschul et al., (1994) NATURE GENETICS 6, 119- 129 which is fully incorporated by reference. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • the search parameters for histogram, descriptions, alignments, expect i.e., the statistical significance threshold for reporting matches against database sequences
  • cutoff, matrix and filter are at the default settings.
  • blastn The default scoring matrix used by blastp, blastx, tblastn, and tblastx is the BLOSUM62 matrix (Henikoff et al ., (1992) PROC. NATL. ACAD. SCI. USA 89, 10915-10919, fully incorporated by reference).
  • the bispecific antibody (e.g, HIV CrossMab antibody) comprises a sequence that includes at least one amino acid alteration with respect to a wild-type heavy or light chain sequence of the PGT145, PG9, PGT128, PGT121, 10-1074, 3BNC117, VRC01, PGT151, 4E10, or 10E8 antibody.
  • the bispecific antibody e.g, HIV crossMab antibody
  • CrossMab antibody comprises a sequence that includes at least one amino acid alteration with respect to a wild-type heavy or light chain sequence of the P140, iMab (or the MV1 variant), 515H7 antibody.
  • the bispecific antibody e.g, HIV CrossMab antibody
  • the bispecific antibody (e.g ., HIV CrossMab antibody) comprises a sequence that includes at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
  • the bispecific antibody (e.g, HIV CrossMab antibody) comprises a sequence that includes at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
  • the bispecific antibody (e.g., HIV CrossMab antibody) comprises a sequence that includes at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
  • the amino acid alteration can be an amino acid deletion, insertion, substitution, or modification. In one embodiment, the amino acid alteration is an amino acid deletion. In another embodiment, the amino acid alteration is an amino acid substitution.
  • the amino acid alteration may be in the Complementarity Determining Regions (CDRs) of the bispecific antibody (e.g, the CDR1, CDR2 or CDR3 regions).
  • the amino acid alteration may be in the framework regions (FWs) of the bispecific antibody (e.g ., the FW1, FW2, FW3, or FW4 regions).
  • the amino acid alteration may be in the joining regions (J regions) of the bispecific antibody (e.g., the Jl, J2, J3, J4, J5, J6, or J7 regions).
  • chimeric antibody derivatives of the bispecific antibodies i.e., antibody molecules in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity.
  • the bispecific antibody may include a heavy and/or light chain in which one or more CDRs or FWs derived from an antibody selected from a PGT145, PG9, PGT128, PGT121, 10-1074, 3BNC117, VRC01, PGT151, 4E10, 10E8, P140, iMab (or the MV1 variant), or 515H7 antibody are replaced with one or more CDRs or FWs derived from a different antibody selected from a PGT145, PG9, PGT128, PGT121, 10-1074, 3BNC117, VRC01, PGT151, 4E10, 10E8, P140, iMab (or the MVl variant), or 515H7 antibody.
  • the present invention provides improved bispecific antibodies that demonstrate advantageous properties related to solubility, stability, and therapeutic activity. It is contemplated that such antibodies may be particularly suited for large-scale commercial production. For example, such antibodies may exhibit increased solubility, reduced aggregation, reduced precipitation, and/or enhanced stability or resistance to degradation during
  • the improved bispecific antibody is a variant of the
  • the variant may exhibit enhanced solubility, stability, and/or therapeutic activity (e.g., antiviral activity) compared to the parent !0E8V2.0/iMab antibody.
  • the bispecific antibody (e.g., HIV CrossMab antibody) may comprise a sequence that is at least about 60%, at least about 61%, at least about 62%, at least about 63%, at least about 64%, at least about 65%, at least about 66%, at least about 67%, at least about 68%, at least about 69%, at least about 70%, at least about 71%, at least about 72%, at least about 73%, at least about 74%, at least about 75%, at least about 76%, at least about 77%, at least about 78%, at least about 79%, at least about 80%, at least about 81%, at least about 82%, at least about 83%, at least about 84%, at least about 85%, at least about 86%, at least about 87%, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97%, at least about 97%
  • the bispecific antibody (e.g ., HIV CrossMab antibody) may comprise a sequence that includes at least about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19,
  • the bispecific antibody may comprise one or more amino acid alterations in the Complementarity Determining Regions (CDRs) of the l0E8V2.0/iMab antibody (e.g, the CDR1, CDR2 or CDR3 regions).
  • the bispecific antibody may comprise one or more amino acid alterations in the framework regions (FWs) of the bispecific antibody (e.g, the FW1, FW2, FW3, or FW4 regions).
  • the amino acid alterations may be in the joining regions (J regions) of the l0E8V2.0/iMab antibody (e.g, the Jl, J2, J3, J4, J5, J6, or J7 regions).
  • the bispecific antibody comprises a variant heavy chain derived from 10E8V2.0 (i.e., SEQ ID NO:34).
  • the bispecific antibody may include one or more mutations at positions selected from L72, 175, F77, L89, Y98, FlOOa, WlOOb, YlOOe, PlOOf, PlOOg, L108, and/or L170 of the heavy chain (the mutation positions on SEQ ID NO: 34 are determined by the Kabat numbering system).
  • the bispecific antibody may include one or more mutations at positions selected from L72, 175, F77, and/or L108.
  • the bispecific antibody may include the one or more mutations selected from L72K, I75K, F77T, and L108K.
  • the bispecific antibody comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 47.
  • the bispecific antibody comprises a variant light chain derived from 10E8V2.0 (i.e., SEQ ID NO:33).
  • the bispecific antibody may include one or more mutations at positions selected from L15, P40, 145, and Pl 12 of the light chain (the mutation positions on SEQ ID NO: 33 are determined by the Kabat numbering system).
  • the bispecific antibody may include one or more mutations at positions selected from P40 and 145.
  • the bispecific antibody may include one or more mutations selected from P40T and I45K.
