WO2019060750A2 - A33 ANTIBODY COMPOSITIONS AND METHODS OF USE IN RADIOIMMUNOTHERAPY - Google Patents

A33 ANTIBODY COMPOSITIONS AND METHODS OF USE IN RADIOIMMUNOTHERAPY Download PDF

Info

Publication number
WO2019060750A2
WO2019060750A2 PCT/US2018/052253 US2018052253W WO2019060750A2 WO 2019060750 A2 WO2019060750 A2 WO 2019060750A2 US 2018052253 W US2018052253 W US 2018052253W WO 2019060750 A2 WO2019060750 A2 WO 2019060750A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
subject
antibodies
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/052253
Other languages
English (en)
French (fr)
Other versions
WO2019060750A3 (en
Inventor
Zhihao WU
Hong Xu
Nai-Kong Cheung
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Memorial Sloan Kettering Cancer Center
Original Assignee
Memorial Sloan Kettering Cancer Center
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to CA3076611A priority Critical patent/CA3076611A1/en
Priority to EA202090583A priority patent/EA202090583A1/ru
Priority to CN201880075541.7A priority patent/CN111372590A/zh
Priority to US16/649,617 priority patent/US11555072B2/en
Priority to AU2018338322A priority patent/AU2018338322B2/en
Priority to EP18859251.3A priority patent/EP3684369A4/en
Priority to JP2020516818A priority patent/JP7303802B2/ja
Priority to KR1020207011796A priority patent/KR102783937B1/ko
Application filed by Memorial Sloan Kettering Cancer Center filed Critical Memorial Sloan Kettering Cancer Center
Priority to IL273484A priority patent/IL273484B2/en
Publication of WO2019060750A2 publication Critical patent/WO2019060750A2/en
Publication of WO2019060750A3 publication Critical patent/WO2019060750A3/en
Anticipated expiration legal-status Critical
Priority to JP2023103361A priority patent/JP2023138957A/ja
Priority to US18/501,782 priority patent/US20240327511A1/en
Priority to JP2024215117A priority patent/JP2025061650A/ja
Priority to AU2025204844A priority patent/AU2025204844A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/0474Organic compounds complexes or complex-forming compounds, i.e. wherein a radioactive metal (e.g. 111In3+) is complexed or chelated by, e.g. a N2S2, N3S, NS3, N4 chelating group
    • A61K51/0482Organic compounds complexes or complex-forming compounds, i.e. wherein a radioactive metal (e.g. 111In3+) is complexed or chelated by, e.g. a N2S2, N3S, NS3, N4 chelating group chelates from cyclic ligands, e.g. DOTA
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K51/00Preparations containing radioactive substances for use in therapy or testing in vivo
    • A61K51/02Preparations containing radioactive substances for use in therapy or testing in vivo characterised by the carrier, i.e. characterised by the agent or material covalently linked or complexing the radioactive nucleus
    • A61K51/04Organic compounds
    • A61K51/08Peptides, e.g. proteins, carriers being peptides, polyamino acids, proteins
    • A61K51/10Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody
    • A61K51/1084Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody the antibody being a hybrid immunoglobulin
    • A61K51/109Antibodies or immunoglobulins; Fragments thereof, the carrier being an antibody, an immunoglobulin or a fragment thereof, e.g. a camelised human single domain antibody or the Fc fragment of an antibody the antibody being a hybrid immunoglobulin immunoglobulins having two or more different antigen-binding sites or multifunctional antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2809Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/82Colon
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/828Stomach
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide

Definitions

  • the present technology relates generally to the preparation of immunoglobulin-related compositions (e.g., antibodies or antigen binding fragments thereof) that specifically bind A33 protein and uses of the same.
  • the present technology relates to the preparation of A33 neutralizing antibodies and their use in detecting and treating A33 associated cancers.
  • CRCs Colorectal cancers
  • mCRCs metastatic CRCs
  • Standard treatment for mCRC consists of chemotherapy in combination with monoclonal antibodies that block tumor signaling or angiogenesis.
  • monoclonal antibody drugs have been FDA approved for CRC treatment: bevacizumab and ramucirumab target the VEGF-VEGFR angiogenesis pathway, while cetuximab and panitumumab target the EGFR pathway.
  • cetuximab and panitumumab do not provide clinical benefits for mCRC with RAS mutations (Van Cutsem E, Cervantes A, Adam R, et al., Annals of Oncology 27: 1386-1422 (2016)), which are found in around 40% of all mCRC (Bencsikova B, Bortlicek Z, Halamkova J, et al., BMC Gastroenterology 15:37 (2015)).
  • RIT radioimmunotherapy
  • TI tumor dose and therapeutic index
  • the present disclosure provides an antibody or antigen binding fragment thereof comprising a heavy chain immunoglobulin variable domain (V H ) and a light chain immunoglobulin variable domain (V L ), wherein (a) the V H comprises a V H -CDR1
  • V L comprises a V L -CDR1 sequence, a V L -CDR2 sequence, and a V L - CDR3 sequence selected from the group consisting of: KASQNVRTVVA (SEQ ID NO: 40), LASNRHT (SEQ ID NO: 41), and QYWSYPLT (SEQ ID NO: 42); KASQNVRTVVA (SEQ ID NO: 40), LASDRHT (SEQ ID NO: 43), and QYWSYPLT (SEQ ID NO: 42); KASQNVRTLVA (SEQ ID NO: 44), LASNRHT (SEQ ID NO: 41), and QHWSYPLT (SEQ ID NO: 45); and KASQNVRTLVA (SEQ ID NO: 44), LASNRHT (SEQ ID NO: 41), and QYWSYPLT (SEQ ID NO: 45); and KASQNVRTLVA (SEQ ID NO: 44), LASNRHT (SEQ ID NO: 41), and QYWSYPL
  • the antibody may further comprise an Fc domain of an isotype selected from the group consisting of IgGl, IgG2, IgG3, IgG4, IgAl, IgA2, IgM, IgD, and IgE.
  • the antibody comprises an IgGl constant region comprising one or more amino acid substitutions selected from the group consisting of N297A and K322A.
  • the antibody comprises an IgG4 constant region comprising a S228P mutation.
  • the antigen binding fragment is selected from the group consisting of Fab, F(ab') 2 , Fab', scF v , and F v .
  • the antibody is a monoclonal antibody, chimeric antibody, humanized antibody, or a bispecific antibody.
  • the antibody or antigen binding fragment binds to an epitope of A33 protein comprising at least five to eight consecutive amino acid residues of SEQ ID NO: 57.
  • the epitope is a conformational epitope.
  • the present disclosure provides an antibody comprising a heavy chain (HC) amino acid sequence comprising SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 58, SEQ ID NO: 62, or a variant thereof having one or more conservative amino acid substitutions, and/or a light chain (LC) amino acid sequence comprising SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 17, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 60, SEQ ID NO: 63, or a variant thereof having one or more conservative amino acid substitutions.
  • HC heavy chain
  • the antibody comprises a HC amino acid sequence and a LC amino acid sequence selected from the group consisting of: SEQ ID NO: 5 and SEQ ID NO: 9 (3A3-H1/L1); SEQ ID NO: 5 and SEQ ID NO: 10 (3A3-H1/L2); SEQ ID NO: 6 and SEQ ID NO: 9 (3A3-H2/L1); SEQ ID NO: 6 and SEQ ID NO: 10 (3A3- H2/L2); SEQ ID NO: 15 and SEQ ID NO: 17 (huA33-IgGl (H2L2)); SEQ ID NO: 19 and SEQ ID NO: 21 (huA33-BsAb); SEQ ID NO: 23 and SEQ ID NO: 24 (clone 31); SEQ ID NO: 25 and SEQ ID NO: 26 (clone 32); SEQ ID NO: 27 and SEQ ID NO: 28 (clone 48); SEQ ID NO: 29 and SEQ ID NO: 30 (clone 49); SEQ ID NO: 31 and SEQ ID NO:
  • the present disclosure provides an antibody comprising (a) a light chain immunoglobulin variable domain sequence that is at least 80%, at least 85%>, at least 90%, at least 95%), or at least 99% identical to the light chain immunoglobulin variable domain sequence present in any one of SEQ ID NOs: 9. 10, 17, 21, 24, 26, 28, 30, 32, 34, 36, 60, or 63; and/or (b) a heavy chain immunoglobulin variable domain sequence that is at least 80%, at least 85%, at least 90%), at least 95%, or at least 99% identical to the heavy chain immunoglobulin variable domain sequence present in any one of SEQ ID NOs: 5, 6, 15, 19, 23, 25, 27, 29, 31, 33, 35, 58 or 62.
  • the present disclosure provides an antibody comprising (a) a LC sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the LC sequence present in any one of SEQ ID NOs: 9. 10, 17, 21, 24, 26, 28, 30, 32, 34, 36, 60, or 63; and/or (b) a HC sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the HC sequence present in any one of SEQ ID NOs: 5, 6, 15, 19, 23, 25, 27, 29, 31, 33, 35, 58 or 62.
  • the antibody is a chimeric antibody, a humanized antibody, or a bispecific antibody. Additionally or alternatively, in some embodiments, the antibody comprises an IgGl constant region comprising one or more amino acid substitutions selected from the group consisting of N297A and K322A. In certain embodiments, the antibody of the present technology comprises an IgG4 constant region comprising a S228P mutation. In any of the above embodiments, the antibody binds to an epitope of A33 protein comprising at least five to eight consecutive amino acid residues of SEQ ID NO: 57. In some embodiments, the epitope is a conformational epitope. Additionally or alternatively, in some embodiments, the antibody of the present technology lacks a-l,6-fucose modifications.
  • the present disclosure provides a recombinant nucleic acid sequence encoding any of the antibodies described herein.
  • the recombinant nucleic acid sequence selected from the group consisting of: SEQ ID NOs: 7, 8, 11, 12, 16, 18, 20, 22, 59 and 61.
  • the present disclosure provides a host cell or vector comprising any of the recombinant nucleic acid sequences disclosed herein.
  • the present disclosure provides a composition comprising an antibody or antigen binding fragment of the present technology and a pharmaceutically-acceptable carrier, wherein the antibody or antigen binding fragment is optionally conjugated to an agent selected from the group consisting of isotopes, dyes, chromagens, contrast agents, drugs, toxins, cytokines, enzymes, enzyme inhibitors, hormones, hormone antagonists, growth factors, radionuclides, metals, liposomes, nanoparticles, RNA, DNA or any combination thereof.
  • an agent selected from the group consisting of isotopes, dyes, chromagens, contrast agents, drugs, toxins, cytokines, enzymes, enzyme inhibitors, hormones, hormone antagonists, growth factors, radionuclides, metals, liposomes, nanoparticles, RNA, DNA or any combination thereof.
  • the bispecific antibody binds to T cells, B-cells, myeloid cells, plasma cells, or mast-cells.
  • the bispecific antibody binds to CD3, CD4, CD8, CD20, CD19, CD21, CD23, CD46, CD80, HLA-DR, CD74, CD22, CD14, CD15, CD16, CD 123, TCR gamma/delta, NKp46, KIR, or a small molecule DOT A hapten.
  • the small molecule DOTA hapten may be selected from the group consisting of DOTA, DOTA-Bn, DOTA-desferrioxamine, DOTA-Phe-Lys(HSG)-D-Tyr-Lys(HSG)-NH 2 , Ac-Lys(HSG)D-Tyr- Lys(HSG)-Lys(Tscg-Cys)-NH 2 , DOTA-D-Asp-D-Lys(HSG)-D-Asp-D-Lys(HSG)-NH 2 ; DOTA- D-Glu-D-Lys(HSG)-D-Glu-D-Lys(HSG)-NH 2 , DOTA-D-Tyr-D-Lys(HSG)-D-Glu-D- Lys(HSG)-NH 2 , DOTA-D-Ala-D-Lys(HSG)-D-Glu-D-Lys(HSG)-NH 2
  • the present disclosure provides a method for treating an A33 associated cancer in a subject in need thereof, comprising administering to the subject an effective amount of any one of the antibodies disclosed herein.
  • the antibody comprises a HC amino acid sequence and a LC amino acid sequence selected from the group consisting of: SEQ ID NO: 5 and SEQ ID NO: 9 (3A3-H1/L1); SEQ ID NO: 5 and SEQ ID NO: 10 (3A3-H1/L2); SEQ ID NO: 6 and SEQ ID NO: 9 (3A3-H2/L1); SEQ ID NO: 6 and SEQ ID NO: 10 (3A3-H2/L2); SEQ ID NO: 15 and SEQ ID NO: 17 (huA33-IgGl (H2L2)); SEQ ID NO: 19 and SEQ ID NO: 21 (huA33-BsAb); SEQ ID NO: 23 and SEQ ID NO: 24 (clone 31); SEQ ID NO: 25 and SEQ ID NO: 26 (clo
  • the A33 associated cancer is colorectal cancer
  • the A33 associated cancer may be colorectal cancer with a MSI genotype or a MSS genotype.
  • the colorectal cancer is associated with a KRAS G12D mutation or a p53 mutation.
  • the antibody is administered to the subject separately, sequentially or simultaneously with an additional therapeutic agent.
  • additional therapeutic agents include one or more of alkylating agents, platinum agents, taxanes, vinca agents, anti-estrogen drugs, aromatase inhibitors, ovarian suppression agents, VEGF/VEGFR inhibitors, EGF/EGFR inhibitors, PARP inhibitors, cytostatic alkaloids, cytotoxic antibiotics, antimetabolites, endocrine/hormonal agents, bisphosphonate therapy agents.
  • the present disclosure provides a method for detecting a tumor in a subject in vivo comprising (a) administering to the subject an effective amount of an antibody of the present technology, wherein the antibody is configured to localize to a tumor expressing A33 and is labeled with a radioisotope; and (b) detecting the presence of a tumor in the subject by detecting radioactive levels emitted by the antibody that are higher than a reference value.
  • the subject is diagnosed with or is suspected of having cancer. Radioactive levels emitted by the antibody may be detected using positron emission tomography or single photon emission computed tomography.
  • the method further comprises administering to the subject an effective amount of an immunoconjugate comprising an antibody of the present technology conjugated to a radionuclide.
  • the radionuclide is an alpha particle-emitting isotope, a beta particle-emitting isotope, an Auger-emitter, or any combination thereof. Examples of beta particle-emitting isotopes include 86 Y, 90 Y, 89 Sr, 165 Dy,
  • nonspecific FcR-dependent binding in normal tissues is eliminated or reduced (e.g., via N297A mutation in Fc region, which results in aglycosylation).
  • kits for the detection and/or treatment of A33 associated cancers comprising at least one immunoglobulin-related composition of the present technology (e.g., any antibody or antigen binding fragment described herein), or a functional variant (e.g., substitutional variant) thereof and instructions for use.
  • the immunoglobulin-related composition of the present technology e.g., any antibody or antigen binding fragment described herein
  • a functional variant e.g., substitutional variant
  • the immunoglobulin-related composition is coupled to one or more detectable labels.
  • the one or more detectable labels comprise a radioactive label, a fluorescent label, or a chromogenic label.
  • the kit further comprises a secondary antibody that specifically binds to an anti-A33 immunoglobulin-related composition described herein.
  • the secondary antibody is coupled to at least one detectable label selected from the group consisting of a radioactive label, a fluorescent label, or a chromogenic label.
  • the present disclosure provides a method for detecting solid tumors in a subject in need thereof comprising (a) administering to the subject an effective amount of a complex comprising a radiolabeled DOTA hapten and a bispecific antibody of the present technology that binds to the radiolabeled DOTA hapten and an A33 antigen, wherein the complex is configured to localize to a solid tumor expressing the A33 antigen recognized by the bispecific antibody of the complex; and (b) detecting the presence of solid tumors in the subject by detecting radioactive levels emitted by the complex that are higher than a reference value.
  • the present disclosure provides a method for selecting a subject for pretargeted radioimmunotherapy comprising (a) administering to the subject an effective amount of a complex comprising a radiolabeled DOTA hapten and a bispecific antibody of the present technology that binds to the radiolabeled DOTA hapten and an A33 antigen, wherein the complex is configured to localize to a solid tumor expressing the A33 antigen recognized by the bispecific antibody of the complex; (b) detecting radioactive levels emitted by the complex; and (c) selecting the subject for pretargeted radioimmunotherapy when the radioactive levels emitted by the complex are higher than a reference value.
  • the present disclosure provides a method for increasing tumor sensitivity to radiation therapy in a subject diagnosed with an A33-positive cancer comprising administering to the subject an effective amount of a complex comprising a radiolabeled-DOTA hapten and a bispecific antibody of the present technology that recognizes and binds to the radiolabeled-DOTA hapten and an A33 antigen target, wherein the complex is configured to localize to a tumor expressing the A33 antigen target recognized by the bispecific antibody of the complex.
  • the present disclosure provides a method for treating cancer in a subject in need thereof comprising administering to the subject an effective amount of a complex comprising a radiolabeled-DOTA hapten and a bispecific antibody of the present technology that recognizes and binds to the radiolabeled-DOTA hapten and an A33 antigen target, wherein the complex is configured to localize to a tumor expressing the A33 antigen target recognized by the bispecific antibody of the complex.
  • the complex is administered intravenously, intramuscularly, intraarterially, intrathecally, intracapsularly, intraorbitally, intradermally, intraperitoneally, transtracheally, subcutaneously,
  • the radiolabeled-DOTA hapten comprises 213 Bi, 211 At, 225 Ac, 152 Dy, 212 Bi, 223 Ra, 219 Rn, 215 Po, 211 Bi, 221 Fr, 217 At, 255 Fm, 86 Y, 90 Y, 89 Sr, 165 Dy, 186 Re, 188 Re, 177 Lu, 67 Cu, m In, 67 Ga, 51 Cr, 58 Co, 99m Tc, 103m Rh, 195m Pt, 119 Sb, 161 Ho, 189m Os, 192 Ir, 201 T1, 203 Pb,
  • Ga, Th, or Cu and optionally comprises an alpha particle-emitting isotope, a beta particle- emitting isotope, or an Auger-emitter.
  • the present disclosure provides a method for increasing tumor sensitivity to radiation therapy in a subject diagnosed with an A33-positive cancer comprising (a) administering an effective amount of an anti-DOTA bispecific antibody of the present technology to the subject, wherein the anti-DOTA bispecific antibody is configured to localize to a tumor expressing an A33 antigen target; and (b) administering an effective amount of a radiolabeled-DOTA hapten to the subject, wherein the radiolabeled-DOTA hapten is configured to bind to the anti-DOTA bispecific antibody.
  • the present disclosure provides a method for treating cancer in a subject in need thereof comprising (a) administering an effective amount of an anti-DOTA bispecific antibody of the present technology to the subject, wherein the anti-DOTA bispecific antibody is configured to localize to a tumor expressing an A33 antigen target; and (b) administering an effective amount of a radiolabeled-DOTA hapten to the subject, wherein the radiolabeled-DOTA hapten is configured to bind to the anti-DOTA bispecific antibody.
  • the methods of the present technology further comprise administering an effective amount of a clearing agent to the subject prior to
  • the radiolabeled-DOTA hapten comprises 213 Bi, 211 At, 225 Ac, 152 Dy, 212 Bi, 223 Ra, 219 Rn, 215 Po, 211 Bi, 221 Fr, 217 At, 255 Fm, 86 Y, 90 Y, 89 Sr, 165 Dy, 186 Re, 188 Re, 177 Lu, 67 Cu, m In, 67 Ga, 51 Cr, 58 Co, 99m Tc, 103m Rh, 195m Pt, 119 Sb, 161 Ho, 189m Os, 192 Ir, 201 T1, 203 Pb, 68 Ga, 227 Th, or 64 Cu, and optionally comprises an alpha particle-emitting isotope, a beta particle-emitting isotope, or an Auger-emitter.
  • the subject is human.
  • Figure 1(A) shows the design and construction of humanized A33-bispecific antibody (huA33-BsAb).
  • Figure 1(B) shows the accelerated stability test of purified huA33-BsAb at 37 °C over 4 weeks.
  • Figure 1(C) shows the Surface Plasmon Resonance (SPR) analysis of huA33- BsAb at 25°C and 37°C. Data were fit to 1 : 1 binding model.
  • Figure 1(D) shows the FACS staining of different tumor cell lines and activated T cells. Mean fluorescence intensity (MFI) values were geometric means.
  • SPR Surface Plasmon Resonance
  • Figure 2(A) shows the activation of CD25 and CD69 markers in T cells at 24 hours post incubation with Colo205 cells and different antibodies.
  • Figure 2(B) shows the
  • FIG. 2(C) shows representative images for Figure 2(B).
  • Figure 2(D) shows the staining of CD45RO at 96 hours post incubation with Colo205 cells and huA33-BsAb in an independent experiment.
  • Figure 2(E) shows the in vivo activation and proliferation of T cells by huA33-BsAb.
  • PBMCs peripheral blood mononuclear cells
  • HuA33-BsAb was injected intravenously the next day and the tumors were isolated after another 4 days and analyzed by FACS.
  • FIG. 3 shows the profile of secreted cytokines and cytotoxic components by huA33-BsAb activated T cells in the presence of a target tumor.
  • the kinetics of cytokine and cytolytic molecule production by T cells in the presence of huA33-BsAb and target cell Colo205 or negative control cell SKMEL5 were determined over 4 days. Because SKMEL5 secreted copious amounts of IL-6, the supernatant from T cells incubated with Colo205 cells in the absence of antibody was used as a negative control in the IL-6 kinetics experiment.
  • Figure 4(A) shows the cytotoxicity elicited by huA33-BsAb against different target tumor cell lines and control cells. Activated T cells were used as effector cells at an effector to target ratio (E:T) of 10: 1. Cells were incubated for 16 hours before obtaining readings.
  • Figure 5(A) shows a summary of the affinity maturation of huA33 (H2L2) by yeast screening.
  • Figure 5(B) shows a summary of K D of parental and affinity matured huA33-BsAb (top) and the on-off rate map of different huA33-BsAbs derived from SPR analysis (bottom).
  • Figure 5(C) shows the results of the T-cell dependent cytotoxicity (TDCC) assay of the parental and affinity matured huA33-BsAbs.
  • TDCC T-cell dependent cytotoxicity
  • FIG. 6(C) shows luminescence images of abdominal LS174T tumors in different groups. Tumor only group had one mouse (#4) that did not take the tumor after 21 days and was excluded from analysis.
  • Figure 7(A) shows luminescence images showing growth of s.c. Colo205 tumors in different groups.
  • Figure 7(B) shows the quantification of signals from Figure 7(A) (top) and the survival of mice from different groups in Figure 7(A) (bottom).
  • Figure 7(C) shows
  • Figure 8(A) shows the growth of s.c. SNU16 tumors in different groups.
  • Figure 8(B) shows the engraftment of human cells from mice blood in Figure 8(A).
  • Figure 9 shows the SPR analysis of 4 versions of humanized A33. All antibodies comprised a IgGl constant domain. 3A3-H1L1, 3A3-H1L2, 3A3-H2L1 and 3A3-H2L2 were 4 versions of humanized 3 A3. 3A3-chA33 was chimeric 3 A3.
  • Figure 10 shows the results of FACS analysis of various cell lines stained with huA33-BsAb.
  • Figure 11(A) shows the upregulation of PD-1 on T cells activated by huA33-BsAb in the presence of Colo205 cells after 24 hours (left) and 96 hours (right).
  • Figure 11(B) shows the absence of T cell division after incubating with SKMEL5 in the presence of huA33-BsAb after 96 hours.
  • Figure 11(C) shows the activation of T cell division by huA33-BsAb in the presence of LS174T cells.
  • Figures 11(B) and 11(C) used the same preparation of T cells.
  • Figures 12(A) and 12(B) show the staining of CD45RO and CD25 markers on T cells 48 hours post incubation with Colo205 cells in the presence of different antibodies. Cells were obtained from the TDCC assay after the supernatant was used for LDH measurement.
  • Figure 12(A) gated on CD4(+) T cells;
  • Figure 12(B) gated on CD8(+) T cells.
  • Figure 13 shows the strategy for rapid reformation of scFv to huA33-BsAb format.
  • Expression vector (1) was linearized with Hindlll/Apal.
  • Promoter fragment (3) was prepared from Sapl digested promoter-containing vector. Both vector and promoter fragment could be prepared in large amounts for higher throughput cloning.
  • VH (4) and VL (2) were amplified directly from yeast with two 5' primers to add the leader sequences and digested with
  • VL Hindlll/Sapl
  • VH Apal/Sapl
  • Figure 14 shows the amino acid sequences of the V H and V L domains of the murine A33 antibody and their corresponding homologous human sequences (SEQ ID NOs: 1-4).
  • the CDR1, CDR2, and CDR3 regions of the V H and V L domains of the murine A33 antibody are indicated by the underlined boldface font.
  • Figure 15 shows the amino acid sequences of the humanized heavy chains of huA33- Hl (3A3-H1) (SEQ ID NO: 5) and huA33-H2 (3A3-H2) (SEQ ID NO: 6). The CDR1, CDR2, and CDR3 regions of 3A3-H1 and 3A3-H2 are indicated by the underlined boldface font.
  • Figure 16 shows the cDNA sequences of the humanized heavy chains of huA33-Hl (3A3-H1) (SEQ ID NO: 7) and huA33-H2 (3A3-H2) (SEQ ID NO: 8).
  • Figure 17 shows the amino acid sequences of the humanized light chains of huA33- Ll (3A3-L1) (SEQ ID NO: 9) and huA33-L2 (3A3-L2) (SEQ ID NO: 10).
  • the CDRl, CDR2, and CDR3 regions of 3 A3-L1 and 3 A3-L2 are indicated by the underlined boldface font.
  • Figure 18 shows the cDNA sequences of the humanized light chains of huA33-Ll (3 A3-L1) (SEQ ID NO: 11) and huA33-L2 (3 A3-L2) (SEQ ID NO: 12).
  • Figure 19 shows the alignment of the original humanized sequences hA33 from King et al. (1995) supra, versus the newly rehumanized huA33 (3 A3) sequences.
  • Figure 20 shows the binding kinetics of the humanized IgG variants of huA33 assayed on GPA33 recombinant protein using SPR (Biacore T100). All four versions retained the high binding affinity of chimeric A33 (chA33).
  • Figure 21 shows the binding kinetics of the original humanized hA33 (in hA33- mC825 bispecific format as described in Cheal et al, Eur. J. Nucl. Med. Mol. Imaging, 43 :925- 937 (2016) vs. huA33 (3A3-H2L2) assayed on GPA33 recombinant protein using SPR (Biacore T100).
  • the original humanized hA33 lost considerable affinity compared to huA33.
  • Figure 22 shows the binding kinetics of the original humanized hA33 (in hA33- mC825 bispecific format as described in Cheal et al, Eur. J. Nucl. Med. Mol. Imaging, 43 :925- 937 (2016) vs. huA33 (3A3-H2L2) assayed on GPA33 recombinant protein using SPR (Biacore T100).
  • the original humanized hA33 lost considerable affinity compared to huA33.
  • Figure 23 shows the humanness analysis of huA33 heavy and light chain sequences (3A3-H1, 3A3-H2, 3A3-L1, 3A3-L2) and the original hA33 sequences. Since all four versions of rehumanization retained high binding affinity of original chA33, H2L2 version was chosen for further development based on its higher humanness T20 score.
  • Figure 24 shows the amino acid sequences of the light chain and heavy chain of the chimeric chA33-IgGl, which correspond to SEQ ID NO: 13 and SEQ ID NO: 14 respectively.
  • Figure 25 shows the amino acid and cDNA sequences of the heavy chain of huA33- IgGl (H2L2), which correspond to SEQ ID NO: 15 and SEQ ID NO: 16 respectively.
  • Figure 26 shows the amino acid and cDNA sequences of the light chain of huA33- IgGl (H2L2), which correspond to SEQ ID NO: 17 and SEQ ID NO: 18 respectively.
  • Figure 27 shows the amino acid and cDNA sequences of the heavy chain of T-cell engaging huA33-BsAb bispecific antibodies, which correspond to SEQ ID NO: 19 and SEQ ID NO: 20 respectively.
  • Figure 28 shows the amino acid and cDNA sequences of the light chain of T-cell engaging huA33-BsAb bispecific antibodies, which correspond to SEQ ID NO: 21 and SEQ ID NO: 22 respectively.
  • the underlined sequences correspond to GS linker sequences.
  • Figure 29 shows a summary of potential modifications to the T-cell engaging huA33- BsAb bispecific antibodies disclosed herein.
  • Figure 30 shows the amino acid sequences of the heavy chain and light chain of the affinity-matured clone 31 in huA33-BsAb format, corresponding to SEQ ID NO: 23 and SEQ ID NO: 24 respectively.
  • the underlined sequences correspond to GS linker sequences.
  • Figure 31 shows the amino acid sequences of the heavy chain and light chain of the affinity-matured clone 32 in huA33-BsAb format, corresponding to SEQ ID NO: 25 and SEQ ID NO: 26 respectively.
  • the underlined sequences correspond to GS linker sequences.
  • Figure 32 shows the amino acid sequences of the heavy chain and light chain of the affinity-matured clone 48 in huA33-BsAb format, corresponding to SEQ ID NO: 27 and SEQ ID NO: 28 respectively.
  • the underlined sequences correspond to GS linker sequences.
  • Figure 33 shows the amino acid sequences of the heavy chain and light chain of the affinity -matured clone 49 in huA33-BsAb format, corresponding to SEQ ID NO: 29 and SEQ ID NO: 30 respectively.
  • the underlined sequences correspond to GS linker sequences.
  • Figure 34 shows the amino acid sequences of the heavy chain and light chain of the affinity-matured clone 53 in huA33-BsAb format, corresponding to SEQ ID NO: 31 and SEQ ID NO: 32 respectively.
  • the underlined sequences correspond to GS linker sequences.
  • Figure 35 shows the amino acid sequences of the heavy chain and light chain of the affinity -matured clone 56 in huA33-BsAb format, corresponding to SEQ ID NO: 33 and SEQ ID NO: 34 respectively.
  • the underlined sequences correspond to GS linker sequences.
  • Figure 36 shows the amino acid sequences of the heavy chain and light chain of the affinity -matured clone 57 in huA33-BsAb format, corresponding to SEQ ID NO: 35 and SEQ ID NO: 36 respectively.
  • the underlined sequences correspond to GS linker sequences.
  • Figure 37 shows the amino acid and cDNA sequences of the heavy chain of bispecific antibodies huA33-huC825 (H2L2), which correspond to SEQ ID NO: 58 and SEQ ID NO: 59, respectively.
  • Figure 38 shows the amino acid and cDNA sequences of the light chain of bispecific antibodies huA33-huC825 (H2L2), which correspond to SEQ ID NO: 60 and SEQ ID NO: 61, respectively.
  • the underlined sequences correspond to GS linker sequences.
  • Figure 39 shows the amino acid sequence of the heavy chain and light chain of the bispecific antibodies huA33-mC825 (H2L2), which correspond to SEQ ID NO: 62 and SEQ ID NO: 63, respectively.
  • the underlined sequences correspond to GS linker sequences.
  • Figure 40 shows ex vivo biodistribution results for GPA33 -positive (GPA33(+)) human colorectal tumor xenograft targeting in mice bearing subcutaneous GPA33(+) SW1222 human colorectal xenografts that were treated with the rehumanized huA33-DOTA bispecific antibody disclosed herein and tracer doses of 177 Lu-DOTA-biotin.
  • the present disclosure generally provides immunoglobulin-related compositions (e.g., antibodies or antigen binding fragments thereof), which can specifically bind to and neutralize the biological activity of A33 polypeptides.
  • the immunoglobulin-related compositions of the present technology are useful in methods for detecting or treating A33 associated cancers in a subject in need thereof. Accordingly, the various aspects of the present methods relate to the preparation, characterization, and manipulation of anti-A33 antibodies.
  • the immunoglobulin- related compositions of the present technology are useful alone or in combination with additional therapeutic agents for treating cancer.
  • the immunoglobulin-related composition is a humanized antibody, a chimeric antibody, or a bispecific antibody.
  • the term "about” in reference to a number is generally taken to include numbers that fall within a range of 1%, 5%, or 10% in either direction (greater than or less than) of the number unless otherwise stated or otherwise evident from the context (except where such number would be less than 0% or exceed 100% of a possible value).
  • the "administration" of an agent or drug to a subject includes any route of introducing or delivering to a subject a compound to perform its intended function. Administration can be carried out by any suitable route, including but not limited to, orally, intranasally, parenterally (intravenously, intramuscularly, intraperitoneally, or subcutaneously), rectally, intrathecally, intratumorally or topically. Administration includes self-administration and the administration by another.
  • an adjuvant refers to one or more substances that cause stimulation of the immune system.
  • an adjuvant is used to enhance an immune response to one or more vaccine antigens or antibodies.
  • An adjuvant may be administered to a subject before, in combination with, or after administration of the vaccine.
  • chemical compounds used as adjuvants include aluminum compounds, oils, block polymers, immune stimulating complexes, vitamins and minerals (e.g., vitamin E, vitamin A, selenium, and vitamin B12), Quil A (saponins), bacterial and fungal cell wall components (e.g., lipopolysaccarides, lipoproteins, and glycoproteins), hormones, cytokines, and co-stimulatory factors.
  • antibody collectively refers to immunoglobulins or immunoglobulin-like molecules including by way of example and without limitation, IgA, IgD, IgE, IgG and IgM, combinations thereof, and similar molecules produced during an immune response in any vertebrate, for example, in mammals such as humans, goats, rabbits and mice, as well as non-mammalian species, such as shark immunoglobulins.
  • antibodies includes intact immunoglobulins and "antigen binding fragments” specifically bind to a molecule of interest (or a group of highly similar molecules of interest) to the substantial exclusion of binding to other molecules (for example, antibodies and antibody fragments that have a binding constant for the molecule of interest that is at least 10 3 M "1 greater, at least 10 4 M “ 1 greater or at least 10 5 M “1 greater than a binding constant for other molecules in a biological sample).
  • antibody also includes genetically engineered forms such as chimeric antibodies (for example, humanized murine antibodies), heteroconjugate antibodies (such as, bispecific antibodies). See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, 111.); Kuby, J., Immunology, 3 rd Ed., W.H. Freeman & Co., New York, 1997.
  • antibody refers to a polypeptide ligand comprising at least a light chain immunoglobulin variable region or heavy chain immunoglobulin variable region which specifically recognizes and binds an epitope of an antigen.
  • Antibodies are composed of a heavy and a light chain, each of which has a variable region, termed the variable heavy (V H ) region and the variable light (V L ) region. Together, the V H region and the V L region are responsible for binding the antigen recognized by the antibody.
  • an immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds. There are two types of light chain, lambda ( ⁇ ) and kappa ( ⁇ ).
  • Each heavy and light chain contains a constant region and a variable region, (the regions are also known as “domains"). In combination, the heavy and the light chain variable regions
  • Light and heavy chain variable regions contain a "framework" region interrupted by three hypervariable regions, also called “complementarity-determining regions” or "CDRs".
  • CDRs complementarity-determining regions
  • the extent of the framework region and CDRs have been defined (see, Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991, which is hereby incorporated by reference).
  • the Kabat database is now maintained online.
  • the sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
  • the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, largely adopt a ⁇ -sheet conformation and the CDRs form loops which connect, and in some cases form part of, the ⁇ - sheet structure.
  • framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions.
  • the CDRs are primarily responsible for binding to an epitope of an antigen.
  • the CDRs of each chain are typically referred to as CDRl, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located.
  • a V H CDR3 is located in the variable domain of the heavy chain of the antibody in which it is found
  • a V L CDRl is the CDRl from the variable domain of the light chain of the antibody in which it is found.
  • An antibody that binds A33 protein will have a specific V H region and the V L region sequence, and thus specific CDR sequences.
  • Antibodies with different specificities have different CDRs. Although it is the CDRs that vary from antibody to antibody, only a limited number of amino acid positions within the CDRs are directly involved in antigen binding. These positions within the CDRs are called specificity determining residues (SDRs).
  • SDRs specificity determining residues
  • Immunoglobulin-related compositions refers to antibodies (including monoclonal antibodies, polyclonal antibodies, humanized antibodies, chimeric antibodies, recombinant antibodies, multispecific antibodies, bispecific antibodies, etc.,) as well as antibody fragments. An antibody or antigen binding fragment thereof specifically binds to an antigen.
  • antibody -related polypeptide means antigen-binding antibody fragments, including single-chain antibodies, that can comprise the variable region(s) alone, or in combination, with all or part of the following polypeptide elements: hinge region, CHi, CH 2 , and CH 3 domains of an antibody molecule. Also included in the technology are any combinations of variable region(s) and hinge region, CHi, CH 2 , and CH 3 domains.
  • Antibody- related molecules useful in the present methods e.g., but are not limited to, Fab, Fab' and F(ab') 2 , Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv) and fragments comprising either a V L or V H domain.
  • Examples include: (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , C L and CHi domains; (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the V H and CHi domains; (iv) a Fv fragment consisting of the V L and V H domains of a single arm of an antibody, (v) a dAb fragment (Ward et al, Nature 341 : 544- 546, 1989), which consists of a V H domain; and (vi) an isolated complementarity determining region (CDR).
  • a Fab fragment a monovalent fragment consisting of the V L , V H , C L and CHi domains
  • a F(ab') 2 fragment a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region
  • antibody fragments or “antigen binding fragments” can comprise a portion of a full length antibody, generally the antigen binding or variable region thereof.
  • antibody fragments or antigen binding fragments include Fab, Fab', F(ab') 2 , and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
  • Bispecific antibody refers to an antibody that can bind simultaneously to two targets that have a distinct structure, e.g., two different target antigens, two different epitopes on the same target antigen, or a hapten and a target antigen or epitope on a target antigen.
  • a variety of different bispecific antibody structures are known in the art.
  • each antigen binding moiety in a bispecific antibody includes V H and/or V L regions; in some such embodiments, the V H and/or V L regions are those found in a particular monoclonal antibody.
  • the bispecific antibody contains two antigen binding moieties, each including V H and/or V L regions from different monoclonal antibodies.
  • the bispecific antibody contains two antigen binding moieties, wherein one of the two antigen binding moieties includes an immunoglobulin molecule having V H and/or V L regions that contain CDRs from a first monoclonal antibody, and the other antigen binding moiety includes an antibody fragment (e.g., Fab, F(ab'), F(ab') 2 , Fd, Fv, dAB, scFv, etc.) having V H and/or V L regions that contain CDRs from a second monoclonal antibody.