  • the bispecific antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 46.
  • the bispecific antibody comprises a variant light chain derived from MV1 (i.e., SEQ ID NO: 1).
  • the bispecific antibody may include mutations at positions 52-54 (the mutation position on SEQ ID NO: 1 is determined by the Kabat numbering system).
  • the bispecific antibody may include amino acid mutations at positions 52-54.
  • the amino acid at position 52 is mutated to Asn (N)
  • the amino acid at position 53 is mutated to Ser (S)
  • the amino acid at position 54 is mutated to Thr (T).
  • the Asn mutation at position 52 is N-linked glycosylated.
  • the bispecific antibody comprises a light chain comprising the amino acid sequence of SEQ ID NO: 38.
  • the bispecific antibody comprises a heavy and light chain derived from 10E8 comprising the amino acid sequence of SEQ ID NO: 47 and SEQ ID NO:46, respectively.
  • the bispecific antibody further comprises a heavy and light chain derived from MV1 comprising the amino acid sequence of SEQ ID NO: 1 and SEQ ID NO:2, respectively.
  • Modification of the amino acid sequence of recombinant binding protein is achieved using any known technique in the art e.g ., site-directed mutagenesis or PCR based mutagenesis. Such techniques are described, for example, in Sambrook et al.
  • Synthetic DNA molecules can be ligated to other appropriate nucleotide sequences, including, e.g, expression control sequences, to produce conventional gene expression constructs encoding the desired antibodies. Production of defined gene constructs is within routine skill in the art. Alternatively, the sequences provided herein can be cloned out of hybridomas by conventional hybridization techniques or polymerase chain reaction (PCR) techniques, using synthetic nucleic acid probes whose sequences are based on sequence information provided herein, or prior art sequence information regarding genes encoding the heavy and light chains. Nucleic acids encoding desired antibodies can be incorporated (ligated) into expression vectors, which can be introduced into host cells through conventional transfection or transformation techniques. Exemplary host cells are E.
  • Transformed host cells can be grown under conditions that permit the host cells to express the genes that encode the immunoglobulin light and/or heavy chain variable regions. Specific expression and purification conditions will vary depending upon the expression system employed.
  • the bispecific antibodies of the present invention are used in therapy.
  • the bispecific antibody e.g., HIV CrossMab antibody
  • the bispecific antibody can be used to neutralize HIV in a mammal (e.g., a human patient).
  • antibodies of the invention can bind to HIV so as to partially or completely inhibit one or more biological activities of the virus.
  • the bispecific antibody e.g, HIV CrossMab antibody
  • the bispecific antibody neutralizes a X4-tropic HIV.
  • the bispecific antibody (e.g, HIV CrossMab antibody) neutralizes a R5X4 dual -tropic HIV.
  • use of the antibody to neutralize HIV in a mammal comprises administering to the mammal a therapeutically effective amount of the antibody.
  • a therapeutically effective amount of active component is in the range of, for example, about 0.1 mg/kg to about 100 mg/kg, e.g., about 1 mg/kg to about 100 mg/kg, e.g., about 1 mg/kg to about 10 mg/kg of the body weight of the patient.
  • a therapeutically effective amount of active component is in a range of about 0.01 mg/kg to about 30 mg/kg of the body weight of the patient, for example, about 0.01 mg/kg, about 0.02 mg/kg, about 0.03 mg/kg, about 0.04 mg/kg, about 0.05 mg/kg, about 0.06 mg/kg, about 0.07 mg/kg, about 0.08 mg/kg, about 0.09 mg/kg, about 0.1 mg/kg, about 0.2 mg/kg, about 0.3 mg/kg, about 0.4 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, about 0.7 mg/kg, about 0.8 mg/kg, about 0.9 mg/kg, about 1 mg/kg, about 1.1 mg/kg, about 1.2 mg/kg, about 1.3 mg/kg, about 1.4 mg/kg, about 1.5 mg/kg, about 1.6 mg/kg, about 1.7 mg/kg, about 1.8 mg/kg, 1.9 mg/kg, about 2 mg/kg, about 3 mg/kg, about 4 mg/kg, about
  • the therapeutically effective amount of active component is any value between about 1 to 10 mg/kg, between about 10 to 20 mg/kg, between about 20 to 30 mg/kg, between about 30 to 40 mg/kg, between about 40 to 50 mg/kg, between about 50 to 60 mg/kg, between about 60 to 70 mg/kg, between about 70 to 80 mg/kg, between about 80 to 90 mg/kg, or between about 90 to 100 mg/kg.
  • the therapeutically effective amount of active component is about 1 mg/kg, about 2 mg/kg, about 3 mg/kg, about 6 mg/kg, about 10 mg/kg, about 20 mg/kg, about 30 mg/kg, or about 60 mg/kg delivered intravenously (IV).
  • the therapeutically effective amount of active component is about 2.5 mg/kg, about 5 mg/kg, about 10 mg/kg, or about 20 mg/kg delivered subcutaneously (s.c.) or intramuscularly (i.m).
  • the amount administered will depend on variables such as the type and extent of disease or indication to be treated, the overall health of the patient, the in vivo potency of the antibody, the pharmaceutical formulation, and the route of administration.
  • the initial dosage can be increased beyond the upper level in order to rapidly achieve the desired blood-level or tissue level.
  • the initial dosage can be smaller than the optimum, and the dosage may be progressively increased during the course of treatment.
  • Human dosage can be optimized, e.g ., in a conventional Phase I dose escalation study designed to run from, for example, 0.5 mg/kg to 20 mg/kg.
  • Dosing frequency can vary, depending on factors such as route of administration, dosage amount and the disease being treated. Exemplary dosing frequencies are more than once daily, about once per day, about twice a day, about three times a day, about four times a day, about five times a day, about every other day, about every third day, about once a week, about once every two weeks, about once every month, about once every two months, about once every three months, about once every six months, or about once every year.
  • the antibodies of the invention may be administered for a prolonged period.