  • a "clearing agent” is an agent that binds to excess bispecific antibody that is present in the blood compartment of a subject to facilitate rapid clearance via kidneys.
  • the use of the clearing agent prior to hapten administration e.g., DOTA
  • DOTA hapten administration
  • Examples of clearing agents include 500 kD-dextran-DOTA-Bn(Y) (Orcutt et al, Mol Cancer Ther. 11(6): 1365-1372 (2012)), 500 kD aminodextran-DOTA conjugate, antibodies against the pretargeting antibody, etc.
  • conjugated refers to the association of two molecules by any method known to those in the art. Suitable types of associations include chemical bonds and physical bonds. Chemical bonds include, for example, covalent bonds and coordinate bonds. Physical bonds include, for instance, hydrogen bonds, dipolar interactions, van der Waal forces, electrostatic interactions, hydrophobic interactions and aromatic stacking.
  • diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (V H ) connected to a light-chain variable domain (V L ) in the same polypeptide chain (V H V L ).
  • V H heavy-chain variable domain
  • V L light-chain variable domain
  • the domains are forced to pair with the complementary domains of another chain and create two antigen binding sites.
  • Diabodies are described more fully in, e.g., EP 404,097; WO 93/11161; and 30 Hollinger et al, Proc. Natl. Acad. Sci. USA, 90: 6444-6448 (1993).
  • single-chain antibodies or “single-chain Fv (scFv)” refer to an antibody fusion molecule of the two domains of the Fv fragment, V L and V H .
  • Single-chain antibody molecules may comprise a polymer with a number of individual molecules, for example, dimer, trimer or other polymers.
  • the two domains of the F v fragment, V L and V H are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the V L and V H regions pair to form monovalent molecules (known as single-chain F v (scF v )).
  • Such single-chain antibodies can be prepared by recombinant techniques or enzymatic or chemical cleavage of intact antibodies.
  • any of the above-noted antibody fragments are obtained using conventional techniques known to those of skill in the art, and the fragments are screened for binding specificity and neutralization activity in the same manner as are intact antibodies.
  • an "antigen” refers to a molecule to which an antibody (or antigen binding fragment thereof) can selectively bind.
  • the target antigen may be a protein,
  • the target antigen may be a polypeptide ⁇ e.g., an A33 polypeptide).
  • An antigen may also be administered to an animal to generate an immune response in the animal.
  • antigen binding fragment refers to a fragment of the whole
  • immunoglobulin structure which possesses a part of a polypeptide responsible for binding to antigen.
  • antigen binding fragment useful in the present technology include scFv, (scFv) 2 , scFvFc, Fab, Fab' and F(ab') 2 , but are not limited thereto.
  • binding affinity is meant the strength of the total noncovalent interactions between a single binding site of a molecule ⁇ e.g., an antibody) and its binding partner ⁇ e.g., an antigen or antigenic peptide).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K D ). Affinity can be measured by standard methods known in the art, including those described herein.
  • a low-affinity complex contains an antibody that generally tends to dissociate readily from the antigen, whereas a high-affinity complex contains an antibody that generally tends to remain bound to the antigen for a longer duration.
  • biological sample means sample material derived from living cells.
  • Biological samples may include tissues, cells, protein or membrane extracts of cells, and biological fluids (e.g., ascites fluid or cerebrospinal fluid (CSF)) isolated from a subject, as well as tissues, cells and fluids present within a subject.
  • biological fluids e.g., ascites fluid or cerebrospinal fluid (CSF)
  • Biological samples of the present technology include, but are not limited to, samples taken from breast tissue, renal tissue, the uterine cervix, the endometrium, the head or neck, the gallbladder, parotid tissue, the prostate, the brain, the pituitary gland, kidney tissue, muscle, the esophagus, the stomach, the small intestine, the colon, the liver, the spleen, the pancreas, thyroid tissue, heart tissue, lung tissue, the bladder, adipose tissue, lymph node tissue, the uterus, ovarian tissue, adrenal tissue, testis tissue, the tonsils, thymus, blood, hair, buccal, skin, serum, plasma, CSF, semen, prostate fluid, seminal fluid, urine, feces, sweat, saliva, sputum, mucus, bone marrow, lymph, and tears.
  • Bio samples can also be obtained from biopsies of internal organs or from cancers. Biological samples can be obtained from subjects for diagnosis or research or can be obtained from non- diseased individuals, as controls or for basic research. Samples may be obtained by standard methods including, e.g., venous puncture and surgical biopsy. In certain embodiments, the biological sample is a breast, lung, colon, or prostate tissue sample obtained by needle biopsy.
  • CDR-grafted antibody means an antibody in which at least one CDR of an "acceptor” antibody is replaced by a CDR "graft” from a “donor” antibody possessing a desirable antigen specificity.
  • chimeric antibody means an antibody in which the Fc constant region of a monoclonal antibody from one species (e.g., a mouse Fc constant region) is replaced, using recombinant DNA techniques, with an Fc constant region from an antibody of another species (e.g., a human Fc constant region). See generally, Robinson et al,
  • PCT/US86/02269 Akira et al, European Patent Application 184,187; Taniguchi, European Patent Application 171,496; Morrison et al, European Patent Application 173,494; Neuberger et al, WO 86/01533; Cabilly et al. U.S. Patent No. 4,816,567; Cabilly et al, European Patent Application 0125,023; Better et al, Science 240: 1041-1043, 1988; Liu et al, Proc. Natl. Acad. Sci. USA 84: 3439-3443, 1987; Liu et al, J. Immunol 139: 3521-3526, 1987; Sun et al, Proc. Natl.
  • the term "consensus FR” means a framework (FR) antibody region in a consensus immunoglobulin sequence. The FR regions of an antibody do not contact the antigen.
  • control is an alternative sample used in an experiment for comparison purpose.
  • a control can be "positive” or “negative.”
  • a positive control a compound or composition known to exhibit the desired therapeutic effect
  • a negative control a subject or a sample that does not receive the therapy or receives a placebo
  • the term "effective amount" refers to a quantity sufficient to achieve a desired therapeutic and/or prophylactic effect, e.g., an amount which results in the prevention of, or a decrease in a disease or condition described herein or one or more signs or symptoms associated with a disease or condition described herein.
  • the amount of a composition administered to the subject will vary depending on the composition, the degree, type, and severity of the disease and on the characteristics of the individual, such as general health, age, sex, body weight and tolerance to drugs. The skilled artisan will be able to determine appropriate dosages depending on these and other factors.
  • the compositions can also be administered in combination with one or more additional therapeutic compounds.
  • the therapeutically active compound e.g., an amount which results in the prevention of, or a decrease in a disease or condition described herein or one or more signs or symptoms associated with a disease or condition described herein.
  • the amount of a composition administered to the subject will vary depending on the composition, the degree, type, and severity of the disease and on the characteristics of
  • compositions may be administered to a subject having one or more signs or symptoms of a disease or condition described herein.
  • a "therapeutically effective amount" of a composition refers to composition levels in which the physiological effects of a disease or condition are ameliorated or eliminated.
  • a therapeutically effective amount can be given in one or more administrations.
  • effector cell means an immune cell which is involved in the effector phase of an immune response, as opposed to the cognitive and activation phases of an immune response.
  • exemplary immune cells include a cell of a myeloid or lymphoid origin, e.g., lymphocytes (e.g., B cells and T cells including cytolytic T cells (CTLs)), killer cells, natural killer cells, macrophages, monocytes, eosinophils, neutrophils, polymorphonuclear cells, granulocytes, mast cells, and basophils. Effector cells express specific Fc receptors and carry out specific immune functions.
  • lymphocytes e.g., B cells and T cells including cytolytic T cells (CTLs)
  • CTLs cytolytic T cells
  • killer cells e.g., natural killer cells
  • macrophages e.g., monocytes, eosinophils, neutrophils, polymorphonuclear cells, granulocytes, mast cells, and basophils
  • An effector cell can induce antibody-dependent cell-mediated cytotoxicity (ADCC), e.g., a neutrophil capable of inducing ADCC.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • monocytes, macrophages, neutrophils, eosinophils, and lymphocytes which express FcocR are involved in specific killing of target cells and presenting antigens to other components of the immune system, or binding to cells that present antigens.
  • epitope means a protein determinant capable of specific binding to an antibody.
  • Epitopes usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non- conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
  • an "epitope" of the A33 protein is a region of the protein to which the anti- A33 antibodies of the present technology specifically bind.
  • the epitope is a conformational epitope.
  • a routine cross-blocking assay such as that described in Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Ed Harlow and David Lane (1988), can be performed. This assay can be used to determine if an anti-A33 antibody binds the same site or epitope as an anti-A33 antibody of the present technology.
  • epitope mapping can be performed by methods known in the art.
  • the antibody sequence can be mutagenized such as by alanine scanning, to identify contact residues.
  • peptides corresponding to different regions of A33 protein can be used in competition assays with the test antibodies or with a test antibody and an antibody with a characterized or known epitope.
  • expression includes one or more of the following: transcription of the gene into precursor mRNA; splicing and other processing of the precursor mRNA to produce mature mRNA; mRNA stability; translation of the mature mRNA into protein (including codon usage and tRNA availability); and glycosylation and/or other modifications of the translation product, if required for proper expression and function.
  • RNA means a segment of DNA that contains all the information for the regulated biosynthesis of an RNA product, including promoters, exons, introns, and other untranslated regions that control expression.
  • Homology refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences.
  • a polynucleotide or polynucleotide region has a certain percentage (for example, at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99%) of "sequence identity" to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
  • This alignment and the percent homology or sequence identity can be determined using software programs known in the art. In some embodiments, default parameters are used for alignment.
  • One alignment program is BLAST, using default parameters.
  • Bioly equivalent polynucleotides are those having the specified percent homology and encoding a polypeptide having the same or similar biological activity. Two sequences are deemed “unrelated” or “non-homologous” if they share less than 40% identity, or less than 25% identity, with each other.
  • non-human (e.g., murine) antibodies are chimeric antibodies which contain minimal sequence derived from non-human
  • humanized antibodies are human immunoglobulins in which hypervariable region residues of the recipient are replaced by hypervariable region residues from a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
  • Fv framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
  • humanized antibodies may comprise residues which are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance such as binding affinity.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains (e.g., Fab, Fab', F(ab') 2 , or Fv), in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus FR sequence although the FR regions may include one or more amino acid substitutions that improve binding affinity.
  • the number of these amino acid substitutions in the FR are typically no more than 6 in the H chain, and in the L chain, no more than 3.
  • the humanized antibody optionally may also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • hypervariable region refers to the amino acid residues of an antibody which are responsible for antigen-binding.
  • the hypervariable region generally comprises amino acid residues from a "complementarity determining region" or "CDR" (e.g., around about residues 24-34 (LI), 50-56 (L2) and 89-97 (L3) in the V L , and around about 31- 35B (HI), 50-65 (H2) and 95-102 (H3) in the V H (Kabat et al, Sequences of Proteins of Immunological Interest, 5 th Ed. Public Health Service, National Institutes of Health, Bethesda, MD.
  • CDR complementarity determining region
  • residues from a "hypervariable loop” ⁇ e.g., residues 26-32 (LI), 50-52 (L2) and 91-96 (L3) in the V L , and 26-32 (HI), 52A-55 (H2) and 96-101 (H3) in the V H (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
  • nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region (e.g., nucleotide sequence encoding an antibody described herein or amino acid sequence of an antibody described herein)), when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection, e.g., NCBI web site).
  • a specified region e.g., nucleotide sequence encoding an antibody described herein or amino acid sequence of an antibody described herein
  • sequences are then said to be “substantially identical.”
  • This term also refers to, or can be applied to, the complement of a test sequence.
  • the term also includes sequences that have deletions and/or additions, as well as those that have substitutions.
  • identity exists over a region that is at least about 25 amino acids or nucleotides in length, or 50-100 amino acids or nucleotides in length.
  • the term "intact antibody” or “intact immunoglobulin” means an antibody that has at least two heavy (H) chain polypeptides and two light (L) chain polypeptides interconnected by disulfide bonds.
  • Each heavy chain is comprised of a heavy chain variable region (abbreviated herein as HCVR or V H ) and a heavy chain constant region.
  • the heavy chain constant region is comprised of three domains, CHi, CH 2 and CH 3 .
  • Each light chain is comprised of a light chain variable region (abbreviated herein as LCVR or V L ) and a light chain constant region.
  • the light chain constant region is comprised of one domain, C L .
  • V H and V L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR complementarity determining regions
  • FR framework regions
  • Each V H and V L is composed of three CDRs and four FRs, arranged from amino-terminus to carboxyl-terminus in the following order: FRi, CDRi, FR 2 , CDR 2 , FR 3 , CDR 3 , FR 4 .
  • the variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies can mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • the terms "individual”, “patient”, or “subject” can be an individual organism, a vertebrate, a mammal, or a human. In some embodiments, the individual, patient or subject is a human.
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
  • a monoclonal antibody can be an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.
  • a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
  • Monoclonal antibodies are highly specific, being directed against a single antigenic site.
  • each monoclonal antibody is directed against a single determinant on the antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including, e.g., but not limited to, hybridoma, recombinant, and phage display technologies.
  • the monoclonal antibodies to be used in accordance with the present methods may be made by the hybridoma method first described by Kohler et al, Nature 256:495 (1975), or may be made by recombinant DNA methods ⁇ See, e.g., U.S. Patent No. 4,816,567).
  • the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al, Nature 352:624-628 (1991) and Marks et al, J. Mol. Biol. 222:581-597 (1991), for example.
  • the term "pharmaceutically-acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal compounds, isotonic and absorption delaying compounds, and the like, compatible with pharmaceutical administration.
  • Pharmaceutically-acceptable carriers and their formulations are known to one skilled in the art and are described, for example, in Remington's Pharmaceutical Sciences (20 th edition, ed. A. Gennaro, 2000, Lippincott, Williams & Wilkins, Philadelphia, Pa.).
  • polyclonal antibody means a preparation of antibodies derived from at least two (2) different antibody-producing cell lines. The use of this term includes preparations of at least two (2) antibodies that contain antibodies that specifically bind to different epitopes or regions of an antigen.
  • polynucleotide or “nucleic acid” means any RNA or DNA, which may be unmodified or modified RNA or DNA.
  • Polynucleotides include, without limitation, single- and double-stranded DNA, DNA that is a mixture of single- and double- stranded regions, single- and double-stranded RNA, RNA that is mixture of single- and double- stranded regions, and hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions.
  • polynucleotide refers to triple-stranded regions comprising RNA or DNA or both RNA and DNA.
  • the term polynucleotide also includes DNAs or RNAs containing one or more modified bases and DNAs or RNAs with backbones modified for stability or for other reasons.
  • Polypeptide refers to both short chains, commonly referred to as peptides, glycopeptides or oligomers, and to longer chains, generally referred to as proteins. Polypeptides may contain amino acids other than the 20 gene-encoded amino acids. Polypeptides include amino acid sequences modified either by natural processes, such as post-translational processing, or by chemical modification techniques that are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature.
  • pre-targeted radioimmunotherapy refers to a multistep process that resolves the slow blood clearance of tumor targeting antibodies, which contributes to undesirable toxicity to normal tissues such as bone marrow.
  • a radionuclide or other diagnostic or therapeutic agent is attached to a small hapten.
  • a pre-targeting bispecific antibody which has binding sites for the hapten as well as a target antigen, is administered first. Unbound antibody is then allowed to clear from circulation and the hapten is subsequently administered.
  • the term "recombinant" when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the material is derived from a cell so modified.
  • recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.
  • the term “separate” therapeutic use refers to an administration of at least two active ingredients at the same time or at substantially the same time by different routes.
  • the term “sequential” therapeutic use refers to administration of at least two active ingredients at different times, the administration route being identical or different. More particularly, sequential use refers to the whole administration of one of the active ingredients before administration of the other or others commences. It is thus possible to administer one of the active ingredients over several minutes, hours, or days before
  • telomere binding fragment e.g., an antibody or antigen binding fragment thereof
  • binds refers to a molecule (e.g., an antibody or antigen binding fragment thereof) which recognizes and binds another molecule (e.g., an antigen), but that does not substantially recognize and bind other molecules.
  • telomere binding can be exhibited, for example, by a molecule having a K D for the molecule to which it binds to of about 10 "4 M, 10 "5 M, 10 "6 M, 10 "7 M, 10 “8 M, 10 "9 M, 10 "10 M, 10 "U M, or 10 "12 M.
  • the term "specifically binds” may also refer to binding where a molecule (e.g., an antibody or antigen binding fragment thereof) binds to a particular polypeptide (e.g., an A33 polypeptide), or an epitope on a particular polypeptide, without substantially binding to any other polypeptide, or polypeptide epitope.
  • a molecule e.g., an antibody or antigen binding fragment thereof
  • a particular polypeptide e.g., an A33 polypeptide
  • an epitope on a particular polypeptide without substantially binding to any other polypeptide, or polypeptide epitope.
  • the term “simultaneous” therapeutic use refers to the administration of at least two active ingredients by the same route and at the same time or at substantially the same time.
  • the term "therapeutic agent” is intended to mean a compound that, when present in an effective amount, produces a desired therapeutic effect on a subject in need thereof.
  • Treating covers the treatment of a disease or disorder described herein, in a subject, such as a human, and includes: (i) inhibiting a disease or disorder, i.e., arresting its development; (ii) relieving a disease or disorder, i.e., causing regression of the disorder; (iii) slowing progression of the disorder; and/or (iv) inhibiting, relieving, or slowing progression of one or more symptoms of the disease or disorder.
  • treatment means that the symptoms associated with the disease are, e.g., alleviated, reduced, cured, or placed in a state of remission.
  • the various modes of treatment of disorders as described herein are intended to mean “substantial,” which includes total but also less than total treatment, and wherein some biologically or medically relevant result is achieved.
  • the treatment may be a continuous prolonged treatment for a chronic disease or a single, or few time administrations for the treatment of an acute condition.
  • Amino acid sequence modification(s) of the anti- A33 antibodies described herein are contemplated. For example, it may be desirable to improve the binding affinity and/or other biological properties of the antibody.
  • Amino acid sequence variants of an anti- A33 antibody are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution is made to obtain the antibody of interest, as long as the obtained antibody possesses the desired properties.
  • the modification also includes the change of the pattern of glycosylation of the protein.
  • the sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated. "Conservative substitutions" are shown in the Table below.
  • Tyr (Y) tip phe; thr; ser phe ile; leu; met; phe; ala;
  • substitutional variant involves substituting one or more hypervariable region residues of a parent antibody.
  • a convenient way for generating such substitutional variants involves affinity maturation using phage display. Specifically, several hypervariable region sites (e.g., 6-7 sites) are mutated to generate all possible amino acid substitutions at each site.
  • the antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of Ml 3 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g., binding affinity) as herein disclosed.
  • alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding.
  • CRC is a heterogeneous disease and can be subdivided into 4 consensus molecular subtypes (CMS) based on gene expression analysis, i.e., CMSl-4.
  • CMS consensus molecular subtypes
  • MSI tumors mainly belong to CMS1 (14% of all CRC patients) and are characterized by genome hypermutation and microsatellite instability, due to deficiencies in DNA repair pathways.
  • ICIs function by reinvigorating repressed tumor infiltrating lymphocytes (TILs) to regain tumoricidal capabilities and therefore, MSI tumors are the most responsive CRC tumors to ICIs.
  • TILs tumor infiltrating lymphocytes
  • MSI tumors account for ⁇ 5% of mCRC; for the majority of mCRC, the efficacy of ICIs so far has been disappointing.
  • Peritoneal carcinomatosis is typically the terminal phase of incurable CRC.
  • CRS cytoreduction surgery
  • HIPEC hyperthemic chemotherapy
  • Human Glycoprotein A33 (GPA33 or A33) is a single-pass type I membrane protein that belongs to the CTX family of cell adhesion molecular within the immunoglobulin family. A33 is expressed in 95% of CRC tissues with very restricted expression in normal tissues. A33 comprises one Ig-like C2-type domain and one Ig-like V-type domain. The predicted mature protein includes a single transmembrane domain, an extracellular region and an intracellular tail. A33 plays a role in intracellular traffic, cell-cell recognition/signaling and recycling to the cell surface.
  • the amino acid sequence of the ectodomain of A33 (Ile22-Val235) is provided below:
  • compositions within the scope of the present technology include, e.g., but are not limited to, monoclonal, chimeric, humanized, and diabodies that specifically bind the target polypeptide, a homolog, derivative or a fragment thereof.
  • the present disclosure also provides antigen binding fragments of any of the anti-A33 antibodies disclosed herein, wherein the antigen binding fragment is selected from the group consisting of Fab, F(ab)'2, Fab', scF v , and F v .
  • the present technology provides an antibody or antigen binding fragment thereof comprising a heavy chain immunoglobulin variable domain (V H ) and a light chain immunoglobulin variable domain (V L ), wherein (a) the V H comprises a V H -CDR1 sequence of FTFSTYDMS (SEQ ID NO: 37), a V H -CDR2 sequence of
  • V L comprises a V L -CDR1 sequence, a V L -CDR2 sequence, and a V L - CDR3 sequence selected from the group consisting of: KASQNVRTVVA (SEQ ID NO: 40), LASNRHT (SEQ ID NO: 41), and QYWSYPLT (SEQ ID NO: 42); KASQNVRTVVA (SEQ ID NO: 40), LASDRHT (SEQ ID NO: 43), and QYWSYPLT (SEQ ID NO: 42); KASQNVRTLVA (SEQ ID NO: 44), LASNRHT (SEQ ID NO: 41), and QHWSYPLT (SEQ ID NO: 45); and KASQNVRTLVA (SEQ ID NO: 44), LASNRHT (SEQ ID NO: 41), and QYWSYPLT
  • the antibody further comprises a Fc domain of any isotype, e.g., but are not limited to, IgG (including IgGl, IgG2, IgG3, and IgG4), IgA (including IgAi and IgA 2 ), IgD, IgE, or IgM, and IgY.
  • IgG including IgGl, IgG2, IgG3, and IgG4
  • IgA including IgAi and IgA 2
  • IgD IgE
  • IgM IgM
  • IgY IgY.
  • constant region sequences include:
  • the immunoglobulin-related compositions of the present technology comprise a heavy chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or is 100% identical to SEQ ID NOS: 46-53. Additionally or alternatively, in some embodiments, the immunoglobulin-related compositions of the present technology comprise a light chain constant region that is at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or is 100% identical to SEQ ID NO: 54. In some embodiments, the immunoglobulin-related compositions of the present technology bind to an epitope of an A33 polypeptide comprising at least five to eight consecutive amino acid residues of SEQ ID NO: 57. In some embodiments, the epitope is a conformational epitope.
  • an isolated immunoglobulin-related composition e.g., an antibody or antigen binding fragment thereof
  • a heavy chain (HC) amino acid sequence comprising SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 15, SEQ ID NO: 19, SEQ ID NO: 23, SEQ ID NO: 25, SEQ ID NO: 27, SEQ ID NO: 29, SEQ ID NO: 31, SEQ ID NO: 33, SEQ ID NO: 35, SEQ ID NO: 58, SEQ ID NO: 62, or a variant thereof having one or more conservative amino acid substitutions.
  • the immunoglobulin-related compositions of the present technology comprise a light chain (LC) amino acid sequence comprising SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 17, SEQ ID NO: 21, SEQ ID NO: 24, SEQ ID NO: 26, SEQ ID NO: 28, SEQ ID NO: 30, SEQ ID NO: 32, SEQ ID NO: 34, SEQ ID NO: 36, SEQ ID NO: 60, SEQ ID NO: 63, or a variant thereof having one or more conservative amino acid substitutions.
  • LC light chain
  • the immunoglobulin-related compositions of the present technology comprise a HC amino acid sequence and a LC amino acid sequence selected from the group consisting of: SEQ ID NO: 5 and SEQ ID NO: 9 (3A3-H1/L1); SEQ ID NO: 5 and SEQ ID NO: 10 (3A3-H1/L2); SEQ ID NO: 6 and SEQ ID NO: 9 (3A3-H2/L1); SEQ ID NO: 6 and SEQ ID NO: 10 (3A3-H2/L2); SEQ ID NO: 15 and SEQ ID NO: 17 (huA33-IgGl (H2L2)); SEQ ID NO: 19 and SEQ ID NO: 21 (huA33-BsAb); SEQ ID NO: 23 and SEQ ID NO: 24 (clone 31); SEQ ID NO: 25 and SEQ ID NO: 26 (clone 32); SEQ ID NO: 27 and SEQ ID NO: 28 (clone 48); SEQ ID NO: 29 and SEQ ID NO:
  • the HC and LC immunoglobulin variable domain sequences form an antigen binding site that binds to an epitope of an A33 polypeptide comprising at least five to eight consecutive amino acid residues of the ectodomain of A33 (SEQ ID NO: 57).
  • the epitope is a conformational epitope.
  • the HC and LC immunoglobulin variable domain sequences are components of the same polypeptide chain. In other embodiments, the HC and LC immunoglobulin variable domain sequences are components of different polypeptide chains. In certain embodiments, the antibody is a full-length antibody.
  • the immunoglobulin-related compositions of the present technology bind specifically to at least one A33 polypeptide. In some embodiments, the immunoglobulin-related compositions of the present technology bind at least one A33 polypeptide with a dissociation constant (K D ) of about 10 "3 M, 10 "4 M, 10 "5 M, 10 "6 M, 10 "7 M, 10 “8 M, 10 "9 M, 10 "10 M, 10 "U M, or 10 "12 M. In certain embodiments, the immunoglobulin- related compositions are monoclonal antibodies, chimeric antibodies, humanized antibodies, or bispecific antibodies. In some embodiments, the antibodies comprise a human antibody framework region.
  • the immunoglobulin-related composition includes one or more of the following characteristics: (a) the light chain immunoglobulin variable domain sequence is at least 80%, at least 85%>, at least 90%, at least 95%, or at least 99% identical to the light chain immunoglobulin variable domain sequence present in any one of SEQ ID NOs: 9.
  • one or more amino acid residues in the immunoglobulin-related compositions provided herein are substituted with another amino acid.
  • the substitution may be a "conservative substitution" as defined herein.
  • the immunoglobulin-related composition comprises (a) a LC sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the LC sequence present in any one of SEQ ID NOs: 9. 10, 17, 21, 24, 26, 28, 30, 32, 34, 36, 60, or 63; and/or (b) a HC sequence that is at least 80%, at least 85%, at least 90%, at least 95%, or at least 99% identical to the HC sequence present in any one of SEQ ID NOs: 5, 6, 15, 19, 23, 25, 27, 29, 31, 33, 35, 58 or 62.
  • the immunoglobulin-related compositions contain an IgGl constant region comprising one or more amino acid substitutions selected from the group consisting of N297A and K322A. Additionally or alternatively, in some embodiments, the immunoglobulin-related compositions contain an IgG4 constant region comprising a S228P mutation.
  • the anti-A33 immunoglobulin-related compositions described herein contain structural modifications to facilitate rapid binding and cell uptake and/or slow release.
  • the anti-A33 immunoglobulin-related composition of the present technology e.g., an antibody
  • a Fab fragment is used to facilitate rapid binding and cell uptake and/or slow release.
  • a F(ab)' 2 fragment is used to facilitate rapid binding and cell uptake and/or slow release.
  • the present technology provides a nucleic acid sequence encoding a heavy chain or a light chain of an immunoglobulin-related composition described herein. Also disclosed herein are recombinant nucleic acid sequences encoding any of the antibodies described herein. In some embodiments, the nucleic acid sequence is selected from the group consisting of SEQ ID NOs: 7, 8, 1 1, 12, 16, 18, 20, 22, 59 and 61. In another aspect, the present technology provides a host cell expressing any nucleic acid sequence encoding a heavy chain or a light chain of an immunoglobulin-related composition described herein. [00147]
  • the immunoglobulin-related compositions of the present technology e.g., an anti- A33 antibody
  • Multispecific antibodies can be specific for different epitopes of one or more A33 polypeptides or can be specific for both the A33 polypeptide(s) as well as for heterologous compositions, such as a heterologous polypeptide or solid support material. See, e.g., WO 93/17715; WO 92/08802; WO 91/00360; WO 92/05793; Tutt et al, J. Immunol. 147: 60-69 (1991); U.S. Pat. Nos.
  • the immunoglobulin-related compositions are chimeric. In certain embodiments, the immunoglobulin-related compositions are humanized.
  • the immunoglobulin-related compositions of the present technology can further be recombinantly fused to a heterologous polypeptide at the N- or C-terminus or chemically conjugated (including covalently and non-covalently conjugations) to polypeptides or other compositions.
  • the immunoglobulin-related compositions of the present technology can be recombinantly fused or conjugated to molecules useful as labels in detection assays and effector molecules such as heterologous polypeptides, drugs, or toxins. See, e.g., WO 92/08495; WO 91/14438; WO 89/12624; U.S. Pat. No. 5,314,995; and EP 0 396 387.
  • the antibody or antigen binding fragment may be optionally conjugated to an agent selected from the group consisting of isotopes, dyes, chromagens, contrast agents, drugs, toxins, cytokines, enzymes, enzyme inhibitors, hormones, hormone antagonists, growth factors, radionuclides, metals, liposomes, nanoparticles, RNA, DNA or any combination thereof.
  • an agent selected from the group consisting of isotopes, dyes, chromagens, contrast agents, drugs, toxins, cytokines, enzymes, enzyme inhibitors, hormones, hormone antagonists, growth factors, radionuclides, metals, liposomes, nanoparticles, RNA, DNA or any combination thereof.
  • an agent selected from the group consisting of isotopes, dyes, chromagens, contrast agents, drugs, toxins, cytokines, enzymes, enzyme inhibitors, hormones, hormone antagonists, growth factors, radionuclides, metals, liposomes, nanoparticles
  • the functional groups on the agent and immunoglobulin-related composition can associate directly.
  • a functional group ⁇ e.g., a sulfhydryl group) on an agent can associate with a functional group ⁇ e.g., sulfhydryl group) on an immunoglobulin-related composition to form a disulfide.
  • the functional groups can associate through a cross-linking agent ⁇ i.e., linker).
  • cross-linking agents are described below.
  • the cross-linker can be attached to either the agent or the immunoglobulin-related composition.
  • the number of agents or immunoglobulin-related compositions in a conjugate is also limited by the number of functional groups present on the other. For example, the maximum number of agents associated with a conjugate depends on the number of functional groups present on the immunoglobulin-related composition. Alternatively, the maximum number of immunoglobulin- related compositions associated with an agent depends on the number of functional groups present on the agent.
  • the conjugate comprises one immunoglobulin-related composition associated to one agent.
  • a conjugate comprises at least one agent chemically bonded (e.g., conjugated) to at least one immunoglobulin-related composition.
  • the agent can be chemically bonded to an immunoglobulin-related composition by any method known to those in the art.
  • a functional group on the agent may be directly attached to a functional group on the immunoglobulin-related composition.
  • suitable functional groups include, for example, amino, carboxyl, sulfhydryl, maleimide, isocyanate, isothiocyanate and hydroxyl.
  • the agent may also be chemically bonded to the immunoglobulin-related
  • composition by means of cross-linking agents such as dialdehydes, carbodiimides,
  • Cross-linking agents can, for example, be obtained from Pierce Biotechnology, Inc., Rockford, 111. The Pierce Biotechnology, Inc. web-site can provide assistance. Additional cross-linking agents include the platinum cross-linking agents described in U.S. Pat. Nos. 5,580,990; 5,985,566; and 6, 133,038 of Kreatech Biotechnology, B.V., Amsterdam, The Netherlands.
  • homobifunctional cross-linkers are typically used to cross-link identical functional groups.
  • homobifunctional cross-linkers include EGS (i.e., ethylene glycol bis[succinimidylsuccinate]), DSS (i.e., disuccinimidyl suberate), DMA (i.e., dimethyl adipimidate.2HCl), DTSSP (i.e., 3,3'-dithiobis[sulfosuccinimidylpropionate])), DPDPB (i.e., l,4-di-[3'-(2'-pyridyldithio)-propionamido]butane), and BMH (i.e., bis-maleimidohexane).
  • EGS i.e., ethylene glycol bis[succinimidylsuccinate]
  • DSS i.e., disuccinimidyl suberate
  • DMA i.e.,
  • cleavable linkers include SMPT (i.e., 4- succinimidyloxycarbonyl-methyl-a-[2-pyridyldithio]toluene), Sulfo-LC-SPDP (i.e.,
  • LC-SPDP succinimidyl 6-(3-[2-pyridyldithio]-propionamido)hexanoate
  • Sulfo-LC-SPDP i.e., sulfosuccinimidyl 6-(3- [2-pyridyldithio]-propionamido)hexanoate
  • SPDP i.e., N-succinimidyl 3-[2-pyridyldithio]- propionamidohexanoate
  • AEDP i.e., 3-[(2-aminoethyl)dithio]propionic acid HC1).
  • a conjugate comprises at least one agent physically bonded with at least one immunoglobulin-related composition.
  • Any method known to those in the art can be employed to physically bond the agents with the immunoglobulin-related compositions.
  • the immunoglobulin-related compositions and agents can be mixed together by any method known to those in the art. The order of mixing is not important.
  • agents can be physically mixed with immunoglobulin-related compositions by any method known to those in the art.
  • the immunoglobulin-related compositions and agents can be placed in a container and agitated, by for example, shaking the container, to mix the immunoglobulin-related compositions and agents.
  • the immunoglobulin-related compositions can be modified by any method known to those in the art.
  • the immunoglobulin-related composition may be modified by means of cross-linking agents or functional groups, as described above.
  • a target polypeptide is chosen to which an antibody of the present technology can be raised.
  • an antibody may be raised against the full- length A33 protein, or to a portion of the extracellular domain of the A33 protein.
  • Techniques for generating antibodies directed to such target polypeptides are well known to those skilled in the art. Examples of such techniques include, for example, but are not limited to, those involving display libraries, xeno or human mice, hybridomas, and the like.
  • Target polypeptides within the scope of the present technology include any polypeptide derived from A33 protein containing the extracellular domain which is capable of eliciting an immune response. The preparation of antibodies specific for A33 protein is illustrated in Examples 1, 2, 3, and 5.
  • Anti-A33 antibodies that can be subjected to the techniques set forth herein include monoclonal and polyclonal antibodies, and antibody fragments such as Fab, Fab', F(ab') 2 , Fd, scFv, diabodies, antibody light chains, antibody heavy chains and/or antibody fragments.
  • an antibody is obtained from an originating species. More particularly, the nucleic acid or amino acid sequence of the variable portion of the light chain, heavy chain or both, of an originating species antibody having specificity for a target polypeptide antigen is obtained.
  • An originating species is any species which was useful to generate the antibody of the present technology or library of antibodies, e.g., rat, mouse, rabbit, chicken, monkey, human, and the like.
  • Phage or phagemid display technologies are useful techniques to derive the antibodies of the present technology. Techniques for generating and cloning monoclonal antibodies are well known to those skilled in the art. Expression of sequences encoding antibodies of the present technology, can be carried out in E. coli.
  • nucleic acid coding sequences which encode substantially the same amino acid sequences as those of the naturally occurring proteins may be used in the practice of the present technology
  • nucleic acid sequences including all or portions of the nucleic acid sequences encoding the above polypeptides, which are altered by the substitution of different codons that encode a functionally equivalent amino acid residue within the sequence, thus producing a silent change.
  • nucleotide sequence of an immunoglobulin tolerates sequence homology variations of up to 25% as calculated by standard methods ("Current Methods in Sequence Comparison and Analysis," Macromolecule
  • one or more amino acid residues within a polypeptide sequence can be substituted by another amino acid of a similar polarity which acts as a functional equivalent, resulting in a silent alteration.
  • Substitutes for an amino acid within the sequence may be selected from other members of the class to which the amino acid belongs.
  • the nonpolar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan and methionine.
  • the polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine.
  • the positively charged (basic) amino acids include arginine, lysine and histidine.
  • the negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
  • proteins or fragments or derivatives thereof which are differentially modified during or after translation, e.g., by glycosylation, proteolytic cleavage, linkage to an antibody molecule or other cellular ligands, etc.
  • an immunoglobulin encoding nucleic acid sequence can be mutated in vitro or in vivo to create and/or destroy translation, initiation, and/or termination sequences or to create variations in coding regions and/or form new restriction endonuclease sites or destroy preexisting ones, to facilitate further in vitro modification.
  • Any technique for mutagenesis known in the art can be used, including but not limited to in vitro site directed mutagenesis, J. Biol. Chem. 253 :6551, use of Tab linkers (Pharmacia), and the like.
  • Methods of generating antibodies or antibody fragments of the present technology typically include immunizing a subject (generally a non-human subject such as a mouse or rabbit) with a purified A33 protein or fragment thereof or with a cell expressing the A33 protein or fragment thereof.
  • An appropriate immunogenic preparation can contain, e.g., a recombinantly-expressed A33 protein or a chemically-synthesized A33 peptide.
  • the ECM of A33 protein, or a portion or fragment thereof can be used as an immunogen to generate an anti-A33 antibody that binds to the A33 protein, or a portion or fragment thereof using standard techniques for polyclonal and monoclonal antibody preparation.
  • an A33 fragment comprises at least five to eight consecutive amino acid residues of the amino acid sequence of SEQ ID NO: 57, and
  • A33 protein encompasses an epitope of the A33 protein such that an antibody raised against the peptide forms a specific immune complex with A33 protein.
  • the antigenic A33 peptide overlapping with the A33 ectodomain comprises at least 5, 8, 10, 15, 20, or 30 amino acid residues. Longer antigenic peptides are sometimes desirable over shorter antigenic peptides, depending on use and according to methods well known to those skilled in the art. Multimers of a given epitope are sometimes more effective than a monomer.
  • the immunogenicity of the A33 protein can be increased by fusion or conjugation to a hapten such as keyhole limpet hemocyanin (KLH) or ovalbumin (OVA). Many such haptens are known in the art.
  • KLH keyhole limpet hemocyanin
  • OVA ovalbumin
  • adjuvants used to increase the immunological response include, but are not limited to, Freund's (complete and incomplete), mineral gels (e.g., aluminum hydroxide), surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), human adjuvants such as Bacille Calmette-Guerin and Corynebacterium parvum, or similar immunostimulatory compounds. These techniques are standard in the art.
  • immune responses may be described as either "primary” or "secondary” immune responses.
  • a primary immune response which is also described as a "protective” immune response, refers to an immune response produced in an individual as a result of some initial exposure (e.g., the initial "immunization") to a particular antigen, e.g., A33 protein.
  • the immunization can occur as a result of vaccinating the individual with a vaccine containing the antigen.
  • the vaccine can be an A33 vaccine comprising one or more A33 protein-derived antigens.
  • a primary immune response can become weakened or attenuated over time and can even disappear or at least become so attenuated that it cannot be detected.
  • the present technology also relates to a "secondary" immune response, which is also described here as a “memory immune response.”
  • secondary immune response refers to an immune response elicited in an individual after a primary immune response has already been produced.
  • a secondary immune response can be elicited, e.g., to enhance an existing immune response that has become weakened or attenuated, or to recreate a previous immune response that has either disappeared or can no longer be detected.
  • the secondary or memory immune response can be either a humoral (antibody) response or a cellular response.
  • a secondary or memory humoral response occurs upon stimulation of memory B cells that were generated at the first presentation of the antigen.
  • Delayed type hypersensitivity (DTH) reactions are a type of cellular secondary or memory immune response that are mediated by CD4 + T cells. A first exposure to an antigen primes the immune system and additional exposure(s) results in a DTH.
  • the anti-A33 antibody can be prepared from the subject's serum. If desired, the antibody molecules directed against the A33 protein can be isolated from the mammal (e.g., from the blood) and further purified by well-known techniques, such as polypeptide A chromatography to obtain the IgG fraction.
  • the antibody is an anti- A33 monoclonal antibody.
  • the anti-A33 monoclonal antibody may be a human or a mouse anti-A33 monoclonal antibody.
  • any technique that provides for the production of antibody molecules by continuous cell line culture can be utilized. Such techniques include, but are not limited to, the hybridoma technique (See, e.g., Kohler & Milstein, 1975.
  • amplified sequences also can be fused to DNAs encoding other proteins - e.g., a bacteriophage coat, or a bacterial cell surface protein - for expression and display of the fusion polypeptides on phage or bacteria. Amplified sequences can then be expressed and further selected or isolated based, e.g., on the affinity of the expressed antibody or fragment thereof for an antigen or epitope present on the A33 protein.
  • hybridomas expressing anti-A33 monoclonal antibodies can be prepared by immunizing a subject and then isolating hybridomas from the subject's spleen using routine methods.
  • a selected monoclonal antibody with the desired properties can be used as expressed by the hybridoma, it can be bound to a molecule such as polyethylene glycol (PEG) to alter its properties, or a cDNA encoding it can be isolated, sequenced and manipulated in various ways.
  • PEG polyethylene glycol
  • Synthetic dendromeric trees can be added to reactive amino acid side chains, e.g., lysine, to enhance the immunogenic properties of A33 protein.
  • CPG-dinucleotide techniques can be used to enhance the immunogenic properties of the A33 protein.
  • Other manipulations include substituting or deleting particular amino acyl residues that contribute to instability of the antibody during storage or after administration to a subject, and affinity maturation techniques to improve affinity of the antibody of the A33 protein.
  • the antibody of the present technology is an anti-A33 monoclonal antibody produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
  • Hybridoma techniques include those known in the art and taught in Harlow et al, Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory, Cold Spring Harbor, NY, 349 (1988); Hammerling et al, Monoclonal Antibodies And T-Cell Hybridomas, 563-681 (1981). Other methods for producing hybridomas and monoclonal antibodies are well known to those of skill in the art.
  • the antibodies of the present technology can be produced through the application of recombinant DNA and phage display technology.
  • anti-A33 antibodies can be prepared using various phage display methods known in the art.
  • phage display methods functional antibody domains are displayed on the surface of a phage particle which carries polynucleotide sequences encoding them.
  • Phages with a desired binding property are selected from a repertoire or combinatorial antibody library (e.g., human or murine) by selecting directly with an antigen, typically an antigen bound or captured to a solid surface or bead.
  • Phages used in these methods are typically filamentous phage including fd and M13 with Fab, Fv or disulfide stabilized Fv antibody domains that are recombinantly fused to either the phage gene III or gene VIII protein.
  • methods can be adapted for the construction of Fab expression libraries (See, e.g., Huse, et al.,. Science 246: 1275-1281, 1989) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for an A33 polypeptide, e.g., a polypeptide or derivatives, fragments, analogs or homologs thereof.
  • the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host including mammalian cells, insect cells, plant cells, yeast, and bacteria.
  • techniques to recombinantly produce Fab, Fab' and F(ab') 2 fragments can also be employed using methods known in the art such as those disclosed in WO 92/22324; Mullinax et al, BioTechniques 12: 864-869, 1992; and Sawai et al, AJRI 34: 26-34, 1995; and Better et al, Science 240: 1041-1043, 1988.
  • hybrid antibodies or hybrid antibody fragments that are cloned into a display vector can be selected against the appropriate antigen in order to identify variants that maintain good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle. See, e.g., Barbas III et al, Phage Display, A Laboratory Manual (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 2001).
  • vector formats could be used for this process, such as cloning the antibody fragment library into a lytic phage vector (modified T7 or Lambda Zap systems) for selection and/or screening.
  • Recombinant polynucleotide constructs encoding an anti-A33 antibody of the present technology typically include an expression control sequence operably-linked to the coding sequences of anti -A33 antibody chains, including naturally-associated or heterologous promoter regions.
  • another aspect of the technology includes vectors containing one or more nucleic acid sequences encoding an anti-A33 antibody of the present technology.
  • the nucleic acid containing all or a portion of the nucleotide sequence encoding the anti-A33 antibody is inserted into an appropriate cloning vector, or an expression vector (i.e., a vector that contains the necessary elements for the transcription and translation of the inserted polypeptide coding sequence) by recombinant DNA techniques well known in the art and as detailed below.
  • expression vectors useful in recombinant DNA techniques are often in the form of plasmids.
  • "plasmid” and “vector” can be used interchangeably as the plasmid is the most commonly used form of vector.
  • the present technology is intended to include such other forms of expression vectors that are not technically plasmids, such as viral vectors ⁇ e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.
  • viral vectors permit infection of a subject and expression of a construct in that subject.
  • the expression control sequences are eukaryotic promoter systems in vectors capable of transforming or transfecting eukaryotic host cells.
  • the host is maintained under conditions suitable for high level expression of the nucleotide sequences encoding the anti- A33 antibody, and the collection and purification of the anti- A33 antibody, e.g., cross-reacting anti-A33 antibodies.
  • These expression vectors are typically replicable in the host organisms either as episomes or as an integral part of the host chromosomal DNA.
  • expression vectors contain selection markers, e.g., ampicillin-resistance or hygromycin-resi stance, to permit detection of those cells transformed with the desired DNA sequences.
  • Vectors can also encode signal peptide, e.g., pectate lyase, useful to direct the secretion of extracellular antibody fragments. See U.S. Pat. No. 5,576, 195.
  • the recombinant expression vectors of the present technology comprise a nucleic acid encoding a protein with A33 binding properties in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression that is operably-linked to the nucleic acid sequence to be expressed.
  • operably-linked is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
  • regulatory sequence is intended to include promoters, enhancers and other expression control elements ⁇ e.g., polyadenylation signals). Such regulatory sequences are described, e.g., in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN
  • Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells ⁇ e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of polypeptide desired, etc.
  • Typical regulatory sequences useful as promoters of recombinant polypeptide expression ⁇ e.g., anti-A33 antibody), include, e.g., but are not limited to, promoters of 3 -phosphogly cerate kinase and other glycolytic enzymes.
  • Inducible yeast promoters include, among others, promoters from alcohol dehydrogenase, isocytochrome C, and enzymes responsible for maltose and galactose utilization.
  • a polynucleotide encoding an anti-A33 antibody of the present technology is operably-linked to an ara B promoter and expressible in a host cell. See U.S. Pat. 5,028,530.
  • the expression vectors of the present technology can be introduced into host cells to thereby produce polypeptides or peptides, including fusion polypeptides, encoded by nucleic acids as described herein ⁇ e.g., anti- A33 antibody, etc.).
  • anti-A33 antibody-expressing host cells which contain a nucleic acid encoding one or more anti-A33 antibodies.
  • the recombinant expression vectors of the present technology can be designed for expression of an anti-A33 antibody in prokaryotic or eukaryotic cells.
  • an anti-A33 antibody can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors), fungal cells, e.g., yeast, yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN
  • recombinant expression vector can be transcribed and translated in vitro, e.g., using T7 promoter regulatory sequences and T7 polymerase.
  • T7 promoter regulatory sequences and T7 polymerase Methods useful for the preparation and screening of polypeptides having a predetermined property, e.g., anti-A33 antibody, via expression of stochastically generated polynucleotide sequences has been previously described. See U.S. Pat. Nos. 5,763,192; 5,723,323; 5,814,476; 5,817,483; 5,824,514; 5,976,862; 6,492, 107; 6,569,641.
  • Fusion vectors add a number of amino acids to a polypeptide encoded therein, usually to the amino terminus of the recombinant polypeptide.
  • Such fusion vectors typically serve three purposes: (i) to increase expression of recombinant polypeptide; (ii) to increase the solubility of the recombinant polypeptide; and (iii) to aid in the purification of the recombinant polypeptide by acting as a ligand in affinity purification.
  • a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant polypeptide to enable separation of the recombinant polypeptide from the fusion moiety subsequent to purification of the fusion polypeptide.
  • enzymes, and their cognate recognition sequences include Factor Xa, thrombin and enterokinase.
  • Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988.
  • GST glutathione S-transferase
  • Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amrann et al, (1988) Gene 69: 301-315) and pET l id (Studier et al, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89). Methods for targeted assembly of distinct active peptide or protein domains to yield multifunctional polypeptides via polypeptide fusion has been described by Pack et al, U.S. Pat. Nos. 6,294,353; 6,692,935.
  • One strategy to maximize recombinant polypeptide expression, e.g., an anti-A33 antibody, in E. coli is to express the polypeptide in host bacteria with an impaired capacity to proteolytically cleave the recombinant polypeptide. See, e.g., Gottesman, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 119-128.
  • Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in the expression host, e.g., E. coli ⁇ See, e.g., Wada, et al, 1992. Nucl. Acids Res. 20: 2111-2118). Such alteration of nucleic acid sequences of the present technology can be carried out by standard DNA synthesis techniques.
  • the anti-A33 antibody expression vector is a yeast expression vector.
  • yeast expression vectors for expression in yeast Saccharomyces cerevisiae include pYepSecl (Baldari, et al, 1987. EMBO J. 6: 229-234), pMFa (Kurjan and Herskowitz, Cell 30: 933-943, 1982), pJRY88 (Schultz et al, Gene 54: 113-123, 1987), pYES2 (Invitrogen
  • an anti-A33 antibody can be expressed in insect cells using baculovirus expression vectors.
  • Baculovirus vectors available for expression of polypeptides include the pAc series (Smith, et al., Mol. Cell. Biol. 3 : 2156-2165, 1983) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).
  • a nucleic acid encoding an anti-A33 antibody of the present technology is expressed in mammalian cells using a mammalian expression vector.
  • mammalian expression vectors include, e.g., but are not limited to, pCDM8 (Seed, Nature 329: 840, 1987) and pMT2PC (Kaufman, et al, EMBO J. 6: 187-195, 1987).
  • the expression vector's control functions are often provided by viral regulatory elements.
  • commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, and simian virus 40.
  • the recombinant mammalian expression vector is capable of directing expression of the nucleic acid in a particular cell type ⁇ e.g., tissue-specific regulatory elements).
  • tissue-specific regulatory elements are known in the art.
  • suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al, Genes Dev. 1 : 268-277, 1987), lymphoid-specific promoters (Calame and Eaton, Adv. Immunol. 43 : 235-275, 1988), promoters of T cell receptors (Winoto and Baltimore, EMBO J.
  • promoters are also encompassed, e.g., the murine hox promoters (Kessel and Gruss, Science 249: 374-379, 1990) and the a-fetoprotein promoter (Campes and Tilghman, Genes Dev. 3 : 537-546, 1989).
  • host cell and "recombinant host cell” are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.
  • a host cell can be any prokaryotic or eukaryotic cell.
  • an anti-A33 antibody can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells.
  • Mammalian cells are a suitable host for expressing nucleotide segments encoding immunoglobulins or fragments thereof. See Winnacker, From Genes To Clones, (VCH
  • suitable host cell lines capable of secreting intact heterologous proteins have been developed in the art, and include Chinese hamster ovary (CHO) cell lines, various COS cell lines, HeLa cells, L cells and myeloma cell lines.
  • the cells are non-human.
  • Expression vectors for these cells can include expression control sequences, such as an origin of replication, a promoter, an enhancer, and necessary processing information sites, such as ribosome binding sites, RNA splice sites, polyadenylation sites, and transcriptional terminator sequences. Queen et al, Immunol. Rev. 89: 49, 1986.
  • Illustrative expression control sequences are promoters derived from endogenous genes, cytomegalovirus, SV40, adenovirus, bovine papillomavirus, and the like. Co et al, J Immunol. 148: 1149, 1992. Other suitable host cells are known to those skilled in the art.
  • Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques.
  • transformation and “transfection” are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid ⁇ e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, electroporation, biolistics or viral-based transfection.
  • Other methods used to transform mammalian cells include the use of polybrene, protoplast fusion, liposomes, electroporation, and microinjection ⁇ See generally, Sambrook et al, Molecular Cloning). Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (MOLECULAR CLONING: A
  • the vectors containing the DNA segments of interest can be transferred into the host cell by well-known methods, depending on the type of cellular host.
  • a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest.
  • selectable markers include those that confer resistance to drugs, such as G418, hygromycin and methotrexate.
  • Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding the anti- A33 antibody or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
  • a host cell that includes an anti-A33 antibody of the present technology can be used to produce (i.e., express) recombinant anti-A33 antibody.
  • the method comprises culturing the host cell (into which a recombinant expression vector encoding the anti-A33 antibody has been introduced) in a suitable medium such that the anti-A33 antibody is produced.
  • the method further comprises the step of isolating the anti-A33 antibody from the medium or the host cell.
  • collections of the anti-A33 antibody e.g., the anti-A33 antibodies or the anti-A33 antibody-related polypeptides are purified from culture media and host cells.
  • the anti-A33 antibody can be purified according to standard procedures of the art, including HPLC purification, column chromatography, gel electrophoresis and the like.
  • the anti-A33 antibody is produced in a host organism by the method of Boss et al, U.S. Pat. No. 4,816,397.
  • anti-A33 antibody chains are expressed with signal sequences and are thus released to the culture media.
  • the anti-A33 antibody chains can be released by treatment with mild detergent.
  • Purification of recombinant polypeptides is well known in the art and includes ammonium sulfate precipitation, affinity chromatography purification technique, column chromatography, ion exchange purification technique, gel electrophoresis and the like (See generally Scopes, Protein Purification (Springer- Verlag, N.Y., 1982).
  • polynucleotides encoding anti-A33 antibodies can be incorporated in transgenes for introduction into the genome of a transgenic animal and subsequent expression in the milk of the transgenic animal. See, e.g., U.S. Pat. Nos. 5,741,957, 5,304,489, and 5,849,992.
  • Suitable transgenes include coding sequences for light and/or heavy chains in operable linkage with a promoter and enhancer from a mammary gland specific gene, such as casein or ⁇ -lactoglobulin.
  • transgenes can be microinjected into fertilized oocytes, or can be incorporated into the genome of embryonic stem cells, and the nuclei of such cells transferred into enucleated oocytes.
  • the anti-A33 antibody of the present technology is a single-chain anti-A33 antibody.
  • techniques can be adapted for the production of single-chain antibodies specific to an A33 protein ⁇ See, e.g., U.S. Pat. No. 4,946,778). Examples of techniques which can be used to produce single-chain Fvs and antibodies of the present technology include those described in U.S. Pat. Nos. 4,946,778 and 5,258,498; Huston et al, Methods in Enzymology, 203 : 46-88, 1991; Shu, L. et al, Proc. Natl. Acad. Sci. USA, 90: 7995-7999, 1993; and Skerra et al, Science 240: 1038-1040, 1988.
  • the anti- A33 antibody of the present technology is a chimeric anti-A33 antibody.
  • the anti-A33 antibody of the present technology is a humanized anti-A33 antibody.
  • the donor and acceptor antibodies are monoclonal antibodies from different species.
  • the acceptor antibody is a human antibody (to minimize its antigenicity in a human), in which case the resulting CDR-grafted antibody is termed a "humanized" antibody.
  • Recombinant anti-A33 antibodies such as chimeric and humanized monoclonal antibodies, comprising both human and non-human portions, can be made using standard recombinant DNA techniques, and are within the scope of the present technology.
  • chimeric and humanized monoclonal antibodies can be produced by recombinant DNA techniques known in the art. Such useful methods include, e.g., but are not limited to, methods described in International Application No. PCT/US86/02269; U.S. Pat. No.
  • antibodies can be humanized using a variety of techniques including CDR-grafting (EP 0 239 400; WO 91/09967; U.S. Pat. No. 5,530, 101; 5,585,089; 5,859,205; 6,248,516; EP460167), veneering or resurfacing (EP 0 592 106; EP 0 519 596;
  • a cDNA encoding a murine anti-A33 monoclonal antibody is digested with a restriction enzyme selected specifically to remove the sequence encoding the Fc constant region, and the equivalent portion of a cDNA encoding a human Fc constant region is substituted
  • the present technology provides the construction of humanized anti-A33 antibodies that are unlikely to induce a human anti-mouse antibody (hereinafter referred to as "HAMA") response, while still having an effective antibody effector function.
  • HAMA human anti-mouse antibody
  • the terms "human” and “humanized”, in relation to antibodies relate to any antibody which is expected to elicit a therapeutically tolerable weak immunogenic response in a human subject.
  • the present technology provides for a humanized anti-A33 antibodies, heavy and light chain immunoglobulins.
  • the anti-A33 antibody of the present technology is an anti-A33 CDR antibody.
  • the donor and acceptor antibodies used to generate the anti-A33 CDR antibody are monoclonal antibodies from different species; typically the acceptor antibody is a human antibody (to minimize its antigenicity in a human), in which case the resulting CDR-grafted antibody is termed a "humanized" antibody.
  • the graft may be of a single CDR (or even a portion of a single CDR) within a single V H or V L of the acceptor antibody, or can be of multiple CDRs (or portions thereof) within one or both of the V H and V L .
  • either or both the heavy and light chain variable regions are produced by grafting the CDRs from the originating species into the hybrid framework regions.
  • Assembly of hybrid antibodies or hybrid antibody fragments having hybrid variable chain regions with regard to either of the above aspects can be accomplished using conventional methods known to those skilled in the art.
  • DNA sequences encoding the hybrid variable domains described herein ⁇ i.e., frameworks based on the target species and CDRs from the originating species can be produced by oligonucleotide synthesis and/or PCR.
  • the nucleic acid encoding CDR regions can also be isolated from the originating species antibodies using suitable restriction enzymes and ligated into the target species framework by ligating with suitable ligation enzymes.
  • the framework regions of the variable chains of the originating species antibody can be changed by site-directed mutagenesis.
  • hybrids are constructed from choices among multiple candidates corresponding to each framework region, there exist many combinations of sequences which are amenable to construction in accordance with the principles described herein. Accordingly, libraries of hybrids can be assembled having members with different combinations of individual framework regions. Such libraries can be electronic database collections of sequences or physical collections of hybrids.
  • This process typically does not alter the acceptor antibody's FRs flanking the grafted CDRs.
  • one skilled in the art can sometimes improve antigen binding affinity of the resulting anti-A33 CDR-grafted antibody by replacing certain residues of a given FR to make the FR more similar to the corresponding FR of the donor antibody. Suitable locations of the substitutions include amino acid residues adjacent to the CDR, or which are capable of interacting with a CDR ⁇ See, e.g., US 5,585,089, especially columns 12-16).
  • one skilled in the art can start with the donor FR and modify it to be more similar to the acceptor FR or a human consensus FR. Techniques for making these modifications are known in the art.
  • the resulting FR fits a human consensus FR for that position, or is at least 90% or more identical to such a consensus FR, doing so may not increase the antigenicity of the resulting modified anti-A33 CDR-grafted antibody significantly compared to the same antibody with a fully human FR.
  • Bispecifw Antibodies A bispecific antibody is an antibody that can bind simultaneously to two targets that have a distinct structure, e.g., two different target antigens, two different epitopes on the same target antigen, or a hapten and a target antigen or epitope on a target antigen.
  • BsAbs can be made, for example, by combining heavy chains and/or light chains that recognize different epitopes of the same or different antigen.
  • a bispecific binding agent binds one antigen (or epitope) on one of its two binding arms (one VH/VL pair), and binds a different antigen (or epitope) on its second arm (a different VH/VL pair).
  • a bispecific binding agent has two distinct antigen binding arms (in both specificity and CDR sequences), and is monovalent for each antigen to which it binds.
  • Bispecific antibodies (BsAb) and bispecific antibody fragments (BsFab) of the present technology have at least one arm that specifically binds to, for example, A33 and at least one other arm that specifically binds to a second target antigen.
  • the second target antigen is an antigen or epitope of a B-cell, a T-cell, a myeloid cell, a plasma cell, or a mast-cell.
  • the second target antigen is selected from the group consisting of CD3, CD4, CD8, CD20, CD19, CD21, CD23, CD46, CD80, HLA-DR, CD74, CD22, CD14, CD15, CD16, CD123, TCR gamma/delta, Kp46 and KIR.
  • the BsAbs are capable of binding to tumor cells that express A33 antigen on the cell surface.
  • the BsAbs have been engineered to facilitate killing of tumor cells by directing (or recruiting) cytotoxic T cells to a tumor site.
  • exemplary BsAbs include those with a first antigen binding site specific for A33 and a second antigen binding site specific for a small molecule hapten ⁇ e.g., DTP A, IMP288, DOTA, DOTA- Bn, DOTA-desferrioxamine, other DOTA-chelates described herein, Biotin, fluorescein, or those disclosed in Goodwin, D A. et al, 1994, Cancer Res. 54(22):5937-5946).
  • a small molecule hapten e.g., DTP A, IMP288, DOTA, DOTA- Bn, DOTA-desferrioxamine, other DOTA-chelates described herein, Biotin, fluorescein, or those disclosed in Goodwin, D A. et al, 1994, Cancer Res. 54(22):5937-5946).
  • bispecific fusion proteins can be produced using molecular engineering.