  • the antibodies may be administered for at least about 1 week, at least about 4 weeks, about 8 weeks, or at least about 12 weeks.
  • the regimen is for at least about 1 month, at least about 6 months, at least about 12 months, at least about 1 year, at least about 2 years, at least about 3 years, at least about 4 years, at least about 5 years, at least about 6 years, at least about 7 years, at least about 8 years, at least about 9 years, at least about 10 years, at least about 15 years, at least about 20 years, at least about 30 years, at least about 40 years, or at least about 50 years.
  • an antibody may be combined with a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier means buffers, carriers, and excipients suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • the carrier(s) should be“acceptable” in the sense of being compatible with the other ingredients of the formulations and not deleterious to the recipient.
  • Pharmaceutically acceptable carriers include buffers, solvents, dispersion media, coatings, isotonic and absorption delaying agents, and the like, that are compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is known in the art.
  • compositions containing antibodies can be presented in a dosage unit form and can be prepared by any suitable method.
  • a pharmaceutical composition should be formulated to be compatible with its intended route of administration. Examples of routes of administration are intravenous (IV), intradermal, inhalation, transdermal, topical, transmucosal, and rectal administration.
  • routes of administration for antibodies of the invention is IV infusion.
  • Useful formulations can be prepared by methods well known in the pharmaceutical art. For example, see Remington's Pharmaceutical Sciences ,
  • compositions for oral delivery can be in the form of tablets, lozenges, aqueous or oily suspensions, granules, powders, sprinkles, emulsions, capsules, syrups, or elixirs, for example.
  • Orally administered compositions can comprise one or more agents, for example, sweetening agents such as fructose, aspartame or saccharin; flavoring agents such as peppermint, oil of wintergreen, or cherry; coloring agents; and preserving agents, to provide a
  • the pharmaceutical compositions are formulated as a composition adapted for parenteral administration.
  • Dosage forms suitable for parenteral administration e.g .
  • intravenous, subcutaneous, intramuscular, or intraperitoneal injection and infusion include, for example, solutions, suspensions, dispersions, emulsions, and the like. They may also be manufactured in the form of sterile solid compositions (e.g. lyophilized composition), which can be dissolved or suspended in sterile injectable medium immediately before use. They may contain, for example, suspending or dispersing agents. In some embodiments, the compositions may additionally include pharmaceutically acceptable excipients or carriers.
  • excipients include sodium citrate, dicalcium phosphate, etc., and/or a) fillers or extenders such as starches, lactose, sucrose, glucose, mannitol, silicic acid, microcrystalline cellulose, and Bakers Special Sugar, etc., b) binders such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinylpyrrolidone, sucrose, acacia, polyvinyl alcohol, polyvinylpolypyrrolidone, methylcellulose, hydroxypropyl cellulose (HPC), and hydroxymethyl cellulose etc., c) humectants such as glycerol, etc., d) disintegrating agents such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, sodium carbonate, cross-linked polymers such as crospovidone (cross-linked polyvinylpyrrolidone), croscarmellose sodium (cross-
  • compositions preferably are sterile. Sterilization can be accomplished, for example, by filtration through sterile filtration membranes. Where the composition is lyophilized, filter sterilization can be conducted prior to or following lyophilization and reconstitution.
  • Figures [[13]] 13A-E and Figures 14A-E [[14]] demonstrate that some iMab-based CrossMabs have greater potency and breadth than parental Abs. Except otherwise stated, all iMab-based bispecific antibodies were constructed using the MV1 variant.
  • IC80 the antibody concentration that confers 80% neutralization of viral infectivity
  • IC50 the antibody concentration that confers 50% neutralization of viral infectivity
  • IC50 the antibody concentration that confers 50% neutralization of viral infectivity
  • the lower the IC50 number the more potent the antibody is at neutralizing a particular HIV strain or isolate.
  • FIGS. 13E and 14E clearly demonstrate that, as compared to the parental antibodies iMab and 10E8, the bispecific CrossMab of the two together (l0E8/iMab) neutralizes almost all HIV viruses (each virus is indicated as a dot) more potently.
  • the other antibody sets (used to make l45/iMab, 1 l7/iMab, l28/iMab and l5l/iMab) sometimes enhance HIV potency compared to their parental components and sometimes do not.
  • the antibody iMab is also relatively potent in cell-cell neutralizing assays.
  • PGT145, 3BNC117, 10E8, PGT128 and PGT151 are relatively potent at neutralizing cell-free viral infection, but are poor in neutralizing viruses in cell-cell transmission assays.
  • Creating bispecific antibodies including PGT145, 3BNC117, 10E8, PGT128 and PGT151 with iMab makes these chimeric antibodies active at neutralizing viruses in a cell-cell transmission assay. It can be seen that l0E8/iMab is the most potent antibody in these comparative studies. It is also found that l0E8/iMab is most active in preventing cell-cell transmission in vitro.
  • Figure 3 shows that improved potency requires covalent linkage of the antibody, i.e., the
  • 11 A-E, 12A-E, 13 A-E, and 14A-E provide further evidence of the improved potency of iMab- derived CrossMab antibodies over its parental antibodies.
  • l0E8/iMab appears to exhibit pre- and post-attachment neutralization; l45/iMab, l5l/iMab and 1 l7/iMab appear to exhibit pre-attachment neutralization; and 1 l7/iMab may show signs of steric restriction and potentially reduced potency for some viruses. l0E8/iMab also exhibits potent activity against HIV cell-to-cell transmission.