  • BsAbs have been constructed that either utilize the full immunoglobulin framework ⁇ e.g., IgG), single chain variable fragment (scFv), or combinations thereof.
  • the bispecific fusion protein is divalent, comprising, for example, a scFv with a single binding site for one antigen and a Fab fragment with a single binding site for a second antigen.
  • the bispecific fusion protein is tetravalent, comprising, for example, an immunoglobulin ⁇ e.g., IgG) with two binding sites for one antigen and two identical scFv for a second antigen.
  • BsAbs composed of two scFv units in tandem have been shown to be a clinically successful bispecific antibody format.
  • BsAbs comprise two single chain variable fragments (scFvs) in tandem have been designed such that an scFv that binds a tumor antigen (e.g., A33) is linked with an scFv that engages T cells (e.g., by binding CD3).
  • a tumor antigen e.g., A33
  • T cells e.g., by binding CD3
  • Recent methods for producing BsAbs include engineered recombinant monoclonal antibodies which have additional cysteine residues so that they crosslink more strongly than the more common immunoglobulin isotypes. See, e.g., FitzGerald et al., Protein Eng. 10(10): 1221- 1225 (1997). Another approach is to engineer recombinant fusion proteins linking two or more different single-chain antibody or antibody fragment segments with the needed dual specificities. See, e.g., Coloma et al., Nature Biotech. 15: 159-163 (1997). A variety of bispecific fusion proteins can be produced using molecular engineering.
  • a BsAb according to the present technology comprises an immunoglobulin, which immunoglobulin comprises a heavy chain and a light chain, and an scFv.
  • the scFv is linked to the C- terminal end of the heavy chain of any A33 immunoglobulin disclosed herein.
  • scFvs are linked to the C-terminal end of the light chain of any A33
  • scFvs are linked to heavy or light chains via a linker sequence.
  • Appropriate linker sequences necessary for the in-frame connection of the heavy chain Fd to the scFv are introduced into the V L and Vkappa domains through PCR reactions.
  • the DNA fragment encoding the scFv is then ligated into a staging vector containing a DNA sequence encoding the CHI domain.
  • the resulting scFv-CHl construct is excised and ligated into a vector containing a DNA sequence encoding the V H region of an A33 antibody.
  • the resulting vector can be used to transfect an appropriate host cell, such as a mammalian cell for the expression of the bispecific fusion protein.
  • a linker is at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more amino acids in length.
  • a linker is characterized in that it tends not to adopt a rigid three-dimensional structure, but rather provides flexibility to the polypeptide (e.g., first and/or second antigen binding sites).
  • a linker is employed in a BsAb described herein based on specific properties imparted to the BsAb such as, for example, an increase in stability.
  • a BsAb of the present technology comprises a G 4 S linker. In some certain embodiments, a BsAb of the present technology comprises a (G 4 S) n linker, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15 or more.
  • the anti-A33 antibodies of the present technology comprise a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild-type Fc region (or the parental Fc region), such that said molecule has an altered affinity for an Fc receptor ⁇ e.g., an FcyR), provided that said variant Fc region does not have a substitution at positions that make a direct contact with Fc receptor based on crystallographic and structural analysis of Fc-Fc receptor interactions such as those disclosed by Sondermann et al., Nature, 406:267-273 (2000).
  • positions within the Fc region that make a direct contact with an Fc receptor such as an FcyR include amino acids 234-239 (hinge region), amino acids 265-269 (B/C loop), amino acids 297-299 (C7E loop), and amino acids 327-332 (F/G) loop.
  • an anti-A33 antibody of the present technology has an altered affinity for activating and/or inhibitory receptors, having a variant Fc region with one or more amino acid modifications, wherein said one or more amino acid modification is a N297 substitution with alanine, or a K322 substitution with alanine.
  • anti-A33 antibodies of the present technology have an Fc region with variant glycosylation as compared to a parent Fc region.
  • variant glycosylation includes the absence of fucose; in some embodiments, variant glycosylation results from expression in GnTl -deficient CHO cells.
  • the antibodies of the present technology may have a modified glycosylation site relative to an appropriate reference antibody that binds to an antigen of interest ⁇ e.g., A33), without altering the functionality of the antibody, e.g., binding activity to the antigen.
  • glycosylation sites include any specific amino acid sequence in an antibody to which an oligosaccharide ⁇ i.e., carbohydrates containing two or more simple sugars linked together) will specifically and covalently attach.
  • Oligosaccharide side chains are typically linked to the backbone of an antibody via either N-or O-linkages.
  • N-linked glycosylation refers to the attachment of an oligosaccharide moiety to the side chain of an asparagine residue.
  • O-linked glycosylation refers to the attachment of an oligosaccharide moiety to a hydroxyamino acid, e.g., serine, threonine.
  • an Fc- glycoform huA33-IgGln
  • that lacks certain oligosaccharides including fucose and terminal N- acetylglucosamine may be produced in special CHO cells and exhibit enhanced ADCC effector function.
  • the carbohydrate content of an immunoglobulin-related composition disclosed herein is modified by adding or deleting a glycosylation site.
  • Methods for modifying the carbohydrate content of antibodies are well known in the art and are included within the present technology, see, e.g., U.S. Patent No. 6,218, 149; EP 0359096B1 ; U.S. Patent Publication No. US 2002/0028486; International Patent Application Publication WO 03/035835; U.S. Patent Publication No. 2003/0115614; U.S. Patent No. 6,218,149; U.S. Patent No.
  • the carbohydrate content of an antibody is modified by deleting one or more endogenous carbohydrate moieties of the antibody.
  • the present technology includes deleting the glycosylation site of the Fc region of an antibody, by modifying position 297 from asparagine to alanine.
  • Engineered glycoforms may be useful for a variety of purposes, including but not limited to enhancing or reducing effector function.
  • Engineered glycoforms may be generated by any method known to one skilled in the art, for example by using engineered or variant expression strains, by co-expression with one or more enzymes, for example DI N- acetylglucosaminyltransferase III (GnTIII), by expressing a molecule comprising an Fc region in various organisms or cell lines from various organisms, or by modifying carbohydrate(s) after the molecule comprising Fc region has been expressed.
  • GnTIII DI N- acetylglucosaminyltransferase III
  • the anti-A33 antibody of the present technology is a fusion protein.
  • the anti-A33 antibodies of the present technology when fused to a second protein, can be used as an antigenic tag.
  • domains that can be fused to polypeptides include not only heterologous signal sequences, but also other heterologous functional regions. The fusion does not necessarily need to be direct, but can occur through linker sequences.
  • fusion proteins of the present technology can also be engineered to improve characteristics of the anti-A33 antibodies. For instance, a region of additional amino acids, particularly charged amino acids, can be added to the N-terminus of the anti-A33 antibody to improve stability and persistence during purification from the host cell or subsequent handling and storage.
  • peptide moieties can be added to an anti-A33 antibody to facilitate purification. Such regions can be removed prior to final preparation of the anti-A33 antibody.
  • the addition of peptide moieties to facilitate handling of polypeptides are familiar and routine techniques in the art.
  • the anti-A33 antibody of the present technology can be fused to marker sequences, such as a peptide which facilitates purification of the fused polypeptide.
  • the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., Chatsworth, Calif), among others, many of which are commercially available. As described in Gentz et al, Proc. Natl. Acad. Sci.
  • hexa-histidine provides for convenient purification of the fusion protein.
  • Another peptide tag useful for purification, the "HA" tag corresponds to an epitope derived from the influenza hemagglutinin protein. Wilson et al., Cell 37: 767, 1984.
  • any of these above fusion proteins can be engineered using the polynucleotides or the polypeptides of the present technology. Also, in some embodiments, the fusion proteins described herein show an increased half-life in vivo.
  • Fusion proteins having disulfide-linked dimeric structures can be more efficient in binding and neutralizing other molecules compared to the monomelic secreted protein or protein fragment alone.
  • EP-A-0 464 533 (Canadian counterpart 2045869) discloses fusion proteins comprising various portions of constant region of immunoglobulin molecules together with another human protein or a fragment thereof.
  • the Fc part in a fusion protein is beneficial in therapy and diagnosis, and thus can result in, e.g., improved pharmacokinetic properties. See EP-A 0232 262.
  • deleting or modifying the Fc part after the fusion protein has been expressed, detected, and purified, may be desired.
  • the Fc portion can hinder therapy and diagnosis if the fusion protein is used as an antigen for immunizations.
  • the anti-A33 antibody of the present technology is coupled with a label moiety, i.e., detectable group.
  • the particular label or detectable group conjugated to the anti-A33 antibody is not a critical aspect of the technology, so long as it does not significantly interfere with the specific binding of the anti-A33 antibody of the present technology to the A33 protein.
  • the detectable group can be any material having a detectable physical or chemical property.
  • Such detectable labels have been well-developed in the field of immunoassays and imaging. In general, almost any label useful in such methods can be applied to the present technology.
  • a label is any composition detectable by
  • Labels useful in the practice of the present technology include magnetic beads (e.g., DynabeadsTM), fluorescent dyes (e.g., fluorescein isothiocyanate, Texas red, rhodamine, and the like), radiolabels (e.g., 3 H, 14 C, 35 S, 125 I, 121 I, 131 I, 112 In, 99 mTc), other imaging agents such as microbubbles (for ultrasound imaging), 18 F, U C, 15 0, (for Positron emission tomography), 99m TC, lu In (for Single photon emission tomography), enzymes (e.g., horse radish peroxidase, alkaline phosphatase and others commonly used in an ELISA), and calorimetric labels such as colloidal gold or colored glass or plastic (e.g., polystyrene, polypropylene, latex, and the like) beads.
  • fluorescent dyes e.g., fluorescein isothiocyanate, Texas
  • Patents that describe the use of such labels include U.S. Pat. Nos. 3,817,837; 3,850,752;
  • the label can be coupled directly or indirectly to the desired component of an assay according to methods well known in the art. As indicated above, a wide variety of labels can be used, with the choice of label depending on factors such as required sensitivity, ease of conjugation with the compound, stability requirements, available instrumentation, and disposal provisions.
  • Non-radioactive labels are often attached by indirect means.
  • a ligand molecule e.g., biotin
  • the ligand then binds to an anti- ligand (e.g., streptavidin) molecule which is either inherently detectable or covalently bound to a signal system, such as a detectable enzyme, a fluorescent compound, or a chemiluminescent compound.
  • an anti- ligand e.g., streptavidin
  • a ligand has a natural anti -ligand, e.g., biotin, thyroxine, and Cortisol, it can be used in conjunction with the labeled, naturally-occurring anti-ligands.
  • any haptenic or antigenic compound can be used in combination with an antibody, e.g., an anti-A33 antibody.
  • the molecules can also be conjugated directly to signal generating compounds, e.g., by conjugation with an enzyme or fluorophore.
  • Enzymes of interest as labels will primarily be hydrolases, particularly phosphatases, esterases and glycosidases, or oxidoreductases, particularly peroxidases.
  • Fluorescent compounds useful as labeling moieties include, but are not limited to, e.g., fluorescein and its derivatives, rhodamine and its derivatives, dansyl,
  • Chemiluminescent compounds useful as labeling moieties include, but are not limited to, e.g., luciferin, and 2,3-dihydrophthalazinediones, e.g., luminol.
  • Means of detecting labels are well known to those of skill in the art.
  • means for detection include a scintillation counter or photographic film as in autoradiography.
  • the label is a fluorescent label, it can be detected by exciting the fluorochrome with the appropriate wavelength of light and detecting the resulting fluorescence.
  • the fluorescence can be detected visually, by means of photographic film, by the use of electronic detectors such as charge coupled devices (CCDs) or
  • agglutination assays can be used to detect the presence of the target antibodies, e.g., the anti-A33 antibodies.
  • antigen-coated particles are agglutinated by samples comprising the target antibodies.
  • none of the components need be labeled and the presence of the target antibody is detected by simple visual inspection.
  • Methods for identifying and/or screening the anti-A33 antibodies of the present technology include any immunologically-mediated techniques known within the art. Components of an immune response can be detected in vitro by various methods that are well known to those of ordinary skill in the art.
  • cytotoxic T lymphocytes can be incubated with radioactively labeled target cells and the lysis of these target cells detected by the release of radioactivity;
  • helper T lymphocytes can be incubated with antigens and antigen presenting cells and the synthesis and secretion of cytokines measured by standard methods (Windhagen A et al, Immunity, 2: 373-80, 1995);
  • antigen presenting cells can be incubated with whole protein antigen and the presentation of that antigen on MHC detected by either T lymphocyte activation assays or biophysical methods (Harding et al, Proc. Natl. Acad.
  • mast cells can be incubated with reagents that cross-link their Fc-epsilon receptors and histamine release measured by enzyme immunoassay (Siraganian et al, TIPS, 4: 432-437, 1983); and (5) enzyme-linked immunosorbent assay
  • products of an immune response in either a model organism (e.g., mouse) or a human subject can also be detected by various methods that are well known to those of ordinary skill in the art.
  • a model organism e.g., mouse
  • a human subject can also be detected by various methods that are well known to those of ordinary skill in the art.
  • the production of antibodies in response to vaccination can be readily detected by standard methods currently used in clinical laboratories, e.g., an ELISA
  • the migration of immune cells to sites of inflammation can be detected by scratching the surface of skin and placing a sterile container to capture the migrating cells over scratch site (Peters et al., Blood, 72: 1310-5, 1988)
  • the proliferation of peripheral blood mononuclear cells (PBMCs) in response to mitogens or mixed lymphocyte reaction can be measured using 3 H- thymidine
  • the phagocytic capacity of granulocytes, macrophages, and other phagocytes in PBMCs can be measured by placing
  • anti-A33 antibodies of the present technology are selected using display of A33 peptides on the surface of replicable genetic packages. See, e.g., U.S. Pat. Nos. 5,514,548; 5,837,500; 5,871,907; 5,885,793; 5,969,108; 6,225,447; 6,291,650; 6,492, 160;
  • anti-A33 antibodies of the present technology are selected using display of A33 peptides on the surface of a yeast host cell. Methods useful for the isolation of scFv polypeptides by yeast surface display have been described by Kieke et al, Protein Eng. 1997 Nov; 10(11): 1303-10.
  • anti-A33 antibodies of the present technology are selected using ribosome display.
  • Methods useful for identifying ligands in peptide libraries using ribosome display have been described by Mattheakis et al, Proc. Natl. Acad. Sci. USA 91 : 9022- 26, 1994; and Hanes et al, Proc. Natl. Acad. Sci. USA 94: 4937-42, 1997.
  • anti-A33 antibodies of the present technology are selected using tRNA display of A33 peptides. Methods useful for in vitro selection of ligands using tRNA display have been described by Merryman et al., Chem. Biol., 9: 741-46, 2002.
  • anti-A33 antibodies of the present technology are selected using RNA display.
  • Methods useful for selecting peptides and proteins using RNA display libraries have been described by Roberts et al. Proc. Natl. Acad. Sci. USA, 94: 12297-302, 1997; and Nemoto et al, FEBSLett., 414: 405-8, 1997.
  • Methods useful for selecting peptides and proteins using unnatural RNA display libraries have been described by Frankel et al, Curr. Opin. Struct. Biol, 13 : 506-12, 2003.
  • anti-A33 antibodies of the present technology are expressed in the periplasm of gram negative bacteria and mixed with labeled A33 protein. See WO 02/34886. In clones expressing recombinant polypeptides with affinity for A33 protein, the concentration of the labeled A33 protein bound to the anti-A33 antibodies is increased and allows the cells to be isolated from the rest of the library as described in Harvey et al, Proc. Natl. Acad. Sci. 22: 9193- 98 2004 and U.S. Pat. Publication No. 2004/0058403.
  • anti-A33 antibodies which are, e.g., but not limited to, anti-A33 hybrid antibodies or fragments can be produced by using conventional techniques to construct an expression vector that encodes an antibody heavy chain in which the CDRs and, if necessary, a minimal portion of the variable region framework, that are required to retain original species antibody binding specificity (as engineered according to the techniques described herein) are derived from the originating species antibody and the remainder of the antibody is derived from a target species immunoglobulin which can be manipulated as described herein, thereby producing a vector for the expression of a hybrid antibody heavy chain.
  • an A33 binding assay refers to an assay format wherein A33 protein and an anti-A33 antibody are mixed under conditions suitable for binding between the A33 protein and the anti-A33 antibody and assessing the amount of binding between the A33 protein and the anti-A33 antibody.
  • the amount of binding is compared with a suitable control, which can be the amount of binding in the absence of the A33 protein, the amount of the binding in the presence of a non-specific immunoglobulin composition, or both.
  • the amount of binding can be assessed by any suitable method.
  • Binding assay methods include, e.g., ELISA, radioimmunoassays, scintillation proximity assays, fluorescence energy transfer assays, liquid chromatography, membrane filtration assays, and the like.
  • Biophysical assays for the direct measurement of A33 protein binding to anti-A33 antibody are, e.g., nuclear magnetic resonance, fluorescence, fluorescence polarization, surface plasmon resonance (BIACORE chips) and the like. Specific binding is determined by standard assays known in the art, e.g., radioligand binding assays, ELISA, FRET, immunoprecipitation, SPR, MR (2D- MR), mass spectroscopy and the like. If the specific binding of a candidate anti- A33 antibody is at least 1 percent greater than the binding observed in the absence of the candidate anti-A33 antibody, the candidate anti-A33 antibody is useful as an anti-A33 antibody of the present technology.
  • A33 neutralization refers to reduction of the activity and/or expression of A33 protein through the binding of an anti-A33 antibody.
  • the capacity of anti-A33 antibodies of the present technology to neutralize A33 activity/expression may be assessed in vitro or in vivo using methods known in the art.
  • anti-A33 antibodies of the present technology are useful in methods known in the art relating to the localization and/or quantitation of an A33 protein ⁇ e.g., for use in measuring levels of the A33 protein within appropriate physiological samples, for use in diagnostic methods, for use in imaging the polypeptide, and the like).
  • Antibodies of the present technology are useful to isolate an A33 protein by standard techniques, such as affinity chromatography or immunoprecipitation.
  • An anti-A33 antibody of the present technology can facilitate the purification of natural immunoreactive A33 proteins from biological samples, e.g., mammalian sera or cells as well as recombinantly-produced immunoreactive A33 proteins expressed in a host system.
  • anti-A33 antibodies can be used to detect an immunoreactive A33 proteins from biological samples, e.g., mammalian sera or cells as well as recombinantly-produced immunoreactive A33 proteins expressed in a host system.
  • anti-A33 antibodies can be used to detect an immunoreactive A33 proteins
  • immunoreactive A33 protein ⁇ e.g., in plasma, a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the immunoreactive polypeptide.
  • the anti- A33 antibodies of the present technology can be used diagnostically to monitor immunoreactive A33 protein levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen.
  • the detection can be facilitated by coupling ⁇ i.e., physically linking) the anti-A33 antibodies of the present technology to a detectable substance.
  • An exemplary method for detecting the presence or absence of an immunoreactive A33 protein in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with an anti-A33 antibody of the present technology capable of detecting an immunoreactive A33 protein such that the presence of an immunoreactive A33 protein is detected in the biological sample. Detection may be accomplished by means of a detectable label attached to the antibody.
  • labeling with regard to the anti-A33 antibody is intended to encompass direct labeling of the antibody by coupling (i.e., physically linking) a detectable substance to the antibody, as well as indirect labeling of the antibody by reactivity with another compound that is directly labeled, such as a secondary antibody.
  • indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin.
  • the anti-A33 antibodies disclosed herein are conjugated to one or more detectable labels.
  • anti-A33 antibodies may be detectably labeled by covalent or non-covalent attachment of a chromogenic, enzymatic, radioisotopic, isotopic, fluorescent, toxic, chemiluminescent, nuclear magnetic resonance contrast agent or other label.
  • chromogenic labels include diaminobenzidine and 4- hydroxyazo-benzene-2-carboxylic acid.
  • suitable enzyme labels include malate dehydrogenase, staphylococcal nuclease, ⁇ -5-steroid isomerase, yeast-alcohol dehydrogenase, a- glycerol phosphate dehydrogenase, triose phosphate isomerase, peroxidase, alkaline
  • phosphatase asparaginase, glucose oxidase, ⁇ -galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase, and acetylcholine esterase.
  • radioisotopic labels examples include 3 H, U1 ln, 125 I, 131 1, 32 P, 35 S, 14 C, 51 Cr, 57 To, 58 Co, 59 Fe, 75 Se, 152 Eu, 90 Y, 67 Cu, 217 Ci, 211 At, 212 Pb, 47 Sc, 109 Pd, etc.
  • m In is an exemplary isotope where in vivo imaging is used since its avoids the problem of dehalogenation of the 125 I or 131 I-labeled A33-binding antibodies by the liver. In addition, this isotope has a more favorable gamma emission energy for imaging (Perkins et al, Eur. J. Nucl. Med.
  • fluorescent labels examples include an 152 Eu label, a fluorescein label, an isothiocyanate label, a rhodamine label, a phycoerythrin label, a phycocyanin label, an allophycocyanin label, a Green Fluorescent Protein (GFP) label, an o-phthaldehyde label, and a fluorescamine label.
  • suitable toxin labels include diphtheria toxin, ricin, and cholera toxin.
  • chemiluminescent labels include a luminol label, an isoluminol label, an aromatic acridinium ester label, an imidazole label, an acridinium salt label, an oxalate ester label, a luciferin label, a luciferase label, and an aequorin label.
  • nuclear magnetic resonance contrasting agents include heavy metal nuclei such as Gd, Mn, and iron.
  • the detection method of the present technology can be used to detect an
  • immunoreactive A33 protein in a biological sample in vitro as well as in vivo.
  • In vitro techniques for detection of an immunoreactive A33 protein include enzyme linked
  • immunosorbent assays ELISAs
  • Western blots immunoprecipitations
  • radioimmunoassay radiofluorescence
  • in vivo techniques for detection of an immunoreactive A33 protein include introducing into a subject a labeled anti-A33 antibody.
  • the anti- A33 antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.
  • the biological sample contains A33 protein molecules from the test subject.
  • An anti-A33 antibody of the present technology can be used to assay immunoreactive A33 protein levels in a biological sample ⁇ e.g., human plasma) using antibody-based techniques.
  • protein expression in tissues can be studied with classical immunohistological methods. Jalkanen, M. et al, J. Cell. Biol. 101 : 976-985, 1985; Jalkanen, M. et al, J. Cell. Biol. 105: 3087-3096, 1987.
  • Other antibody-based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
  • ELISA enzyme linked immunosorbent assay
  • RIA radioimmunoassay
  • Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, and radioisotopes or other radioactive agent, such as iodine ( 125 I, 121 I, 131 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 112 In), and technetium ( 99 mTc), and fluorescent labels, such as fluorescein, rhodamine, and green fluorescent protein (GFP), as well as biotin.
  • enzyme labels such as, glucose oxidase, and radioisotopes or other radioactive agent, such as iodine ( 125 I, 121 I, 131 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 112 In), and technetium ( 99 mTc)
  • fluorescent labels such as fluorescein, rhodamine, and green fluorescent protein (GFP), as well as biotin.
  • anti-A33 antibodies of the present technology may be used for in vivo imaging of A33.
  • Antibodies useful for this method include those detectable by X-radiography, NMR or ESR.
  • suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject.
  • Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which can be incorporated into the anti-A33 antibodies by labeling of nutrients for the relevant scFv clone.
  • An anti-A33 antibody which has been labeled with an appropriate detectable imaging moiety such as a radioisotope ⁇ e.g., 131 I, 112 In, 99 mTc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance, is introduced ⁇ e.g., parenterally, subcutaneously, or intraperitoneally) into the subject.
  • an appropriate detectable imaging moiety such as a radioisotope ⁇ e.g., 131 I, 112 In, 99 mTc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance.
  • the present technology provides a diagnostic method of a medical condition, which involves: (a) assaying the expression of immunoreactive A33 protein by measuring binding of an anti-A33 antibody of the present technology in cells or body fluid of an individual; (b) comparing the amount of immunoreactive A33 protein present in the sample with a standard reference, wherein an increase or decrease in immunoreactive A33 protein levels compared to the standard is indicative of a medical condition.
  • the anti-A33 antibodies of the present technology may be used to purify immunoreactive A33 protein from a sample.
  • the antibodies are immobilized on a solid support.
  • solid supports include plastics such as polycarbonate, complex carbohydrates such as agarose and sepharose, acrylic resins and such as polyacrylamide and latex beads. Techniques for coupling antibodies to such solid supports are well known in the art (Weir et al., "Handbook of Experimental Immunology” 4th Ed., Blackwell Scientific Publications, Oxford, England, Chapter 10 (1986); Jacoby et al., Meth. Enzym. 34 Academic Press, N.Y. (1974)).
  • the simplest method to bind the antigen to the antibody-support matrix is to collect the beads in a column and pass the antigen solution down the column.
  • the efficiency of this method depends on the contact time between the immobilized antibody and the antigen, which can be extended by using low flow rates.
  • the immobilized antibody captures the antigen as it flows past.
  • an antigen can be contacted with the antibody-support matrix by mixing the antigen solution with the support ⁇ e.g., beads) and rotating or rocking the slurry, allowing maximum contact between the antigen and the immobilized antibody.
  • the slurry is passed into a column for collection of the beads.
  • the beads are washed using a suitable washing buffer and then the pure or substantially pure antigen is eluted.
  • An antibody or polypeptide of interest can be conjugated to a solid support, such as a bead.
  • a first solid support such as a bead
  • a second solid support which can be a second bead or other support, by any suitable means, including those disclosed herein for conjugation of a polypeptide to a support.
  • any of the conjugation methods and means disclosed herein with reference to conjugation of a polypeptide to a solid support can also be applied for conjugation of a first support to a second support, where the first and second solid support can be the same or different.
  • Appropriate linkers which can be cross-linking agents, for use for conjugating a polypeptide to a solid support include a variety of agents that can react with a functional group present on a surface of the support, or with the polypeptide, or both.
  • Reagents useful as cross- linking agents include homo-bi-functional and, in particular, hetero-bi-functional reagents.
  • Useful bi-functional cross-linking agents include, but are not limited to, N-SIAB, dimaleimide, DTNB, N-SATA, N-SPDP, SMCC and 6-HYNIC.
  • a cross-linking agent can be selected to provide a selectively cleavable bond between a polypeptide and the solid support.
  • a photolabile cross-linker such as 3-amino-(2-nitrophenyl)propionic acid can be employed as a means for cleaving a polypeptide from a solid support.
  • An antibody or polypeptide can be immobilized on a solid support, such as a bead, through a covalent amide bond formed between a carboxyl group functionalized bead and the amino terminus of the polypeptide or, conversely, through a covalent amide bond formed between an amino group functionalized bead and the carboxyl terminus of the polypeptide.
  • a bi-functional trityl linker can be attached to the support, e.g., to the 4-nitrophenyl active ester on a resin, such as a Wang resin, through an amino group or a carboxyl group on the resin via an amino resin.
  • the solid support can require treatment with a volatile acid, such as formic acid or trifluoroacetic acid to ensure that the polypeptide is cleaved and can be removed.
  • a volatile acid such as formic acid or trifluoroacetic acid
  • the polypeptide can be deposited as a headless patch at the bottom of a well of a solid support or on the flat surface of a solid support.
  • the polypeptide can be desorbed into a MS.
  • Hydrophobic trityl linkers can also be exploited as acid-labile linkers by using a volatile acid or an appropriate matrix solution, e.g., a matrix solution containing 3 -HP A, to cleave an amino linked trityl group from the polypeptide.
  • Acid lability can also be changed.
  • trityl, monomethoxytrityl, dimethoxytrityl or trimethoxytrityl can be changed to the appropriate ⁇ -substituted, or more acid-labile tritylamine derivatives, of the polypeptide, i.e., trityl ether and tritylamine bonds can be made to the polypeptide.
  • a polypeptide can be removed from a hydrophobic linker, e.g., by disrupting the hydrophobic attraction or by cleaving tritylether or tritylamine bonds under acidic conditions, including, if desired, under typical MS conditions, where a matrix, such as 3 -HP A acts as an acid.
  • Orthogonally cleavable linkers can also be useful for binding a first solid support, e.g., a bead to a second solid support, or for binding a polypeptide of interest to a solid support.
  • a first solid support e.g., a bead
  • a second solid support without cleaving the polypeptide from the support; the polypeptide then can be cleaved from the bead at a later time.
  • a disulfide linker which can be cleaved using a reducing agent, such as DTT, can be employed to bind a bead to a second solid support, and an acid cleavable bi-functional trityl group could be used to immobilize a polypeptide to the support.
  • the linkage of the polypeptide to the solid support can be cleaved first, e.g., leaving the linkage between the first and second support intact.
  • Trityl linkers can provide a covalent or hydrophobic conjugation and, regardless of the nature of the conjugation, the trityl group is readily cleaved in acidic conditions.
  • a bead can be bound to a second support through a linking group which can be selected to have a length and a chemical nature such that high density binding of the beads to the solid support, or high density binding of the polypeptides to the beads, is promoted.
  • a linking group can have, e.g., "tree-like" structure, thereby providing a multiplicity of functional groups per attachment site on a solid support. Examples of such linking group;
  • polylysine examples include polylysine, polyglutamic acid, penta-erythrole and tm-hydroxy-aminom ethane.
  • Noncovalent Binding Association An antibody or polypeptide can be conjugated to a solid support, or a first solid support can also be conjugated to a second solid support, through a noncovalent interaction.
  • a magnetic bead made of a ferromagnetic material which is capable of being magnetized, can be attracted to a magnetic solid support, and can be released from the support by removal of the magnetic field.
  • the solid support can be provided with an ionic or hydrophobic moiety, which can allow the interaction of an ionic or hydrophobic moiety, respectively, with a polypeptide, e.g., a polypeptide containing an attached trityl group or with a second solid support having hydrophobic character.
  • a solid support can also be provided with a member of a specific binding pair and, therefore, can be conjugated to a polypeptide or a second solid support containing a
  • a bead coated with avidin or with streptavidin can be bound to a polypeptide having a biotin moiety incorporated therein, or to a second solid support coated with biotin or derivative of biotin, such as iminobiotin.
  • biotin e.g., can be incorporated into either a polypeptide or a solid support and, conversely, avidin or other biotin binding moiety would be incorporated into the support or the polypeptide, respectively.
  • Other specific binding pairs contemplated for use herein include, but are not limited to, hormones and their receptors, enzyme, and their substrates, a nucleotide sequence and its complementary sequence, an antibody and the antigen to which it interacts specifically, and other such pairs knows to those skilled in the art.
  • anti-A33 antibodies of the present technology are useful in diagnostic methods. As such, the present technology provides methods using the antibodies in the diagnosis of A33 activity in a subject. Anti-A33 antibodies of the present technology may be selected such that they have any level of epitope binding specificity and very high binding affinity to an A33 protein. In general, the higher the binding affinity of an antibody the more stringent wash conditions can be performed in an immunoassay to remove nonspecifically bound material without removing target polypeptide. Accordingly, anti-A33 antibodies of the present technology useful in diagnostic assays usually have binding affinities of about 10 8 M "1 , 10 9 M “1 , 10 10 M “1 , 10 11 M “1 or 10 12 M “1 . Further, it is desirable that anti-A33 antibodies used as diagnostic reagents have a sufficient kinetic on-rate to reach equilibrium under standard conditions in at least 12 h, at least five (5) h, or at least one (1) hour.
  • Anti-A33 antibodies can be used to detect an immunoreactive A33 protein in a variety of standard assay formats. Such formats include immunoprecipitation, Western blotting, ELISA, radioimmunoassay, and immunometric assays. See Harlow & Lane, Antibodies, A Laboratory Manual (Cold Spring Harbor Publications, New York, 1988); U.S. Pat. Nos.
  • Bio samples can be obtained from any tissue or body fluid of a subject.
  • the subject is at an early stage of cancer.
  • the early stage of cancer is determined by the level or expression pattern of A33 protein in a sample obtained from the subject.
  • the sample is selected from the group consisting of urine, blood, serum, plasma, saliva, amniotic fluid, cerebrospinal fluid (CSF), and biopsied body tissue.
  • Immunometric or sandwich assays are one format for the diagnostic methods of the present technology. See U.S. Pat. No. 4,376,110, 4,486,530, 5,914,241, and 5,965,375.
  • Such assays use one antibody, e.g., an anti-A33 antibody or a population of anti-A33 antibodies immobilized to a solid phase, and another anti-A33 antibody or a population of anti-A33 antibodies in solution.
  • the solution anti-A33 antibody or population of anti-A33 antibodies is labeled. If an antibody population is used, the population can contain antibodies binding to different epitope specificities within the target polypeptide. Accordingly, the same population can be used for both solid phase and solution antibody.
  • first and second A33 monoclonal antibodies having different binding specificities are used for the solid and solution phase.
  • Solid phase (also referred to as “capture”) and solution (also referred to as “detection”) antibodies can be contacted with target antigen in either order or simultaneously. If the solid phase antibody is contacted first, the assay is referred to as being a forward assay. Conversely, if the solution antibody is contacted first, the assay is referred to as being a reverse assay. If the target is contacted with both antibodies
  • the assay is referred to as a simultaneous assay.
  • a sample is incubated for a period that usually varies from about 10 min to about 24 hr and is usually about 1 hr.
  • a wash step is then performed to remove components of the sample not specifically bound to the anti-A33 antibody being used as a diagnostic reagent.
  • a wash can be performed after either or both binding steps.
  • binding is quantified, typically by detecting a label linked to the solid phase through binding of labeled solution antibody.
  • a calibration curve is prepared from samples containing known concentrations of target antigen.
  • Concentrations of the immunoreactive A33 protein in samples being tested are then read by interpolation from the calibration curve (i.e., standard curve).
  • Analyte can be measured either from the amount of labeled solution antibody bound at equilibrium or by kinetic measurements of bound labeled solution antibody at a series of time points before equilibrium is reached. The slope of such a curve is a measure of the concentration of the A33 protein in a sample.
  • Suitable supports for use in the above methods include, e.g., nitrocellulose membranes, nylon membranes, and derivatized nylon membranes, and also particles, such as agarose, a dextran-based gel, dipsticks, particulates, microspheres, magnetic particles, test tubes, microtiter wells, SEPHADEXTM (Amersham Pharmacia Biotech, Piscataway N. J.), and the like. Immobilization can be by absorption or by covalent attachment.
  • anti-A33 antibodies can be joined to a linker molecule, such as biotin for attachment to a surface bound linker, such as avidin.
  • the present disclosure provides an anti-A33 antibody of the present technology conjugated to a diagnostic agent.
  • the diagnostic agent may comprise a radioactive or non-radioactive label, a contrast agent (such as for magnetic resonance imaging, computed tomography or ultrasound), and the radioactive label can be a gamma-, beta-, alpha-, Auger electron-, or positron-emitting isotope.
  • a diagnostic agent is a molecule which is administered conjugated to an antibody moiety, i.e., antibody or antibody fragment, or subfragment, and is useful in diagnosing or detecting a disease by locating the cells containing the antigen.
  • Useful diagnostic agents include, but are not limited to, radioisotopes, dyes (such as with the biotin-streptavidin complex), contrast agents, fluorescent compounds or molecules and enhancing agents ⁇ e.g., paramagnetic ions) for magnetic resonance imaging (MRI).
  • MRI magnetic resonance imaging
  • U.S. Pat. No. 6,331, 175 describes MRI technique and the preparation of antibodies conjugated to a MRI enhancing agent and is incorporated in its entirety by reference.
  • the diagnostic agents are selected from the group consisting of radioisotopes, enhancing agents for use in magnetic resonance imaging, and fluorescent compounds.
  • a reagent having a long tail to which are attached a multiplicity of chelating groups for binding the ions.
  • a tail can be a polymer such as a polylysine, polysaccharide, or other derivatized or derivatizable chain having pendant groups to which can be bound chelating groups such as, e.g., ethylenediaminetetraacetic acid (EDTA), diethylenetriaminepentaacetic acid (DTP A), porphyrins, polyamines, crown ethers, bis-thiosemicarbazones, polyoximes, and like groups known to be useful for this purpose.
  • EDTA ethylenediaminetetraacetic acid
  • DTP A diethylenetriaminepentaacetic acid
  • porphyrins polyamines, crown ethers, bis-thiosemicarbazones, polyoximes, and like groups known to be useful for this purpose.
  • Chelates may be coupled to the antibodies of the present technology using standard chemistries.
  • the chelate is normally linked to the antibody by a group which enables formation of a bond to the molecule with minimal loss of immunoreactivity and minimal aggregation and/or internal cross-linking.
  • Other methods and reagents for conjugating chelates to antibodies are disclosed in U.S. Pat. No. 4,824,659.
  • Particularly useful metal-chelate combinations include 2-benzyl-DTPA and its monomethyl and cyclohexyl analogs, used with diagnostic isotopes for radio-imaging.
  • the same chelates, when complexed with non-radioactive metals, such as manganese, iron and gadolinium are useful for MRI, when used along with the A33 antibodies of the present technology.
  • Macrocyclic chelates such as NOTA (l,4,7-triaza-cyclononane-N,N',N"-triacetic acid), DOTA, and TETA (p-bromoacetamido-benzyl-tetraethylaminetetraacetic acid) are of use with a variety of metals and radiometals, such as radionuclides of gallium, yttrium and copper, respectively. Such metal-chelate complexes can be stabilized by tailoring the ring size to the metal of interest.
  • ring-type chelates such as macrocyclic polyethers, which are of interest for stably binding nuclides, such as 223 Ra for RAIT are also contemplated.
  • the immunoglobulin-related compositions (e.g., antibodies or antigen binding fragments thereof) of the present technology are useful for the treatment of A33 associated cancers.
  • Such treatment can be used in patients identified as having pathologically high levels of the A33 (e.g., those diagnosed by the methods described herein) or in patients diagnosed with a disease known to be associated with such pathological levels.
  • the present disclosure provides a method for treating an A33 associated cancer in a subject in need thereof, comprising administering to the subject an effective amount of an antibody (or antigen binding fragment thereof) of the present technology.
  • cancers that can be treated by the antibodies of the present technology include, but are not limited to: colorectal cancer,
  • the A33 associated cancer may be colorectal cancer with a MSI genotype or a MSS genotype.
  • the colorectal cancer is associated with a KRAS G12D mutation or a p53 mutation.
  • compositions of the present technology may be employed in conjunction with other therapeutic agents useful in the treatment of A33 associated cancers.
  • the antibodies of the present technology may be separately, sequentially or simultaneously administered with at least one additional therapeutic agent-selected from the group consisting of alkylating agents, platinum agents, taxanes, vinca agents, anti-estrogen drugs, aromatase inhibitors, ovarian suppression agents, VEGF/VEGFR inhibitors, EGF/EGFR inhibitors, PARP inhibitors, cytostatic alkaloids, cytotoxic antibiotics, antimetabolites, endocrine/hormonal agents, bisphosphonate therapy agents and targeted biological therapy agents (e.g., therapeutic peptides described in US 6306832, WO 2012007137, WO 2005000889, WO 2010096603 etc.).
  • the at least one additional therapeutic agent is a chemotherapeutic agent.
  • chemotherapeutic agents include, but are not limited to, cyclophosphamide, fluorouracil (or 5- fluorouracil or 5-FU), methotrexate, edatrexate (10-ethyl-lO-deaza-aminopterin), thiotepa, carboplatin, cisplatin, taxanes, paclitaxel, protein-bound paclitaxel, docetaxel, vinorelbine, tamoxifen, raloxifene, toremifene, fulvestrant, gemcitabine, irinotecan, ixabepilone,
  • temozolmide topotecan, vincristine, vinblastine, eribulin, mutamycin, capecitabine, anastrozole, exemestane, letrozole, leuprolide, abarelix, buserlin, goserelin, megestrol acetate, risedronate, pamidronate, ibandronate, alendronate, denosumab, zoledronate, trastuzumab, tykerb, anthracyclines ⁇ e.g., daunorubicin and doxorubicin), bevacizumab, oxaliplatin, melphalan, etoposide, mechlorethamine, bleomycin, microtubule poisons, annonaceous acetogenins, or combinations thereof.
  • compositions of the present technology may optionally be administered as a single bolus to a subject in need thereof.
  • the dosing regimen may comprise multiple administrations performed at various times after the appearance of tumors.
  • Administration can be carried out by any suitable route, including orally, intranasally, parenterally (intravenously, intramuscularly, intraperitoneally, or subcutaneously), rectally, intracranially, intrathecally, or topically. Administration includes self-administration and the administration by another. It is also to be appreciated that the various modes of treatment of medical conditions as described are intended to mean “substantial”, which includes total but also less than total treatment, and wherein some biologically or medically relevant result is achieved.
  • the antibodies of the present technology comprise
  • Dosage regimens can be adjusted to provide the desired response ⁇ e.g., a therapeutic response).
  • an effective amount of the antibody compositions of the present technology ranges from about 0.000001 mg per kilogram body weight per day to about 10,000 mg per kilogram body weight per day.
  • the dosage ranges are from about 0.0001 mg per kilogram body weight per day to about 100 mg per kilogram body weight per day.
  • the dosage ranges from about 0.0001 to 100 mg/kg, and more usually 0.01 to 5 mg/kg every week, every two weeks or every three weeks, of the subject body weight.
  • dosages can be 1 mg/kg body weight or 10 mg/kg body weight every week, every two weeks or every three weeks or within the range of 1-10 mg/kg every week, every two weeks or every three weeks.
  • a single dosage of antibody ranges from 0.1-10,000 micrograms per kg body weight. In one embodiment, antibody concentrations in a carrier range from 0.2 to 2000 micrograms per delivered milliliter.
  • An exemplary treatment regime entails administration once per every two weeks or once a month or once every 3 to 6 months.
  • Anti-A33 antibodies may be administered on multiple occasions. Intervals between single dosages can be hourly, daily, weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of the antibody in the subject.
  • dosage is adjusted to achieve a serum antibody concentration in the subject of from about 75 ⁇ g/mL to about 125 ⁇ g/mL, 100 ⁇ g/mL to about 150 ⁇ g/mL, from about 125 ⁇ g/mL to about 175 ⁇ g/mL, or from about 150 ⁇ g/mL to about 200 ⁇ g/mL.
  • anti-A33 antibodies can be administered as a sustained release
  • Dosage and frequency vary depending on the half-life of the antibody in the subject.
  • the dosage and frequency of administration can vary depending on whether the treatment is prophylactic or therapeutic. In prophylactic applications, a relatively low dosage is administered at relatively infrequent intervals over a long period of time. In therapeutic applications, a relatively high dosage at relatively short intervals is sometimes required until progression of the disease is reduced or terminated, or until the subject shows partial or complete amelioration of symptoms of disease. Thereafter, the patient can be administered a prophylactic regime.
  • the present disclosure provides a method for detecting a tumor in a subject in vivo comprising (a) administering to the subject an effective amount of an antibody (or antigen binding fragment thereof) of the present technology, wherein the antibody is configured to localize to a tumor expressing A33 and is labeled with a radioisotope; and (b) detecting the presence of a tumor in the subject by detecting radioactive levels emitted by the antibody that are higher than a reference value.
  • the reference value is expressed as injected dose per gram (%ID/g).
  • the reference value may be calculated by measuring the radioactive levels present in non-tumor (normal) tissues, and computing the average radioactive levels present in non-tumor (normal) tissues + standard deviation.
  • the ratio of radioactive levels between a tumor and normal tissue is about 2: 1, 3 : 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 15: 1, 20: 1, 25: 1, 30: 1, 35: 1, 40: 1, 45: 1, 50: 1, 55: 1, 60: 1, 65: 1, 70: 1, 75: 1, 80: 1, 85: 1, 90: 1, 95: 1 or 100: 1.
  • the subject is diagnosed with or is suspected of having cancer. Radioactive levels emitted by the antibody may be detected using positron emission tomography or single photon emission computed tomography.
  • the method further comprises administering to the subject an effective amount of an immunoconjugate comprising an antibody of the present technology conjugated to a radionuclide.
  • the radionuclide is an alpha particle-emitting isotope, a beta particle-emitting isotope, an Auger-emitter, or any combination thereof. Examples of beta particle-emitting isotopes include 86 Y, 90 Y, 89 Sr, 165 Dy,
  • alpha particle-emitting isotopes include Bi, At, 225 Ac, 152 Dy, 212 Bi, 223 Ra, 219 Rn, 215 Po, 211 Bi, 221 Fr, 217 At, and 255 Fm.
  • Auger- emitters include m In, 67 Ga, 51 Cr, 58 Co, 99m Tc, 103m Rh, 195m Pt, 119 Sb, 161 Ho, 189m Os, 192 Ir, 201 T1, and 203 Pb.
  • nonspecific FcR-dependent binding in normal tissues is eliminated or reduced (e.g., via N297A mutation in Fc region, which results in aglycosylation).
  • the therapeutic effectiveness of such an immunoconjugate may be determined by computing the area under the curve (AUC) tumor: AUC normal tissue ratio.
  • the immunoconjugate has a AUC tumor: AUC normal tissue ratio of about 2: 1, 3 : 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 15: 1, 20: 1, 25: 1, 30: 1, 35: 1, 40: 1, 45: 1, 50: 1, 55: 1, 60: 1, 65: 1, 70: 1, 75: 1, 80: 1, 85: 1, 90: 1, 95: 1 or 100: 1.
  • the present disclosure provides a method for detecting solid tumors in a subject in need thereof comprising (a) administering to the subject an effective amount of a complex comprising a radiolabeled DOTA hapten and a bispecific antibody of the present technology that binds to the radiolabeled DOTA hapten and an A33 antigen, wherein the complex is configured to localize to a solid tumor expressing the A33 antigen recognized by the bispecific antibody of the complex; and (b) detecting the presence of solid tumors in the subject by detecting radioactive levels emitted by the complex that are higher than a reference value.
  • the subject is human.
  • the present disclosure provides a method for selecting a subject for pretargeted radioimmunotherapy comprising (a) administering to the subject an effective amount of a complex comprising a radiolabeled DOTA hapten and a bispecific antibody of the present technology that binds to the radiolabeled DOTA hapten and an A33 antigen, wherein the complex is configured to localize to a solid tumor expressing the A33 antigen recognized by the bispecific antibody of the complex; (b) detecting radioactive levels emitted by the complex; and (c) selecting the subject for pretargeted radioimmunotherapy when the radioactive levels emitted by the complex are higher than a reference value.
  • the subject is human.
  • Examples of DOT A haptens include (i) DOT A-Phe-Ly s(HSG)-D-Tyr-Ly s(HSG)- H 2 ; (ii) Ac-Lys(HSG)D-Tyr-Lys(HSG)-Lys(Tscg-Cys)- H 2 ; (iii) DOTA-D-Asp-D-Lys(HSG)- D-Asp-D-Lys(HSG)- H 2 ; (iv) DOTA-D-Glu-D-Lys(HSG)-D-Glu-D-Lys(HSG)- H 2 ;
  • the radiolabel may be an alpha particle-emitting isotope, a beta particle-emitting isotope, or an Auger-emitter.
  • radiolabels include 213 Bi, 211 At, 225 Ac, 152 Dy, 212 Bi, 223 Ra, 219 Rn, 215 Po, 211 Bi, 221 Fr, 217 At, 255 Fm, 86 Y, 90 Y, 89 Sr, 165 Dy, 186 Re, 188 Re, 177 Lu, 67 Cu, m In, 67 Ga, 51 Cr, 58 Co, 99m Tc, 103m Rh, 195m Pt, 119 Sb, 161 Ho, 189m Os, 192 Ir, 201 T1, 203 Pb, 68 Ga, 227 Th, or 64 Cu.
  • the radioactive levels emitted by the complex are detected using positron emission tomography or single photon emission computed tomography. Additionally or alternatively, in some embodiments of the methods disclosed herein, the subject is diagnosed with, or is suspected of having an A33-positive cancer such as colorectal cancer, Pseudomyxoma peritonei, appendiceal cancer, pancreatic cancer, and gastric cancer.
  • an A33-positive cancer such as colorectal cancer, Pseudomyxoma peritonei, appendiceal cancer, pancreatic cancer, and gastric cancer.
  • the complex is administered intravenously, intramuscularly, intraarterially, intrathecally, intracapsularly, intraorbitally, intradermally, intraperitoneally, transtracheally, subcutaneously, intracerebroventricularly, orally or intranasally.
  • the complex is administered into the cerebral spinal fluid or blood of the subject.
  • the radioactive levels emitted by the complex are detected between 2 to 120 hours after the complex is administered.
  • the radioactive levels emitted by the complex are expressed as the percentage injected dose per gram tissue (%ID/g).
  • the reference value may be calculated by measuring the radioactive levels present in non-tumor (normal) tissues, and computing the average radioactive levels present in non-tumor (normal) tissues + standard deviation.
  • the reference value is the standard uptake value (SUV). See Thie JA, J Nucl Med. 45(9): 1431-4 (2004).
  • the ratio of radioactive levels between a tumor and normal tissue is about 2: 1, 3 : 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 15: 1, 20: 1, 25: 1, 30: 1, 35: 1, 40: 1, 45: 1, 50: 1, 55: 1, 60: 1, 65: 1, 70: 1, 75: 1, 80: 1, 85: 1, 90: 1, 95: 1 or 100: 1.
  • the present disclosure provides a method for increasing tumor sensitivity to radiation therapy in a subject diagnosed with an A33-positive cancer comprising (a) administering an effective amount of an anti-DOTA bispecific antibody of the present technology to the subject, wherein the anti-DOTA bispecific antibody is configured to localize to a tumor expressing an A33 antigen target; and (b) administering an effective amount of a radiolabeled-DOTA hapten to the subject, wherein the radiolabeled-DOTA hapten is configured to bind to the anti-DOTA bispecific antibody.
  • the subject is human.
  • the anti-DOTA bispecific antibody is administered under conditions and for a period of time ⁇ e.g., according to a dosing regimen) sufficient for it to saturate tumor cells.
  • unbound anti-DOTA bispecific antibody is removed from the blood stream after administration of the anti-DOTA bispecific antibody.
  • the radiolabeled- DOTA hapten is administered after a time period that may be sufficient to permit clearance of unbound anti-DOTA bispecific antibody.
  • the radiolabeled-DOTA hapten may be administered at any time between 1 minute to 4 or more days following administration of the anti-DOTA bispecific antibody.
  • the radiolabeled-DOTA hapten is administered 1 minute, 2 minutes, 3 minutes, 4 minutes, 5 minutes, 10 minutes, 15 minutes, 20 minutes, 25 minutes, 30 minutes, 35 minutes, 40 minutes, 45 minutes, 50 minutes, 55 minutes, 1 hour, 1.25 hours, 1.5 hours, 1.75 hours, 2 hours, 2.5 hours, 3 hours, 3.5 hours, 4 hours, 4.5 hours, 5 hours, 5.5 hours, 6 hours, 6.5 hours, 7 hours, 7.5 hours, 8 hours, 8.5 hours, 9 hours, 9.5 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 23 hours, 24 hours, 48 hours, 72 hours, 96 hours, or any range therein, following administration of the anti-DOTA bispecific antibody.
  • the radiolabeled-DOTA hapten is administered
  • the method further comprises administering an effective amount of a clearing agent to the subject prior to administration of the radiolabeled-DOTA hapten.
  • a clearing agent can be any molecule (dextran or dendrimer or polymer) that can be conjugated with C825-hapten.
  • the clearing agent is no more than 2000 kD, 1500 kD, 1000 kD, 900 kD, 800 kD, 700 kD, 600 kD, 500 kD, 400 kD, 300 kD, 200 kD, 100 kD, 90 kD, 80 kD, 70 kD, 60 kD, 50 kD, 40 kD, 30 kD, 20 kD, 10 kD, or 5kD.
  • the clearing agent is a 500 kD aminodextran-DOTA conjugate (e.g., 500 kD dextran-DOTA-Bn (Y), 500 kD dextran-DOTA-Bn (Lu), or 500 kD dextran- DOTA-Bn (In) etc.).
  • 500 kD aminodextran-DOTA conjugate e.g., 500 kD dextran-DOTA-Bn (Y), 500 kD dextran-DOTA-Bn (Lu), or 500 kD dextran- DOTA-Bn (In) etc.
  • the clearing agent and the radiolabeled-DOTA hapten are administered without further administration of the anti-DOTA bispecific antibody of the present technology.
  • an anti-DOTA bispecific antibody of the present technology is administered according to a regimen that includes at least one cycle of: (i) administration of the anti-DOTA bispecific antibody of the present technology (optionally so that relevant tumor cells are saturated); (ii) administration of a radiolabeled-DOTA hapten and, optionally a clearing agent; (iii) optional additional administration of the radiolabeled-DOTA hapten and/or the clearing agent, without additional administration of the anti-DOTA bispecific antibody.
  • the method may comprise multiple such cycles (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more cycles).
  • the anti-DOTA bispecific antibody and/or the radiolabeled-DOTA hapten is administered intravenously, intramuscularly, intraarterially, intrathecally, intracapsularly, intraorbitally, intradermally, intraperitoneally, transtracheally, subcutaneously, intracerebroventricularly, orally or
  • the present disclosure provides a method for increasing tumor sensitivity to radiation therapy in a subject diagnosed with an A33-positive cancer comprising administering to the subject an effective amount of a complex comprising a radiolabeled-DOTA hapten and a bispecific antibody of the present technology that recognizes and binds to the radiolabeled-DOTA hapten and an A33 antigen target, wherein the complex is configured to localize to a tumor expressing the A33 antigen target recognized by the bispecific antibody of the complex.
  • the complex may be administered intravenously, intramuscularly, intraarterially, intrathecally, intracapsularly, intraorbitally, intradermally, intraperitoneally, transtracheally, subcutaneously, intracerebroventricularly, orally or intranasally.
  • the subject is human.
  • the present disclosure provides a method for treating cancer in a subject in need thereof comprising (a) administering an effective amount of an anti-DOTA bispecific antibody of the present technology to the subject, wherein the anti-DOTA bispecific antibody is configured to localize to a tumor expressing an A33 antigen target; and (b) administering an effective amount of a radiolabeled-DOTA hapten to the subject, wherein the radiolabeled-DOTA hapten is configured to bind to the anti-DOTA bispecific antibody.
  • the anti-DOTA bispecific antibody is administered under conditions and for a period of time (e.g., according to a dosing regimen) sufficient for it to saturate tumor cells.
  • unbound anti-DOTA bispecific antibody is removed from the blood stream after administration of the anti-DOTA bispecific antibody.
  • the radiolabeled-DOTA hapten is administered after a time period that may be sufficient to permit clearance of unbound anti- DOTA bispecific antibody.
  • the subject is human.
  • the method further comprises administering an effective amount of a clearing agent to the subject prior to administration of the radiolabeled- DOTA hapten.
  • the radiolabeled-DOTA hapten may be administered at any time between 1 minute to 4 or more days following administration of the anti-DOTA bispecific antibody.
  • the radiolabeled-DOTA hapten is administered 1 minute, 2 minutes, 3 minutes, 4 minutes, 5 minutes, 10 minutes, 15 minutes, 20 minutes, 25 minutes, 30 minutes, 35 minutes, 40 minutes, 45 minutes, 50 minutes, 55 minutes, 1 hour, 1.25 hours, 1.5 hours, 1.75 hours, 2 hours, 2.5 hours, 3 hours, 3.5 hours, 4 hours, 4.5 hours, 5 hours, 5.5 hours, 6 hours, 6.5 hours, 7 hours, 7.5 hours, 8 hours, 8.5 hours, 9 hours, 9.5 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 16 hours, 17 hours, 18 hours, 19 hours, 20 hours, 21 hours, 22 hours, 23 hours, 24 hours, 48 hours, 72 hours, 96 hours, or any range therein, following administration of the anti-DOTA bispecific antibody.
  • the radiolabeled-DOTA hapten may be administered at any time after 4 or more days following administration of the anti-DOTA bispecific antibody.
  • the clearing agent may be a 500 kD aminodextran-DOTA conjugate (e.g., 500 kD dextran-DOTA-Bn (Y), 500 kD dextran-DOTA-Bn (Lu), or 500 kD dextran-DOTA-Bn (In) etc.).
  • the clearing agent and the radiolabeled-DOTA hapten are administered without further administration of the anti-DOTA bispecific antibody.
  • an anti-DOTA bispecific antibody is administered according to a regimen that includes at least one cycle of: (i) administration of the an anti-DOTA bispecific antibody of the present technology (optionally so that relevant tumor cells are saturated); (ii) administration of a radiolabeled-DOTA hapten and, optionally a clearing agent; (iii) optional additional administration of the radiolabeled-DOTA hapten and/or the clearing agent, without additional administration of the anti-DOTA bispecific antibody.
  • the method may comprise multiple such cycles (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more cycles).
  • Also provided herein are methods for treating cancer in a subject in need thereof comprising administering to the subject an effective amount of a complex comprising a radiolabeled-DOTA hapten and a bispecific antibody of the present technology that recognizes and binds to the radiolabeled-DOTA hapten and an A33 antigen target, wherein the complex is configured to localize to a tumor expressing the A33 antigen target recognized by the bispecific antibody of the complex.
  • the therapeutic effectiveness of such a complex may be determined by computing the area under the curve (AUC) tumor: AUC normal tissue ratio.
  • the complex has a AUC tumor: AUC normal tissue ratio of about 2: 1, 3 : 1, 4: 1, 5: 1, 6: 1, 7: 1, 8: 1, 9: 1, 10: 1, 15: 1, 20: 1, 25: 1, 30: 1, 35: 1, 40: 1, 45: 1, 50: 1, 55: 1, 60: 1, 65: 1, 70: 1, 75: 1, 80: 1, 85: 1, 90: 1, 95: 1 or 100: 1.
  • an effective amount ⁇ e.g., dose) of anti-A33 antibody described herein will provide therapeutic benefit without causing substantial toxicity to the subject.
  • Toxicity of the anti-A33 antibody described herein can be determined by standard
  • the dose ratio between toxic and therapeutic effect is the therapeutic index.
  • the data obtained from these cell culture assays and animal studies can be used in formulating a dosage range that is not toxic for use in human.
  • the dosage of the anti-A33 antibody described herein lies within a range of circulating concentrations that include the effective dose with little or no toxicity.
  • the dosage can vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the subject's condition. See, e.g., Fingl et al, In: The Pharmacological Basis of Therapeutics, Ch. 1 (1975).
  • the anti-A33 antibody can be incorporated into pharmaceutical compositions suitable for administration.
  • the pharmaceutical compositions generally comprise recombinant or substantially purified antibody and a pharmaceutically-acceptable carrier in a form suitable for administration to a subject.
  • Pharmaceutically-acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions for administering the antibody compositions ⁇ See, e.g., Remington's
  • compositions are generally formulated as sterile, substantially isotonic and in full compliance with all Good Manufacturing Practice (GMP) regulations of the U.S. Food and Drug
  • compositions, carriers, diluents and reagents are used interchangeably and represent that the materials are capable of administration to or upon a subject without the production of undesirable physiological effects to a degree that would prohibit administration of the composition.
  • pharmaceutically-acceptable excipient means an excipient that is useful in preparing a pharmaceutical composition that is generally safe, non-toxic, and desirable, and includes excipients that are acceptable for veterinary use as well as for human pharmaceutical use. Such excipients can be solid, liquid, semisolid, or, in the case of an aerosol composition, gaseous.
  • “Pharmaceutically-acceptable salts and esters” means salts and esters that are pharmaceutically-acceptable and have the desired
  • Such salts include salts that can be formed where acidic protons present in the composition are capable of reacting with inorganic or organic bases.
  • Suitable inorganic salts include those formed with the alkali metals, e.g., sodium and potassium, magnesium, calcium, and aluminum.
  • Suitable organic salts include those formed with organic bases such as the amine bases, e.g., ethanolamine, diethanolamine, triethanolamine,
  • Such salts also include acid addition salts formed with inorganic acids (e.g., hydrochloric and hydrobromic acids) and organic acids (e.g., acetic acid, citric acid, maleic acid, and the alkane- and arene-sulfonic acids such as
  • esters include esters formed from carboxy, sulfonyloxy, and phosphonoxy groups present in the anti-A33 antibody, e.g., Ci -6 alkyl esters.
  • a pharmaceutically- acceptable salt or ester can be a mono-acid-mono-salt or ester or a di-salt or ester; and similarly where there are more than two acidic groups present, some or all of such groups can be salified or esterified.
  • An anti-A33 antibody named in this technology can be present in unsalified or unesterified form, or in salified and/or esterified form, and the naming of such anti-A33 antibody is intended to include both the original (unsalified and unesterified) compound and its pharmaceutically-acceptable salts and esters. Also, certain embodiments of the present technology can be present in more than one stereoisomeric form, and the naming of such anti- A33 antibody is intended to include all single stereoisomers and all mixtures (whether racemic or otherwise) of such stereoisomers. A person of ordinary skill in the art, would have no difficulty determining the appropriate timing, sequence and dosages of administration for particular drugs and compositions of the present technology.
  • Examples of such carriers or diluents include, but are not limited to, water, saline, Ringer's solutions, dextrose solution, and 5% human serum albumin. Liposomes and nonaqueous vehicles such as fixed oils may also be used.
  • the use of such media and compounds for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or compound is incompatible with the anti-A33 antibody, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the
  • a pharmaceutical composition of the present technology is formulated to be compatible with its intended route of administration.
  • the anti-A33 antibody compositions of the present technology can be administered by parenteral, topical, intravenous, oral, subcutaneous, intraarterial, intradermal, transdermal, rectal, intracranial, intrathecal, intraperitoneal, intranasal; or intramuscular routes, or as inhalants.
  • the anti-A33 antibody can optionally be administered in combination with other agents that are at least partly effective in treating various A33 associated cancers.
  • Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial compounds such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating compounds such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and compounds for the adjustment of tonicity such as sodium chloride or dextrose.
  • the pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • the parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
  • compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
  • suitable carriers include physiological saline, bacteriostatic water, Cremophor ELTM (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS).
  • the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi.
  • the carrier can be a solvent or dispersion medium containing, e.g., water, ethanol, polyol (e.g., glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof.
  • the proper fluidity can be maintained, e.g., by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
  • Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal compounds, e.g., parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like.
  • isotonic compounds e.g., sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition.
  • Prolonged absorption of the injectable compositions can be brought about by including in the composition a compound which delays absorption, e.g., aluminum monostearate and gelatin.
  • Sterile injectable solutions can be prepared by incorporating an anti-A33 antibody of the present technology in the required amount in an appropriate solvent with one or a
  • dispersions are prepared by incorporating the anti-A33 antibody into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
  • sterile powders for the preparation of sterile injectable solutions methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • the antibodies of the present technology can be administered in the form of a depot injection or implant preparation which can be formulated in such a manner as to permit a sustained or pulsatile release of the active ingredient.
  • Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the anti-A33 antibody can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding compounds, and/or adjuvant materials can be included as part of the composition.
  • the tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating compound such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening compound such as sucrose or saccharin; or a flavoring compound such as peppermint, methyl salicylate, or orange flavoring.