  • Pro l40-based CrossMab activities are sometimes weaker than their parental antibodies and corresponding iMab-based CrossMabs, as shown by the high concentrations required to reach IC80 and IC50.
  • Anchoring of these four mAbs to the host cell receptor CCR5 via another host cell receptor-binding antibody called Pro 140 does not improve the antiviral potency or breadth (as measured by IC80 against a large panel of HIV isolates) compared to their respective parental antibodies.
  • Pro 140 indicates that Prol40- based CrossMabs for these four antibodies are weaker than their corresponding iMab-based CrossMabs (IC50 and IC80 comparisons of Prol40-based vs. iMab-based CrossMabs).
  • 10E8/P140 a fifth Pro l40-based CrossMab, is more potent than its parental antibodies and l0E8/iMab CrossMab.
  • These panels illustrate a comparison of the potency (IC80 or IC50) of parental mAb Prol40 (right-most column of data points in Figures 13E and 14E), bispecific CrossMab 10E8/P140 (second from right column of data points in Figures 13E and 14E), and parental mAb 10E8 (center column of data points in Figures 13E and 14E) against a large panel of HIV isolates.
  • Pro 140 is known to not have activity against X4 HIV viruses, as X4 viruses use CXCR4 as a co- receptor for HIV-l entry, and Pro 140 binds to CCR5. 10E8 alone has very weak activity against X4 viruses. However, the bispecific CrossMab l0E8/Pro 140 can neutralize all X4 viruses tested to date better than either of the parent antibodies.
  • Figures 4A-J illustrate the effectiveness of 10E8, Pro 140, and 10E8/P140 bispecific CrossMab antibody in inhibition of various strains of HIV.
  • l0E8/Prol40 CrossMab is a more potent inhibitor of various strains of HIV than the co-administration of the two parental antibodies, demonstrating a synergistic, not merely additive, enhancement of potency with this particular bispecific antibody.
  • a CrossMab of 10E8 fused to a non-membrane bound antibody (XI 9) does not provide enhanced potency, as can be seen when compared to membrane bound 10E8/P140.
  • the potency of the 10E8/P140 CrossMab appears to require anchoring of 10E8 to the cell membrane.
  • membrane binding alone does not afford the enhanced potency of these CrossMabs.
  • Figures 7A-H show that anchoring 10E8 on HER2 does not provide substantial potency enhancement as compared to anchoring 10E8 on CCR5.
  • Anchoring of 10E8 to a viral receptor specifically specifically (in this case CCR5 via Pro 140 or CD4 via iMab) provides enhanced antiviral activity.
  • D10E8 is a mutant version of the 10E8 mAh that has a one amino acid deletion in the light chain FR3. Compared to 10E8, D10E8 has a much weaker epitope binding activity, as illustrated in Figures 8A-C. However, once the D10E8 was anchored on a cell receptor (by combining D10E8 and iMab in a CrossMab antibody - iMab specifically binds cell receptor CD4), Figures 8D-E, show that its inhibition activity is improved. These data suggest the contribution of specific cell receptor anchoring, i.e., anchoring on a viral receptor or a viral co-receptor, in enhancing the activity of this HIV antibody.
  • specific cell receptor anchoring i.e., anchoring on a viral receptor or a viral co-receptor
  • D10E8/R140 CrossMab has improved antiviral activity over D10E8, it is still not as potent as 10E8/P140 CrossMab.
  • D10E8/R140 CrossMab is comparatively more effective in neutralizing R5 viruses than it is in neutralizing X4 viruses.
  • 4E10 is an anti-gp4l MPER mAh known to be less potent than the anti-gp4l MPER mAh 10E8.
  • FIGS. 20 and 21 A-G show that anchoring 4E10 on co-receptor CCR5 (via Pro 140 in a CrossMab antibody) enhanced antiviral activity of 4E10 significantly.
  • the l0E8/Prol40 CrossMab represents an effective combination in terms of overcoming energetic, spatial and temporal constraints, targeting sequential/interdependent steps in the entry process, epitope location/accessibility, binding affinity, pre-and post-attachment neutralization, and binding geometry.
  • 4El0/Prol40 has a greater binding affinity for MPER than D10E8/RGO140 and !0E8/Prol40.
  • Figures 9A-G show the inhibition potency of 10E8/RI ⁇ 140, D10E8/RGO140 and 4El0/Prol40, and their parental antibodies 10E8, D10E8 and 4E10 against various strains of HIV.
  • Figures 10, 13A-E, 14A-E, 15A-E, 16, and 17A-B provide additional evidence of the greater potency of CrossMab antibodies as compared to their parental antibodies individually and the parental antibodies in combination.
  • FIG. 10 The enhanced antiviral coverage of l0E8/iMab and l0E8/Prol40 CrossMabs is illustrated in Figure 10, which depict the potency and breadth of several antibodies against HIV.
  • the x-axis indicates the concentration of a particular antibody
  • the y-axis indicates the percent of a large panel of HIV viral isolates neutralized by a particular antibody at a specific concentration
  • each line indicates a different antibody evaluated.
  • the left-most lines along the x-axis and those that can closely approach or reach 100% on the y-axis indicate a highly potent and broad antibody against HIV.
  • 10E8/P140 CrossMab and l0E8/iMab CrossMab are among the most effective antibodies with respect to both viral coverage and potency, and are significantly more effective than their parental antibodies.
  • Figures 18A-H and 19A-C show the potency of the CrossMab 10E8/515H7 antibody as compared to its parental antibodies and previously discussed antibodies.
  • the potency of a CrossMab antibody does not appear to correlate directly with the density of cell membrane protein targets, as the density of CCR5 (the target of Prol40) is less than that of CD4 (the target of ibalizumab), yet the potency of l0E8/Prol40-derived CrossMab antibody is greater than that of l0E8/iMab-derived CrossMab antibody.
  • CDRs Regions
  • FWs framework regions
  • H6L10 of 10E8 antibody was found to be active, non-autoreactive, and stable by size exclusion chromatography, as shown in Figure 27.
  • H6LlO/Pro 140 and its parental antibodies were found to have comparable pharmacokinetics profiles in mice, as shown in Figure 28.