  • a binder such as microcrystalline cellulose, gum tragacanth or gelatin
  • an excipient such as starch or lactose, a disintegrating compound such as alginic acid, Primogel, or corn starch
  • a lubricant such as magnesium stearate or Sterotes
  • a glidant such as colloidal silicon dioxide
  • the anti-A33 antibody is delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
  • a suitable propellant e.g., a gas such as carbon dioxide, or a nebulizer.
  • Systemic administration can also be by transmucosal or transdermal means.
  • penetrants appropriate to the barrier to be permeated are used in the formulation.
  • penetrants are generally known in the art, and include, e.g., for transmucosal administration, detergents, bile salts, and fusidic acid derivatives.
  • Transmucosal administration can be accomplished through the use of nasal sprays or suppositories.
  • the anti-A33 antibody is formulated into ointments, salves, gels, or creams as generally known in the art.
  • the anti-A33 antibody can also be prepared as pharmaceutical compositions in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
  • suppositories e.g., with conventional suppository bases such as cocoa butter and other glycerides
  • retention enemas for rectal delivery.
  • the anti-A33 antibody is prepared with carriers that will protect the anti-A33 antibody against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems.
  • a controlled release formulation including implants and microencapsulated delivery systems.
  • Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art.
  • the materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc.
  • Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically-acceptable carriers. These can be prepared according to methods known to those skilled in the art, e.g., as described in U.S. Pat. No. 4,522,811.
  • kits for the detection and/or treatment of A33 associated cancers comprising at least one immunoglobulin-related composition of the present technology (e.g., any antibody or antigen binding fragment described herein), or a functional variant (e.g., substitutional variant) thereof.
  • the above described components of the kits of the present technology are packed in suitable containers and labeled for diagnosis and/or treatment of A33 associated cancers.
  • the above-mentioned components may be stored in unit or multi-dose containers, for example, sealed ampoules, vials, bottles, syringes, and test tubes, as an aqueous, preferably sterile, solution or as a lyophilized, preferably sterile, formulation for reconstitution.
  • the kit may further comprise a second container which holds a diluent suitable for diluting the pharmaceutical composition towards a higher volume. Suitable diluents include, but are not limited to, the pharmaceutically acceptable excipient of the pharmaceutical composition and a saline solution. Furthermore, the kit may comprise instructions for diluting the pharmaceutical composition and/or instructions for administering the pharmaceutical composition, whether diluted or not.
  • the containers may be formed from a variety of materials such as glass or plastic and may have a sterile access port (for example, the container may be an intravenous solution bag or a vial having a stopper which may be pierced by a hypodermic injection needle).
  • the kit may further comprise more containers comprising a pharmaceutically acceptable buffer, such as phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, culture medium for one or more of the suitable hosts.
  • a pharmaceutically acceptable buffer such as phosphate-buffered saline, Ringer's solution and dextrose solution. It may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, needles, syringes, culture medium for one or more of the suitable hosts.
  • the kits may optionally include instructions customarily included in commercial packages of therapeutic or diagnostic products, that contain information about, for example, the indications, usage, dosage, manufacture, administration, contraindications and/or warnings concerning the use of such therapeutic or diagnostic products.
  • kits are useful for detecting the presence of an immunoreactive A33 protein in a biological sample, e.g., any body fluid including, but not limited to, e.g., serum, plasma, lymph, cystic fluid, urine, stool, cerebrospinal fluid, ascitic fluid or blood and including biopsy samples of body tissue.
  • the kit can comprise: one or more humanized, chimeric, or bispecific anti-A33 antibodies of the present technology (or antigen binding fragments thereof) capable of binding an A33 protein in a biological sample; means for determining the amount of the A33 protein in the sample; and means for comparing the amount of the immunoreactive A33 protein in the sample with a standard.
  • One or more of the anti-A33 antibodies may be labeled.
  • the kit components, e.g., reagents
  • the kit can further comprise instructions for using the kit to detect the immunoreactive A33 protein.
  • the kit can comprise, e.g., 1) a first antibody, e.g. a humanized, chimeric or bispecific A33 antibody of the present technology (or an antigen binding fragment thereof), attached to a solid support, which binds to an A33 protein; and, optionally; 2) a second, different antibody which binds to either the A33 protein or to the first antibody, and is conjugated to a detectable label.
  • a first antibody e.g. a humanized, chimeric or bispecific A33 antibody of the present technology (or an antigen binding fragment thereof)
  • a solid support which binds to an A33 protein
  • a second, different antibody which binds to either the A33 protein or to the first antibody, and is conjugated to a detectable label.
  • the kit can also comprise, e.g., a buffering agent, a preservative or a protein- stabilizing agent.
  • the kit can further comprise components necessary for detecting the detectable-label, e.g., an enzyme or a substrate.
  • the kit can also contain a control sample or a series of control samples, which can be assayed and compared to the test sample.
  • Each component of the kit can be enclosed within an individual container and all of the various containers can be within a single package, along with instructions for interpreting the results of the assays performed using the kit.
  • the kits of the present technology may contain a written product on or in the kit container.
  • the written product describes how to use the reagents contained in the kit, e.g., for detection of an A33 protein in vitro or in vivo, or for treatment of A33 associated cancers in a subject in need thereof.
  • the use of the reagents can be according to the methods of the present technology.
  • the present technology is further illustrated by the following Examples, which should not be construed as limiting in any way.
  • the following Examples demonstrate the preparation, characterization, and use of illustrative A33 antibodies of the present technology.
  • the following Examples demonstrate the production of chimeric, humanized, and bispecific antibodies of the present technology, and characterization of their binding specificities and in vivo biological activities.
  • Example 1 Materials and Methods for Generating and Characterizing the Anti-A33 Antibodies o f the Present Technology
  • Cell lines and human white cells were purchased from ATCC (Manassas, Virginia); SW1222 was ECACC (Salisbury, United Kingdom). All cells were authenticated by STR typing. Cells were maintained in RPMI medium supplemented with 10% FBS (Sigma, St. Louis, MO), 0.03% L-Glutamine (Gibco Laboratories, Gaithersburg, MD) and Pen/Strep (Gibco Laboratories, Gaithersburg, MD). Buffy coats from healthy donors were purchased from New York Blood Center (New York City, NY) and human PBMCs were isolated by Ficoll gradient of Buffy coats.
  • mouse A33 was humanized as IgGi. Two different VH and VL sequences were combined to generate 4 different humanized A33 antibodies. Binding kinetics was compared with that of chimeric antibody chA33 using Surface Plasmon resonance (SPR) analysis.
  • the heavy chain sequence is SEQ ID NO: 6 (3A3- H2) and the light chain sequence is SEQ ID NO: 10 (3A3-L2).
  • the heavy chain sequence including the leader sequence is
  • MGWSCIILFLVATATGDIQMTQSQSSLSTSVGDRVTITCKASQNVRTVVAWYQQKPGKS PKTLIYLASNRHTGVPSRFSGSGSGTEFTLTISNVQPEDFADYFCLQHWSYPLTFGSGTKL EIKR SEQ ID NO: 56.
  • the underlined sequence corresponds to the leader sequence.
  • HuA33-BsAb was constructed by fusing the humanized OKT3 scFv onto the C-terminus of the light chain of huA33 antibody via a (G 4 S) 3 linker as previously described in Xu H et al, Cancer Immunology Research 3 :266-277 (2015) and Lopez-Albaitero A et al, Oncolmmunology 6:el267891 (2017).
  • N297A and K322A mutations were introduced in the Fc region of the antibody to eliminate FcR and complement binding activities, respectively (Shields RL et al., Journal of Biological Chemistry 276:6591- 6604 (2001); Idusogie EE et al, Journal of Immunology 164:4178-4184 (2000)).
  • the DNA construct was then transfected into CHO-S cells and stable clones were selected for high levels of antibody production. For larger-scale antibody purification, the selected stable clone was expanded in shaker flasks. Bispecific antibody was purified from supernatant using one-step protein A affinity chromatography.
  • T-cell dependent cytotoxicity (TDCC) assays were performed using both 51 Cr-release assay and Pierce LDH-release assay (Thermo Fisher Scientific,
  • T cells activated by exposure to anti-CD3/anti-CD28 Dynabeads for 14 days were subsequently used as effector cells, excepted for sorted cells from PBMCs, which were used for TDCC assay without prior stimulation.
  • 51 Cr assay was performed as previously described in Cheng M et al, International Journal of Cancer 136:476-486 (2015).
  • LDH assay was conducted according to the manufacturer's instructions with the following modifications. Briefly, for each assay well of a 96-well round-bottom plate, 1.5xl0 4 target cells were incubated with variable number of effector cells, depending on the intended E:T ratios.
  • Antibodies were then added at different dilutions and the plates were incubated at 37°C for 16 hours. Each condition was done in triplicates. Supernatant was then transferred to a flat bottom plate with reaction substrate and incubated for 30 min before reading at 490 nm, with 680 nm as a reference wavelength. EC 50 values were calculated by fitting the curves to a 4-parameter nonlinear regression model using GraphPad Prism.
  • T cells were purified from PBMCs using pan T cell isolation kit (Miltenyi Biotec, Cambridge, MA). Target and control tumor cells were incubated with 2xl0 6 cells/well at an effector to target ratio of 5: 1 in 24-well plates in triplicates, with 2 ml total volume per well. Culture supernatants were collected at 24 hours, 48 hours, 72 hours and 96 hours and cytokine levels were measured with flow cytometry using LEGENDplexTM human CD8/NK Panel (Biolegend, San Diego, CA) according to the manufacturer's protocol.
  • T cell proliferation assay Fresh PBMCs from healthy donors were labeled with 2.5 nM CFSE (Life Technologies Corp., Carlsbad, CA) for 5 min at room temperature, followed by neutralization using PBS containing 5% FBS. Target cells were then incubated with labeled PBMCs under different conditions at 37°C before analyzing the expression of surface activation markers and T cell proliferation at 24 hours and 96 hours.
  • 2.5 nM CFSE Life Technologies Corp., Carlsbad, CA
  • luciferase expressing LS174T-luc or SW1222-luc cells were resuspended in RPMI medium and injected intraperitoneally into DKO mice.
  • Human effector cells were supplied as activated T cells and injected intravenously.
  • Mice were treated with 2-3 weekly cycles of antibody-T cell-antibody regimen, with each component separated by 3-4 days. Growth of tumors was followed weekly by measuring luminescence signals on an IVIS Spectrum in vivo imaging system (PerkinElmer Inc., Waltham, MA) after injection of 3.3 mg/mouse of luciferin. Luminescence was analyzed and quantified using Living Image Software (PerkinElmer Inc., Waltham, MA).
  • Antibodies and flow cytometry Antibodies anti-hCD25-PE, anti-CD69-PE, anti- hCD8-APC, anti-hCD45-PECy7, anti-hCD4-PE, anti-hCD4-BV421, anti-hCD62L-PercpCy5.5, anti-hPDl-BV421, anti-hCD45RO-PECy7, were purchased from Biolegend (San Diego, CA). Goat anti-human IgG-PE was purchased from SouthernBiotech (Birmingham, AL).
  • Streptavidin-PE, anti-hCD4-APC and anti-hCD25-APC were purchased from BD Biosciences (San Jose, CA). All FACS analysis was done using FACSCalibur or LSRII system (BD
  • Parental huA33 was converted into scFv format with a 20 amino acid (G4S) 4 linker and cloned into a yeast display vector.
  • HuA33 scFv was randomly mutated using GeneMorph II mutagenesis kit (Agilent Technologies, Santa Clara, CA). PCR products were electroporated together with linearized vector into yeast and the library was subjected to 4 rounds of sorting using biotinylated GPA33. Individual clones from the last round were PCR amplified and sequenced to analyze the mutation pattern.
  • Figure 14 shows the amino acid sequences of the V H and V L domains of the murine A33 antibody and their corresponding homologous human sequences (SEQ ID NOs: 1-4).
  • the amino acid sequences of the V H and V L domains of 3A3-H1/L1, 3A3-H1/L2, 3A3-H2/L1 and 3A3-H2/L2 humanized A33 antibodies of the present technology are shown in Figure 15 and Figure 17.
  • the cDNA sequences of the V H and V L domains of 3A3-H1/L1, 3A3-H1/L2, 3A3- H2/L1 and 3A3-H2/L2 humanized A33 antibodies are shown in Figure 16 and Figure 18.
  • Figure 19 shows the alignment of the original humanized amino acid sequences hA33 from King et al. (1995) supra, versus the newly rehumanized huA33 (3A3) amino acid sequences.
  • Figure 24 shows the amino acid sequences of the light chain and heavy chain of the chimeric chA33-IgGl, which correspond to SEQ ID NO: 13 and SEQ ID NO: 14 respectively.
  • Figure 25 shows the amino acid and cDNA sequences of the heavy chain of huA33-IgGl (H2L2), which correspond to SEQ ID NO: 15 and SEQ ID NO: 16 respectively.
  • Figure 26 shows the amino acid and cDNA sequences of the light chain of huA33-IgGl (H2L2), which correspond to SEQ ID NO: 17 and SEQ ID NO: 18 respectively.
  • the immunoglobulin-related compositions disclosed herein are useful for detecting A33 protein in a sample.
  • the huA33 antibody was reformatted into bispecific format by fusing scFv of humanized OKT3 to the C-terminus of light chain via a flexible GS linker ( Figure 1(A)).
  • the DNA construct was used to establish a CHO-S stable cell line and huA33-BsAb was purified from the supernatant. Protein yield using protein A chromatography was 50 mg/L to 100 mg/L without extensive optimization. Similar yields were observed using Expi293 transient expression system (data not shown).
  • One-step protein A purification routinely produced protein with purity above 90%, as measured by SEC-HPLC. Four cycles of freeze-thaw did not cause noticeable changes in SEC-HPLC profile (data not shown).
  • Figure 27 shows the amino acid and cDNA sequences of the heavy chain of T-cell engaging huA33-BsAb bispecific antibodies, which correspond to SEQ ID NO: 19 and SEQ ID NO: 20 respectively.
  • Figure 28 shows the amino acid and cDNA sequences of the light chain of T-cell engaging huA33-BsAb bispecific antibodies, which correspond to SEQ ID NO: 21 and SEQ ID NO: 22 respectively.
  • Figure 29 shows a summary of potential modifications to the T- cell engaging huA33-BsAb bispecific antibodies disclosed herein.
  • the immunoglobulin-related compositions disclosed herein are useful for detecting A33 protein in a sample.
  • Example 4 Biological Activity of T-cell engaging HuA 33 -BsAb Antibodies of the Present Technology
  • HuA33-BsAb activated and induced cell cycle entry of fresh T cells.
  • CFSE-labeled PBMCs were mixed with Colo205 cells at an E:T ratio of 5, and cultured in the presence of huA33-BsAb (1 ⁇ g/ml).
  • HuA33-BsAb induced secretion of inflammatory cytokines and cytolytic molecules.
  • the secreted cytokine profile of T cells activated by huA33-BsAb in the presence of target tumors was examined.
  • Total T cells were purified from PBMCs and cultured in the presence of Colo205 tumor cells at an effector to target ratio of 5 : 1.
  • SKMEL5 cells were used as a negative control.
  • Cell culture supernatants were collected daily over 4 days and the levels of cytokines and cytotoxic molecules were measured using a flow cytometry based multiplex method.
  • Thl cytokines IL-2, IFNy, TNFa
  • Th2 cytokines IL-4, IL-10
  • IL-2 Thl cytokines
  • IL-4 Th2 cytokines
  • IL-6 Thl7 cytokine IL-17a was also secreted at high levels. Cytotoxic components sFasL, sFas, Granzyme A, Granzyme B, Perforin and Granulysin were all released in the supernatant.
  • HuA33-BsAb redirected T cells to specifically kill colon cancer and gastric cancer cells.
  • the ability of huA33-BsAb to redirect T cells to kill cancer cells was tested. Based on a survey of GPA33 expression on multiple human cancer cell lines (Figure 10), 3 colon cancer cell lines (LS174T, SW1222 and Colo205) and one gastric cancer cell line (SNU16) were selected for cytotoxicity studies.
  • MSI LS174T
  • MSS SW1222, Colo205, SNU16
  • LS174T cells carried a KRAS G12D mutation while the others carried p53 mutations or deletions (Ahmed D et al.,
  • CD45RA(+)CD62L(+) and CD45RA(-)CD45RO(+)CD62L(-) memory subsets from both CD4(+) and CD8(+) T cells were sorted. Sorted cells were cultured in the presence of Colo205 tumors cells at an E:T ratio of 5: 1 for 48 hours before measuring cytotoxicity using the LDH assay. As shown in Figure 4(B), both CD4(+) and CD8(+) memory T cell subsets were capable of inducing cytotoxicity, with CD8(+) memory T cells mediating more efficient killing at higher concentration.
  • the immunoglobulin-related compositions disclosed herein are useful for detecting A33 protein in a sample.
  • Example 5 A ffinity Maturation of huA33-BsAb by Yeast Display
  • yeast display method was used to affinity mature scFv derived from huA33. Since scFv tends to aggregate easily, a method to rapidly reformat scFv to T cell engaging huA33-BsAbs (which is a more relevant format and could be readily produced in high yield and purity) was developed (Figure 13).
  • the method was based on a one-step 4-fragment ligation approach that made use of the type II enzyme Sapl to allow seamless linkage of different fragments and could be readily adapted to other vectors or scaled up to a high-throughput workflow.
  • Multi-fragment In- Fusion® cloning (Clontech Laboratories, Mountain View, CA) was also tested with success but was less robust (data not shown), possibly due to the specific sequences of the expression vector.
  • the immunoglobulin-related compositions disclosed herein are useful for detecting A33 protein in a sample.
  • Efficacy of huA33-BsAb was tested in vivo in the following xenograft models in humanized DKO mice using two different tumor models: (1) s.c. tumor plus s.c. effectors and (2) i.p. tumor plus i.v. effectors.
  • HuA33-BsAb cured MSI tumor LSI 74T in a s. c. xenograft model and suppressed tumor growth in an i.p. model.
  • LS174T cells were mixed with PBMCs at a 1 : 1 ratio and implanted subcutaneously in DKO mice.
  • PBMCs peripheral blood mononuclear cells
  • FIG. 6(A) without antibody treatment, both tumor only and tumor+PBMC groups exhibited rapid tumor growth. Mice from tumor+PBMC group developed tumor ulceration and had to be euthanized.
  • 6 doses of huA33-BsAb over 3 weeks effectively cured the mice, which remained tumor free for at least 120 days.
  • mice were randomized into different treatment groups, treated with no antibody group (tumor only), tumor + T cell only group (tumor +ATC), or i.v. huA33- BsAb (7 doses over 3 weeks), plus weekly T cell injections over 3 weeks. Treatment was started on day 5 after tumor implantation. All T cells were injected through retro-orbital route.
  • HuA33-BsAb cured MSS tumor COLO205 in a s.c. xenograft model and suppressed tumor growth of metastatic MSS tumor SW1222.
  • Two MSS colon cancer cell lines Colo205 and SW1222 were tested.
  • Colo205 cells tumors were implanted subcutaneously with PBMCs as effector cells.
  • 4 doses of huA33-BsAb were enough to completely eradicate Colo205 tumors and the mice remained tumor free for at least 4 months after a total of 6 doses of antibody treatment (Figure 7(A) and Figure 7(B)).
  • HuA33-BsAb inhibited growth of gastric cancers in a s.c. xenograft model.
  • GPA33 is expressed in a subset of gastric cancer cells.
  • FACS analysis and in vitro TDCC assays demonstrated that SNU16 expressed GPA33 and was sensitive to huA33-BsAb redirected T cell killing.
  • SNU16 cells were xenografted subcutaneously after mixing with human PBMCs.
  • huA33-BsAb redirected T cells did not undergo cellular exhaustion and exhibited continual quantitative tumor- homing properties >3 weeks. Tumors were cured despite the presence of PD1 and PD-L1, and the addition of checkpoint blockade at subtherapeutic doses of huA33-BsAb further enhanced these anti-tumor properties.
  • the A33 immunoglobulin-related compositions disclosed herein offer both FcR-dependent and T cell-dependent immunotherapeutic strategies for the diagnosis and therapy of A33 associated cancers.
  • the antibodies or antigen binding fragments of the present technology can detect tumors and inhibit the progression of tumor growth and/or metastasis. Accordingly, the immunoglobulin-related compositions disclosed herein are useful for detecting and treating an A33 -positive cancer in a subject in need thereof.
  • Radioimmunotherapy are radiation overexposure in normal tissues, immunogenicity, suboptimal tumor dose and a low therapeutic index.
  • This Example will demonstrate that the huA33-DOTA bispecific antibodies of the present technology are useful in PRIT for treating cancers expressing the human A33 antigen such as colorectal cancer.
  • the A33-DOTA bispecific antibodies of the present technology comprise a first antigen-binding site based on the humanized A33 antibodies described herein and a second antigen-binding site that binds to a small molecule hapten ⁇ e.g., benzyl- 1,4,7, 10- tetraazacyclododecane- 1,4,7, 10- tetraacetic acid [DOTA-Bn]).
  • a small hapten ⁇ e.g., benzyl- 1,4,7, 10- tetraazacyclododecane- 1,4,7, 10- tetraacetic acid [DOTA-Bn]
  • An anti-DOTA-Bn single chain Fv fragment (ScFv) based on an affinity matured 2D 12.5 antibody will be linked to the carboxyl end of a humanized A33 light chain.
  • Figure 37 shows the amino acid and cDNA sequences of the heavy chain of bispecific antibodies huA33-huC825 (H2L2), which correspond to SEQ ID NO: 58 and SEQ ID NO: 59, respectively.
  • Figure 38 shows the amino acid and cDNA sequences of the light chain of bispecific antibodies huA33-huC825 (H2L2), which correspond to SEQ ID NO: 60 and SEQ ID NO: 61, respectively.
  • Figure 39 shows the amino acid sequence of the heavy chain and light chain of the bispecific antibodies huA33-mC825 (H2L2), which correspond to SEQ ID NO: 62 and SEQ ID NO: 63, respectively.
  • Tumor cell lines and cell culture reagents The human colorectal cancer cell line SW1222 will be maintained by serial passage.
  • the cells are cultured in Minimal Essential Medium supplemented with 10% heat inactivated fetal calf serum, 2.0 mM glutamine, 100 units/mL penicillin, and 100 units/mL streptomycin in a 37 °C environment containing 5% C0 2 .
  • Cultures are established and cryopreserved in small aliquots to limit passages to less than three months, and periodically tested for mycoplasma according to manufacturer's specifications using a commercial kit (Lonza, Portsmouth, NH).
  • huA33-huC825 and huA33-mC825 will be produced in CHO cells in a mammalian expression vector and purified by protein A affinity chromatography.
  • Biacore T100 Biosensor, CM5 sensor chip, and related reagents are purchased from GE Healthcare (Chicago, IL). Recombinant human A33 protein will be purchased from Novoprotein Scientific, Inc. (Summit, NJ). A BSA- (Y)-DOTA- Bn conjugate will be prepared as described in Cheal et al, Mol. Cancer Ther. 13(7) (2014). A33 and DOTA antigens are immobilized using the Amino Coupling kit (GE Healthcare, Chicago, IL). Purified bispecific antibodies and control antibodies are analyzed, and data will be fit to a bivalent analyte model using the Biacore T100 evaluation software as described in Cheal et al, (2014).
  • huA33-C825 is trace radiolabeled with I 131 to estimate tumor uptake during PRIT.
  • the IODOGEN method (Cheal, S. et ⁇ , ⁇ Cancer Ther. 13(7): 1-10 (2014)) is used to prepare 131 I-huA33-mC825 or 131 I-huA33-huC825 (final specific activity 95.5 MBq/mg, with cold huA33-huC825 or huA33-mC825 added to achieve desired mg dose, radiochemical purity >98% using size-exclusion high pressure liquid chromatography), and the in vitro cell binding immunoreactivity will be evaluated using SW1222 cells essentially as described by Lindmo, T. et al, J. Immunol. Meth. 126(2): 183-189 (1990)).
  • a GD2-targeted bispecific antibody (hu3F8-C825) is used in place of huA33-mC825 or huA33-huC825.
  • mice are euthanized by C0 2 (g) asphyxiation, and tumor and selected organs are harvested, rinsed with water and allowed to air-dry, weighed and radioassayed by gamma scintillation counting (Perkin Elmer Wallac Wizard 3 ", PerkinElmer Inc., Waltham, MA). Count rates will be background and decay corrected, converted to activities using a system calibration factor, normalized to the administered activity, and expressed as percent injected dose per gram (%ID/g). Differences in 177 Lu-activity concentration in tumor and various tissues will be analyzed by Student's unpaired t-test when appropriate.
  • the non-decay-corrected time-activity concentration data are fit using Excel to a 1 -component, a 2-component, or a more complex exponential function as appropriate, and will be analytically integrated to yield the cumulated activity concentration per unit administered activity (MBq-h/g per MBq).
  • the 177 Lu equilibrium dose constant for non-penetrating radiations (8.49 g-cGy/MBq-h) will be used to estimate the tumor-to- tumor and select organ-to-organ self-absorbed doses, assuming complete local absorption of the 177 Lu beta rays only and ignoring the gamma ray and non-self dose
  • the following imaging acquisition parameters will be used: energy window of 350-750 keV, coincidence timing window of 6 nsec, and an acquisition time of 20 min.
  • the resulting list-mode data are sorted into 2D histograms by Fourier re-binning and transverse images reconstructed by filtered back- projection into a 128x 128x95 matrix (reconstructed spatial resolution is 2.6 mm full-width half maximum (FWHM)).
  • the image data are corrected for non-uniformity of response of the scanner, deadtime count losses, physical decay (to the time of injection), and the 86 Y positron branching ratio. No attenuation, scatter, or partial-volume averaging correction will be applied.
  • An empirically determined system calibration factor i.e.
  • mice is used to convert voxel count rates to activity concentrations.
  • the resulting image data are then normalized to the administered activity to determine by region-of-interest analysis the percent of the injected dose per gram (%ID/g) of tissue corrected for radioactive decay to the time of injection.
  • AsiPRO VM 5.0 software Concorde Microsystems, Knoxville, TN is used to perform imaging and region of interest (ROI) analyses (as ROI maximum, %ID/g). The animals are sacrificed at 24 h p.i. for ex vivo biodistribution analysis.
  • the tumor volume on day 10-post tumor inoculation (TV 10) is described ⁇ i.e., day of first 177 Lu-DOTA-Bn injection) and expressed when appropriate as average ⁇ SD.
  • the following definitions are used to describe treatment response: a complete response (CR) is defined as tumor shrinkage to ⁇ 100 mm 3 .
  • a durable response (DR) is defined as survival at 140 days post treatment. Excessive tumor burden is defined as >2000 mm 3 .
  • select groups of A33-positive SW1222 tumor- bearing mice undergoing treatment are placed under anesthesia by gas inhalation before scanning in a nanoSPECT
  • a dose of huA33-C825 (huA33-huC825 or huA33-mC825) is selected based on pilot biodistribution studies in SW1222-tumor bearing mice at 24 h p.i. of 177 Lu-DOTA-Bn using 0.1-0.6 mg of huA33-C825 (0.48-2.86 nmol), and fixed ratios of Clearing Agent and 177 Lu- DOTA-Bn (5.6 MBq). Next, additional biodistribution experiments are performed to optimize the Clearing Agent dose during PRIT.
  • Lu-activity may reduce the capacity for subsequent Lu-DOTA- Bn uptake at the tumor.
  • 177 Lu-DOTA-Bn dose titration studies are performed using the optimized PRIT doses for huA33-C825 (huA33-huC825 or huA33-mC825) and Clearing Agent.
  • the 177 Lu-activity biodistribution data for tumor and critical select tissues is compared between 177 Lu-DOTA-Bn dose groups as both %ID/g and absolute uptake (kBq/g).
  • 177 177 of Lu-DOTA-Bn A single group of animals is sacrificed at 2, 24, and 120 h p.i. of Lu- DOTA-Bn for biodistribution analysis. These data will be used as described herein to estimate absorbed doses for radioimmunotherapy with 177 Lu-DOTA-Bn. It is anticipated that tumor uptake of 177 Lu will occur very rapidly following administration, and will decrease over the next 96 h at 120 h p.i. For each target region, the absorbed dose is calculated as the product of the 177 Lu equilibrium dose constant for non-penetrating radiations (i.e., beta rays) and the target
  • This Example demonstrates the efficacy of PRIT using the A33-DOTA bispecific antibodies of the present technology on A33-positive tumors. It is anticipated that a progressive increase in therapeutic index and a reduction in absolute tumor uptake will be observed with increasing doses. Accordingly, the huA33-DOTA bispecific antibodies of the present technology are useful in treating cancers expressing the human A33 antigen such as colorectal cancer.
  • Example 8 In vivo Therapeutic Effects of huA33-C825 Antibodies of the Present Technology
  • This Example illustrates the in vivo efficacy of a huA33-C825 bispecific antibody in PRIT to mediate a reduction in tumor burden in mice bearing A33- positive cancer cells.
  • this Example describes effect of single- and dual-cycle therapy on tumor burden in SW1222 -tumor bearing mice.
  • Serial nanoSPECT/CT imaging is conducted on five randomly selected mice undergoing DPRIT up to 160 hours post-injection of the first cycle of 177 Lu-DOTA-Bn for dosimetry calculations. It is anticipated that DPRIT will induce complete tumor response in all treated animals and no obvious toxicities in kidney, liver, spleen, and bone/marrow. Lutetium-177 nanoSPECT/CT imaging of three-cycle PRIT regimen treated animals are expected to show high contrast with visible uptake in tumors and minimal tissue background.
  • NanoSPECT/CT is utilized for high-resolution quantitative imaging of mice undergoing 177 Lu- DPRIT treatment for "real-time" dosimetry.
  • a SW1222-tumor bearing nude mouse (volume: 100 mm 3 according to Vernier caliper measurement) is treated with a single cycle of huA33- C825 PRIT (huA33-huC825 or huA33-mC825) + 55 MBq of 177 Lu- DOTA-Bn and is imaged by nanoSPECT/CT at three times following injection of 177 Lu-DOTA- Bn: at 1, 24, and 160 hours post-injection.
  • the images are decay corrected to the time of injection and calibrated using known activity standards.
  • the activity concentration in tumor is determined using region-of- interest analysis of the calibrated images.
  • the huA33-DOTA bispecific antibodies of the present technology are useful in treating A33 -positive cancers and are useful in detecting tumors in a subject.
  • the GPA33(+) human colorectal cancer cell line SW1222 was obtained from the Ludwig Institute for Cancer Immunotherapy (New York, NY).
  • SW1222 cells were cultured in Minimal Essential Medium supplemented with 10% heat-inactivated fetal calf serum, 2.0 mM glutamine, 100 units/mL penicillin, and 100 //g/mL streptomycin. All cells were maintained in a 37°C environment containing 5% C0 2 (g).
  • cultures were established and cryopreserved in small aliquots to limit passages to less than three months, and were periodically tested for mycoplasma negativity using a commercial kit (Lonza, Basel, Switzerland).
  • mice were inoculated with 5.0 x 10 6 cells in a 200 /L cell suspension of a 1 : 1 mixture of media with reconstituted basement membrane (BD Matrigel, Collaborative Biomedical Products Inc., Bedford, MA) on lower flank via subcutaneous (s.c.) injection, and established tumors (100-300 mm 3 ) were observed within 7 - 10 d.
  • BD Matrigel Collaborative Biomedical Products Inc., Bedford, MA
  • established tumors 100-300 mm 3
  • mice were euthanized by C0 2 (g) asphyxiation, and tumor and selected organs were harvested, rinsed with water and allowed to air-dry, weighed, and radioassayed by gamma scintillation counting (Wallac Wizard 3", Perkin Elmer, Waltham, MA). Count rates were corrected for background and decay, converted to activities using a system calibration factor specific for the isotope, normalized to the administered activity, and expressed as average ⁇ SD %ID/g unless otherwise noted.
  • CA Clearing Agent
  • %ID/gm percent injected dose per gram of tissue.
  • the huA33-DOTA bispecific antibodies of the present technology are useful in treating A33 -positive cancers and are useful in detecting tumors in a subject.
  • a range includes each individual member.
  • a group having 1-3 cells refers to groups having 1, 2, or 3 cells.
  • a group having 1-5 cells refers to groups having 1, 2, 3, 4, or 5 cells, and so forth.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • Optics & Photonics (AREA)
  • Physics & Mathematics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Apparatus Associated With Microorganisms And Enzymes (AREA)
  • Medicinal Preparation (AREA)
PCT/US2018/052253 2017-09-23 2018-09-21 A33 ANTIBODY COMPOSITIONS AND METHODS OF USE IN RADIOIMMUNOTHERAPY Ceased WO2019060750A2 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
KR1020207011796A KR102783937B1 (ko) 2017-09-23 2018-09-21 A33 항체 조성물 및 방사면역요법에서 이를 사용하는 방법
EA202090583A EA202090583A1 (ru) 2017-09-23 2018-09-21 Композиции на основе антител против a33 и способы их применения в радиоиммунотерапии
CN201880075541.7A CN111372590A (zh) 2017-09-23 2018-09-21 A33抗体组合物及在放射免疫疗法中使用其的方法
US16/649,617 US11555072B2 (en) 2017-09-23 2018-09-21 A33 antibody compositions and methods of using the same in radioimmunotherapy
AU2018338322A AU2018338322B2 (en) 2017-09-23 2018-09-21 A33 antibody compositions and methods of using the same in radioimmunotherapy
EP18859251.3A EP3684369A4 (en) 2017-09-23 2018-09-21 A33-ANTIBODY COMPOSITIONS AND METHOD OF USING THEREOF IN RADIOIMMUNOTHERAPY
JP2020516818A JP7303802B2 (ja) 2017-09-23 2018-09-21 A33抗体組成物および放射性免疫療法におけるその使用方法
CA3076611A CA3076611A1 (en) 2017-09-23 2018-09-21 A33 antibody compositions and methods of using the same in radioimmunotherapy
IL273484A IL273484B2 (en) 2017-09-23 2018-09-21 A33 antibody compositions and methods of using the same in radioimmunotherapy
JP2023103361A JP2023138957A (ja) 2017-09-23 2023-06-23 A33抗体組成物および放射性免疫療法におけるその使用方法
US18/501,782 US20240327511A1 (en) 2017-09-23 2023-11-03 A33 antibody compositions and methods of using the same in radioimmunotherapy
JP2024215117A JP2025061650A (ja) 2017-09-23 2024-12-10 A33抗体組成物および放射性免疫療法におけるその使用方法
AU2025204844A AU2025204844A1 (en) 2017-09-23 2025-06-26 A33 antibody compositions and methods of using the same in radioimmunotherapy

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762562373P 2017-09-23 2017-09-23
US201762562374P 2017-09-23 2017-09-23
US62/562,374 2017-09-23
US62/562,373 2017-09-23

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/649,617 A-371-Of-International US11555072B2 (en) 2017-09-23 2018-09-21 A33 antibody compositions and methods of using the same in radioimmunotherapy
US202218147951A Continuation 2017-09-23 2022-12-29

Publications (2)

Publication Number Publication Date
WO2019060750A2 true WO2019060750A2 (en) 2019-03-28
WO2019060750A3 WO2019060750A3 (en) 2019-05-16

Family

ID=65810903

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/052253 Ceased WO2019060750A2 (en) 2017-09-23 2018-09-21 A33 ANTIBODY COMPOSITIONS AND METHODS OF USE IN RADIOIMMUNOTHERAPY

Country Status (9)

Country Link
US (2) US11555072B2 (https=)
EP (1) EP3684369A4 (https=)
JP (3) JP7303802B2 (https=)
KR (1) KR102783937B1 (https=)
CN (1) CN111372590A (https=)
AU (2) AU2018338322B2 (https=)
CA (1) CA3076611A1 (https=)
IL (1) IL273484B2 (https=)
WO (1) WO2019060750A2 (https=)

Cited By (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020127366A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Humanized anti-human-pd-1 antibody
WO2020127377A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Bifunctional anti-pd-1/il-7 molecule
WO2020127373A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Bifunctional anti-pd-1/sirpa molecule
WO2020127369A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Bifunctional molecule directed against human pd-1
WO2020165374A1 (en) 2019-02-14 2020-08-20 Ose Immunotherapeutics Bifunctional molecule comprising il-15ra
US11254744B2 (en) 2015-08-07 2022-02-22 Imaginab, Inc. Antigen binding constructs to target molecules
CN114341176A (zh) * 2019-04-08 2022-04-12 纪念斯隆凯特琳癌症中心 Cd19抗体及其使用方法
WO2022101492A1 (en) 2020-11-16 2022-05-19 Technische Universität München Bioorthogonal reporter gene system
WO2022108976A3 (en) * 2020-11-18 2022-09-15 Memorial Sloan Kettering Cancer Center Anti-gpa33 multi-specific antibodies and uses thereof
US12435141B2 (en) 2013-03-13 2025-10-07 Imaginab, Inc. Antigen binding constructs to CD8

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11122038B1 (en) * 2017-05-18 2021-09-14 United Services Automobile Association (Usaa) Methods and systems for authentication of new users
CN116744981A (zh) * 2021-01-13 2023-09-12 豪夫迈·罗氏有限公司 组合疗法

Family Cites Families (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6307026B1 (en) * 1992-12-10 2001-10-23 Celltech Limited Humanized antibodies directed against A33 antigen
DE69331735T2 (de) * 1992-12-10 2002-09-26 Celltech Therapeutics Ltd., Slough Gegen das A33 Antigen gerichtete Humanisierte Antikörper
EP0983303B1 (en) 1997-05-21 2006-03-08 Biovation Limited Method for the production of non-immunogenic proteins
ES2230848T3 (es) 1998-04-28 2005-05-01 Smithkline Beecham Corporation Anticuerpos monoclonales con inmunogenicidad reducida.
WO2006028197A1 (ja) * 2004-09-06 2006-03-16 Kirin Beer Kabushiki Kaisha 抗a33抗体
EP2840091A1 (en) 2013-08-23 2015-02-25 MacroGenics, Inc. Bi-specific diabodies that are capable of binding gpA33 and CD3 and uses thereof
JP2017534598A (ja) * 2014-09-30 2017-11-24 ザ メディカル カレッジ オブ ウィスコンシン インクThe Medical College Of Wisconsin, Inc. 神経系疾患を治療する標的療法のための汎用的なプラットフォーム
CN107847584B (zh) * 2015-02-09 2022-01-25 纪念斯隆凯特琳癌症中心 具有人a33抗原和dota金属复合物亲和力的多特异性抗体及其用途
RS61907B1 (sr) 2015-04-06 2021-06-30 Subdomain Llc Polipeptidi koji sadrže de novo vezujući domen i njihova primena

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12435141B2 (en) 2013-03-13 2025-10-07 Imaginab, Inc. Antigen binding constructs to CD8
US11254744B2 (en) 2015-08-07 2022-02-22 Imaginab, Inc. Antigen binding constructs to target molecules
WO2020127367A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Humanized anti-human-pd-1 antibody
WO2020127366A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Humanized anti-human-pd-1 antibody
WO2020127369A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Bifunctional molecule directed against human pd-1
WO2020127373A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Bifunctional anti-pd-1/sirpa molecule
EP4257199A2 (en) 2018-12-21 2023-10-11 Ose Immunotherapeutics Humanized anti-human-pd-1 antibody
WO2020127377A1 (en) 2018-12-21 2020-06-25 Ose Immunotherapeutics Bifunctional anti-pd-1/il-7 molecule
WO2020165374A1 (en) 2019-02-14 2020-08-20 Ose Immunotherapeutics Bifunctional molecule comprising il-15ra
CN114341176A (zh) * 2019-04-08 2022-04-12 纪念斯隆凯特琳癌症中心 Cd19抗体及其使用方法
US12612456B2 (en) 2019-04-08 2026-04-28 Memorial Sloan Kettering Cancer Center CD19 antibodies and methods of using the same
WO2022101492A1 (en) 2020-11-16 2022-05-19 Technische Universität München Bioorthogonal reporter gene system
WO2022108976A3 (en) * 2020-11-18 2022-09-15 Memorial Sloan Kettering Cancer Center Anti-gpa33 multi-specific antibodies and uses thereof

Also Published As

Publication number Publication date
WO2019060750A3 (en) 2019-05-16
JP2020534017A (ja) 2020-11-26
US20240327511A1 (en) 2024-10-03
CA3076611A1 (en) 2019-03-28
KR20200057759A (ko) 2020-05-26
CN111372590A (zh) 2020-07-03
AU2025204844A1 (en) 2025-07-17
IL273484B2 (en) 2025-12-01
IL273484A (en) 2020-05-31
AU2018338322A1 (en) 2020-04-09
AU2018338322B2 (en) 2025-07-17
US20200291112A1 (en) 2020-09-17
KR102783937B1 (ko) 2025-03-24
EP3684369A4 (en) 2021-06-23
JP7303802B2 (ja) 2023-07-05
IL273484B1 (en) 2025-08-01
JP2023138957A (ja) 2023-10-03
US11555072B2 (en) 2023-01-17
JP2025061650A (ja) 2025-04-11
EP3684369A2 (en) 2020-07-29

Similar Documents

Publication Publication Date Title
US20240327511A1 (en) A33 antibody compositions and methods of using the same in radioimmunotherapy
US12486323B2 (en) Anti-L1-CAM antibodies and uses thereof
US12441793B2 (en) CD33 antibodies and methods of using the same to treat cancer
US20230212289A1 (en) Anti-cd3 antibodies and uses thereof
US20260015435A1 (en) Anti-polysialic acid antibodies and uses thereof
US20220251192A1 (en) Anti-cd33 antibodies for treating cancer
AU2020343652A1 (en) Anti-STEAP1 antibodies and uses thereof
US20220242967A1 (en) Anti-glypican-3 antibodies and uses thereof
US20240026037A1 (en) Anti-gpa33 multi-specific antibodies and uses thereof
WO2022081443A2 (en) Anti-psma antibodies and uses thereof
AU2024344464A1 (en) Gpa33 antibody compositions and uses thereof
EA046795B1 (ru) Композиции на основе антител против a33 и способы их применения в радиоиммунотерапии

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 3076611

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020516818

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018338322

Country of ref document: AU

Date of ref document: 20180921

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20207011796

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2018859251

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2018859251

Country of ref document: EP

Effective date: 20200423

WWG Wipo information: grant in national office

Ref document number: 273484

Country of ref document: IL