  • the H6L10 variant of 10E8 (referred to as l0E8 v I.O) combined with P140 in a bispecific antibody is substantially less potent than 10E8/P140 when tested against a large panel of HIV strains.
  • the H6L10 variant of 10E8 (referred to as 10E8 n i. o) combined with iMab in a bispecific antibody retains the same relative amount of potency as compared to l0E8/iMab when tested against a large panel of HIV strains, but l0E8 v i.o/iMab possesses the same instability as l0E8/iMab as determined by size exclusion chromatography and indicated by an X in Table 3.
  • the H6L10 variant may further include a S74W mutation.
  • Table 3 lists exemplary variants, their activities, size exclusion chromatography results, and pharmacokinetics (“PK”) results (see also Figure 46).
  • Table 3 Exemplary variants that are stable while retaining anti -HIV activity
  • H6L10 has a single peak by SEC but reduced activity compared to 10E8.
  • H6L10/Pro 140 CrossMab has single SEC peak and good mouse PK, but reduced anti -HIV activity.
  • H6LlO/iMab CrossMab has double SEC peaks and poor mouse PK, but its activity against HIV is roughly the same as l0E8/iMab.
  • l0E8vi.i includes a single point mutation in H6L10. When paired with Prol40 in a CrossMab bispecific, this construct has single SEC peak and good mouse PK. Its activity against HIV is improved as compared to l0E8Vl .0/Prol40, but still slightly less than that of
  • l0E8/Prol40 When paired with iMab in a CrossMab bispecific, this construct has double SEC peaks and poor mouse PK, and its activity against HIV is still roughly the same as l0E8/iMab and l0E8Vl.0/iMab.
  • lOE8v2.o is a chimeric antibody variant of 10E8 in which the FW1, CDR1 and part of FW2 are from lOE8vi . o and in which the remaining part of FW2, CDR2, FW3, CDR3 and FW4 are from 10E8.
  • this construct When paired with Prol40 in a CrossMab bispecific, this construct has double SEC peaks and has reduced activity against HIV as compared to l0E8/Prol40.
  • this construct When paired with iMab in a CrossMab bispecific, this construct has a single SEC peak, good PK, and activity against HIV that is improved over l0E8/iMab.
  • lOE8v3.o is a somatic variant of 10E8 known as Hl 1L1.
  • Hl lLl/Prol40 CrossMab has a single SEC peak and better anti-HIV activity than any other l0E8/Prol40 construct (including the original one identified), but has poor mouse PK due to autoreactivity.
  • Hl lLl/iMab CrossMab has a single SEC peak and anti-HIV activity that is better than the original l0E8/iMab identified and roughly equivalent activity to that observed for !0E8V2.0/iMab, but has poor mouse PK due to autoreactivity.
  • the variant of 10E8 that produced a single SEC peak in the context of a particular CrossMab bispecific was different when paired with Prol40 or iMab. It appears that the stability of the 10E8 arm of these CrossMab bispecific antibodies is context dependent and will vary depending of what antibody it is paired with.
  • one variant (l0E8vn) was identified that was stable by SEC and with good mouse PK and good anti-HIV activity when paired with Prol40.
  • Another variant (lOE8v2.o) was also identified that was stable by SEC with good mouse PK and with better anti -HIV activity than the originally identified l0E8/iMab.
  • Figure 30 depicts the pharmacokinetics of 10E8 and CrossMab antibodies derived from several 10E8 variants and iMab or P140 in a mouse model. As shown in Figures [[31]] 31 A-D and 32A- B [[32]], 10E8n ⁇ . i/R140 and lOE8 V2. o/iMab improve anti-HIV activity and stability, and have good stability when stored in PBS at 4°C.
  • Figure 33 depicts a native mass spectroscopy analysis of lOE8v2.o/iMab (N297A).
  • Figures 34A-C compare the activity of 10E8 n i.i/R140 and lOE8v2.o/iMab on a HIV Clade C panel, and compares their IC50 and IC80 efficacy.
  • Figures 35 and 36 compare the potency of 10E8 n i.i/R140, lOE8 V2. o/iMab, and various monoclonal antibodies against HIV.
  • hydrophobic residues were identified on the surface of the lOE8.2/iMab antibody (also referred to as the lOE8 V2. o/iMab antibody) which may negatively affect solubility and stability of the bispecific antibody.
  • the hydrophobic residues are presented in Table 5 below (with reference to the Kabat numbering system):
  • hydrophobic residues were mutated either alone or in combination to yield lOE8.2/iMab variants that were assessed for their functional activity against HIV and in vivo pharmacokinetic profiles (see Figures 37A-B).
  • the amino acid sequences of the various lOE8.2/iMab variants are provided elsewhere herein.
  • l/iMab, lOE8.2.2/iMab, and lOE8.2.3/iMab antibodies retained functional activity in the in vitro HIV-l neutralization assay as compared to the parental lOE8.2/iMab antibody.
  • BALB/c mice were divided into groups of three, and mice in each group were administered intraperitoneally with 100 pg of the indicated antibody. Blood was drawn from all animals at Days 1, 2, 4, 7 and 10 post antibody administration, and serum was isolated and analyzed for levels of antibody in individual mice. CoStar 96-Well EIA/RIA plates were coated with 100 ng per well of goat anti-human IgG Fc-g fragment overnight at 4°C.
  • lOE8.2/iMab variants e.g., lOE8.2. l/iMab, lOE8.2.2/iMab, and lOE8.2.3/iMab antibodies
  • lOE8.2/iMab variants e.g., lOE8.2. l/iMab, lOE8.2.2/iMab, and lOE8.2.3/iMab antibodies
  • the precipitation profiles of the variants were evaluated under thermal stress- inducing conditions. Specifically, lOE8.2/iMab variants were expressed in 293 cells, purified using a Protein A column, exchanged into a solution of PBS (pH 7.4), and concentrated to >30 mg/mL using a membrane with a nominal molecular weight limit of 50 kDa. Samples were then incubated at 50°C and assessed visually for precipitation at the indicated time points. Results from the thermal stress analysis are shown in Figure 37C.
  • lO/iMab exhibited the least aggregation, as indicated by a decreased peak size between 7 mL and 11 mL in Figure 38B.
  • the lOE8.4/iMab variant was advanced into additional solubility and stability studies. This variant comprises a combination of 6 hydrophobic to hydrophilic residue mutations as compared to the parental lOE8.2/iMab antibody.
  • Figures 45A-B provide a sequence alignment of the parental lOE8.2/iMab antibody and the lOE8.4/iMab variant.
  • the solubility of the lOE8.4/iMab antibody at 4°C was determined.
  • the lOE8.2/iMab and lOE8.4/iMab antibodies were each buffer exchanged into target buffers and were concentrated via ultracentrifugation at 3000-5000g, 4°C. Protein concentrations at different time points were determined by absorbance at 280nm using a
  • NanoDrop 2000 spectrophotometer All measurements were repeated twice with 2.5 pL sample each time and an average was taken, and then protein concentration was plotted versus time. The maximum protein concentration achieved was determined as the solubility of the protein. As shown in Figures 39A-B, at concentrations above 50mg/mL, the lOE8.4/iMab antibody showed consistently higher protein concentrations and solubility as compared to the lOE8.2/iMab antibody in buffers 1 (acetate buffer, pH 4.5) and 2 (histidine buffer, pH 5.5). The turbidity characteristics of the lOE8.4/iMab antibody were also analyzed.
  • the lOE8.2/iMab and lOE8.4/iMab antibodies were each buffer exchanged into target buffers and were concentrated via ultracentrifugation at 3000-5000g, 4°C. Absorbance at 280 nm and 350 nm were measured over time using a NanoDrop 2000 spectrophotometer. All measurements were repeated twice with 2.5 pL sample each time and an average was taken, and protein concentration (A280) was plotted versus turbidity (A350) for similar timepoints during the ultracentrifugation process. As shown in Figure 40, the turbidity of both lOE8.2/iMab and lOE8.4/iMab antibodies increased with protein concentration over time. In particular, the lOE8.2/iMab antibody showed higher turbidity than lOE8.4/iMab at the same protein
  • thermostability profile of the lOE8.4/iMab antibody was compared against the parental lOE8.2/iMab antibody using differential scanning calorimetry (DSC).
  • DSC differential scanning calorimetry
  • each bispecific antibody was buffer exchanged into identical buffer compositions using ultra- filtration centrifugal devices under the condition of 4°C and 3000-5000g. The protein concentrations were then adjusted to -10 mg/mL and aseptically filtered with 0.22-pm filter. Samples were then diluted to 1 mg/mL with reference buffers. Reference buffers (400 pL) were added into the odd-numbered wells of a 96-well plate and 400 pL of samples were added into the even-numbered wells of the same plate.
  • thermograms were scanned from 20 °C to 90 °C with a rate of 200 °C/hr. Analysis of thermograms was performed with MicroCal VP-Capillary DSC Automated data analysis software. As shown in Figure 41, both lOE8.2/iMab and lOE8.4/iMab antibodies exhibited similar thermostability when evaluated by DSC.
  • Figure 42 shows the results from a turbidity analysis after forced degradation of the lOE8.2/iMab and lOE8.4/iMab antibodies.
  • the lOE8.2/iMab and lOE8.4/iMab antibodies were each buffer exchanged into identical buffer compositions using ultra-filtration centrifugal devices under the condition of 4°C and 3000-5000g. The protein concentrations were then adjusted to -10 mg/mL and aseptically filtered with 0.22-pm filter.
  • Molecule purity after forced degradation of the lOE8.2/iMab and lOE8.4/iMab antibodies was also assessed.
  • the lOE8.2/iMab and lOE8.4/iMab antibodies were each buffer exchanged into two buffer compositions using ultra-filtration centrifugal devices under the condition of 4°C and 3000-5000g.
  • the protein concentrations were then adjusted to -10 mg/mL and aseptically filtered with 0.22-pm filter. Samples were then incubated at 50 °C to induce forced degradation, and the percentage of molecule purity by SDS-Gel Capillary Electrophoresis in non-reducing conditions was determined at 0 days, 3 days and 6 days after incubation began.
  • a denaturing solution was prepared by mixing sample buffer, 10% SDS and 100 mM N-Ethylmaleimide at 20: 1 :0.7 volume ratio. Two microliters of samples and 7pL denaturing solution were mixed well, incubated at 70 °C for 10 mins and spun down.
  • lOE8.2/iMab and lOE8.4/iMab antibodies were each buffer exchanged into two buffer compositions using ultra-filtration centrifugal devices under the condition of 4°C and 3000-5000g.
  • the protein concentrations were then adjusted to -10 mg/mL and aseptically filtered with 0.22-pm filter. Samples were then incubated at 50 °C to induce forced degradation, and the high molecular weight (HMW) fraction in each protein sample was determined by SE-HPLC (size exclusion chromatography) as a measurement of aggregation.
  • HMW high molecular weight
  • Size exclusion chromatography was performed using an Agilent 1260 Infinity system and a TSKGel G3000SWXL column (300x7.8 mm, 5pm).
  • the mobile phase was 50mM PB, 300 mM NaCl, pH 7.0 ⁇ 0.2 and the flow rate was set as 1.0 mL/min.
  • lOE8.4/iMab antibodies were compared in vitro.
  • virus neutralization was assessed with a single cycle assay using TZM-bl cells and 118 HIV-l tier-2 HIV-l Env pseudoviruses representing diverse clades and origins as described previously (Seaman et al. 2010. J. Virol. 84, 1439-1452).
  • Results indicate that, in addition to its improvement in solubility, decrease in turbidity and improvement in biophysical properties under thermal stress inducing conditions, the lOE8.4/iMab antibody also exhibited an approximately 2.5-fold enhancement in
  • the functional activities of the lOE8.2/iMab and lOE8.4/iMab antibodies were also compared in vivo.
  • Immunodeficient NSG mice (NOD . Cg-Prkdc cul II2rg u ' l,jl l Sz J ) were reconstituted with human hematopoietic stem cells and infected with Tier-2 clade B HIV- l JR-CSK four weeks prior to the initiation of antibody treatment. Mice were then treated weekly with modified variants of lOE8.2/iMab or lOE8.4/iMab that allowed for their evaluation in humanized mice.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Virology (AREA)
  • Biophysics (AREA)
  • Oncology (AREA)
  • AIDS & HIV (AREA)
  • Communicable Diseases (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Hematology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

L'invention concerne de manière générale divers modes de réalisation selon lesquels des anticorps bispécifiques sont utilisés dans la prévention et le traitement du VIH.
PCT/US2018/066643 2013-12-02 2018-12-20 Anticorps bispécifiques neutralisants hiv-1 WO2019135921A1 (fr)

Priority Applications (6)

Application Number Priority Date Filing Date Title
AU2018399587A AU2018399587A1 (en) 2017-12-21 2018-12-20 Bispecific HIV-1-neutralizing antibodies
EP18898849.7A EP3728311A4 (fr) 2017-12-21 2018-12-20 Anticorps bispécifiques neutralisants hiv-1
US16/770,840 US12098187B2 (en) 2013-12-02 2018-12-20 Bispecific HIV-1-neutralizing antibodies
CN201880089788.4A CN111819196B (zh) 2017-12-21 2018-12-20 双特异性hiv-1中和抗体
JP2020535114A JP7345861B2 (ja) 2017-12-21 2018-12-20 二重特異性ｈｉｖ－１中和抗体
CA3085351A CA3085351A1 (fr) 2017-12-21 2018-12-20 Anticorps bispecifiques neutralisants hiv-1

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US15/850,832 US10308707B2 (en) 2013-12-02 2017-12-21 Bispecific HIV-1-neutralizing antibodies
US15/850,832 2017-12-21

Publications (1)

Publication Number Publication Date
WO2019135921A1 true WO2019135921A1 (fr) 2019-07-11

Family

ID=67143961

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/066643 WO2019135921A1 (fr) 2013-12-02 2018-12-20 Anticorps bispécifiques neutralisants hiv-1

Country Status (7)

Country Link
EP (1) EP3728311A4 (fr)
JP (1) JP7345861B2 (fr)
CN (1) CN111819196B (fr)
AU (1) AU2018399587A1 (fr)
CA (1) CA3085351A1 (fr)
TW (1) TWI745643B (fr)
WO (1) WO2019135921A1 (fr)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12098187B2 (en) 2013-12-02 2024-09-24 The Trustees Of Columbia University In The City Of New York Bispecific HIV-1-neutralizing antibodies

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
AU2022338817A1 (en) * 2021-08-30 2024-03-07 Kanglin Biotechnology (Hangzhou) Co., Ltd. Gene sequence construct for gene therapy for hiv infection
WO2024008177A1 (fr) * 2022-07-08 2024-01-11 Nanjing Curegene Technology Co., Ltd. Cellules modifiées et leurs utilisations

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150152167A1 (en) * 2013-12-02 2015-06-04 Aaron Diamond Aids Research Center Hiv-1-neutralizing antibody potency and breadth via cell receptor anchoring using bispecific antibodies with native architecture
WO2017074878A1 (fr) * 2015-10-25 2017-05-04 Sanofi Protéines de liaison trispécifiques et/ou trivalentes pour la prévention ou le traitement d'une infection par le vih

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9951106B2 (en) * 2012-12-04 2018-04-24 University Of Maryland, Baltimore Recombinant fusion protein comprising HIV gp120 linked to an enhancing CD4 binding site mAb
WO2016054023A1 (fr) * 2014-09-29 2016-04-07 Duke University Anticorps anti-vih-1 et utilisations de ceux-ci (adcc et ab bispécifiques)

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150152167A1 (en) * 2013-12-02 2015-06-04 Aaron Diamond Aids Research Center Hiv-1-neutralizing antibody potency and breadth via cell receptor anchoring using bispecific antibodies with native architecture
US20170247435A1 (en) * 2013-12-02 2017-08-31 Aaron Diamond Aids Research Center Bispecific hiv-1 neutralizing antibodies
WO2017074878A1 (fr) * 2015-10-25 2017-05-04 Sanofi Protéines de liaison trispécifiques et/ou trivalentes pour la prévention ou le traitement d'une infection par le vih

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12098187B2 (en) 2013-12-02 2024-09-24 The Trustees Of Columbia University In The City Of New York Bispecific HIV-1-neutralizing antibodies

Also Published As

Publication number Publication date
CN111819196B (zh) 2022-10-28
CA3085351A1 (fr) 2019-07-11
TW201938583A (zh) 2019-10-01
CN111819196A (zh) 2020-10-23
EP3728311A4 (fr) 2021-11-17
AU2018399587A1 (en) 2020-07-09
TWI745643B (zh) 2021-11-11
JP7345861B2 (ja) 2023-09-19
EP3728311A1 (fr) 2020-10-28
JP2021506945A (ja) 2021-02-22

Similar Documents

Publication Publication Date Title
US12098187B2 (en) Bispecific HIV-1-neutralizing antibodies
US9884905B2 (en) Bispecific HIV-1 neutralizing antibodies
US10442857B2 (en) Anti-IL-17 antibodies
CN110234355B (zh) 单体人IgG1 Fc和双特异性抗体
US9308258B2 (en) Stable and aggregation free antibody FC molecules through CH3 domain interface engineering
JP2013511281A (ja) 単量体抗体Ｆｃ
AU2018399587A1 (en) Bispecific HIV-1-neutralizing antibodies
US10689434B2 (en) Antibody against hepatitis B surface antigen and use thereof
CN114751986A (zh) 中和新冠病毒的多特异性抗体
TW202409093A (zh) 融合蛋白
CN114751988A (zh) 中和冠状病毒的多特异性抗体
CN117320752A (zh) 具有改善的半衰期的经修饰FcRn结合片段

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18898849

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3085351

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020535114

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018399587

Country of ref document: AU

Date of ref document: 20181220

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018898849

Country of ref document: EP

Effective date: 20200721