WO2019040390A1 - ANTI-APELIN ANTIBODIES AND USES THEREOF - Google Patents
ANTI-APELIN ANTIBODIES AND USES THEREOF Download PDFInfo
- Publication number
- WO2019040390A1 WO2019040390A1 PCT/US2018/047144 US2018047144W WO2019040390A1 WO 2019040390 A1 WO2019040390 A1 WO 2019040390A1 US 2018047144 W US2018047144 W US 2018047144W WO 2019040390 A1 WO2019040390 A1 WO 2019040390A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- chain variable
- variable region
- polypeptide sequence
- subject
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/26—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against hormones ; against hormone releasing or inhibiting factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/74—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving hormones or other non-cytokine intercellular protein regulatory factors such as growth factors, including receptors to hormones and growth factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
Definitions
- This invention relates to monoclonal anti-apelin antibodies, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies.
- DR retinopathy
- PDR proliferative diabetic retinopathy
- NPDR non-proliferative diabetic retinopathy
- AMD age-related macular degeneration
- DME diabetic macular edema
- RVO retinal vein occlusion
- mCNV myopic choroidal neovascularization
- CKD chronic kidney disease
- NASH non-alcoholic steatohepatitis
- liver cirrhosis plaque neovascularization
- rubeosis iridis rubeosis iridis
- neovascular glaucoma corneal
- CNV neovascularization
- ROP retinopathy of prematurity
- OHSS ovarian hyperstimulation syndrome
- endometriosis endometrial hyperplasia and cancer
- myometrial leiomyomas myometrial leiomyomas
- adenomyosis cancer (e.g., solid tumors and hematologic malignancies), fibrosis (e.g., pathological and physiological fibrosis, renal fibrosis, cardiac fibrosis, liver fibrosis, and pulmonary fibrosis), and/or associated complications are also provided.
- cancer e.g., solid tumors and hematologic malignancies
- fibrosis e.g., pathological and physiological fibrosis, renal fibrosis, cardiac fibrosis, liver fibrosis, and pulmonary fibrosis
- associated complications are also provided.
- This application contains a sequence listing, which is submitted electronically via EFS-Web as an ASCII formatted sequence listing with a file name "689204.1 WO Sequence Listing” and a creation date of August 15, 2018, and having a size of 88 kb.
- the sequence listing submitted via EFS-Web is part of the specification and is herein incorporated by reference in its entirety.
- Apelin is a naturally occurring peptide with several endogenous forms. It is initially produced as a 77-amino acid precursor, preproapelin, which is proteolytically processed into apelin-36 (or apelin 36) (containing the C-terminal 36 amino acids of the apelin precursor), apelin- 17 (or apelin 17) (containing the C-terminal 17 amino acids of preproapelin; K17F) and apelin- 13 (or apelin 13) (containing the C-terminal 13 amino acids of preproapelin) (Tatemoto et al., Biochem Biophys Res. Commun. 251(2):471-6 (1998); Habata et al., Biochim Biophys Acta 1452(l):25-35 (1999); Lee et al., J.
- Apelin is the endogenous ligand of apelin receptor APJ (also named apelinR, AGTRLl, or APLNR). APJ is a member of the G protein-coupled receptor gene family.
- Apelin binds to and activates APJ and triggers a wide range of downstream signaling events, including downregulation of forskolin-induced cAMP production and promotion of phosphorylation of extracellular signal-regulated kinases (ERKs), Akt, and p70 S6 kinase (De Mota, Neuroendocrinology 72(6):400-7 (2000); Li et al., Front Biosci. 13 :3786-92 (2008); Masri et al., Biochem Biophys Res
- K17F and pE13F can induce APJ receptor internalization.
- K17F has higher affinity than pE13F for APJ, whereas apelin-36 has similar affinity to pE13F (Iturrioz et al., J Biol Chem. 285(42):32627-37 (2010);
- the apelin/ APJ axis regulates many physiological functions including cardiac contractibility, blood pressure, cardiovascular tone, tissue angiogenesis, water homeostasis, gastrointestinal track physiology, proliferation of vascular smooth muscle cells (VSMCs) and other cell types, monocyte adhesion to human umbilical vein endothelial cells, cardiac repair post-myocardial infarction, and pathological fibrosis in several tissues or organs (O'Carroll et al., J Endocrinol.
- Apelin plays an important role in angiogenesis and cell proliferation of endothelial cells (ECs) (Kalin et al., Dev Biol. 305(2):599-614 (2007); Kasai et al., Biochem Biophys Res Commun. 325(2):395-400 (2004)). Both apelin and APJ are expressed on ECs of newly developing blood vessels during angiogenesis (Kidoya et al., EMBO J. 27(3):522-34 (2008); Saint-Geniez et al., Mech Dev.
- apelin knockout mice have impaired retinal vascularization and ocular development (Kasai et al., Arterioscler Thromb Vase
- mAb an apelin-neutralizing monoclonal antibody
- mAb can specifically bind to apelin and block its biological activity on cells that express the apelin receptor APJ; it can also be called an anti-apelin mAb with neutralizing activity.
- Agents such as an apelin-neutralizing mAb could be used to treat diabetic retinopathy (DR), age- related macular degeneration (AMD), and diabetic macular edema (DME). Since the apelin/ APJ axis could work with the VEGF pathway in a cooperative manner, a combination of an apelin-neutralizing mAb with a VEGF blocker such as ranibizumab (Lucentis®) could have an additive or even synergistic therapeutic effect in patients with DR, DME, AMD, and/or other eye diseases. A bispecific antibody that targets both apelin and VEGF could have a similar effect.
- Apelin- 13 has been shown to promote tumor proliferation in various types of cancers, including breast, hepatocellular, lymphatic, lung and ovarian cancer. Apelin and APJ expression is upregulated in various tumors (Sorli et al., Oncogene. 26(55):7692-9).
- Apelin is a potent activator of tumor neoangiogenesis and proliferation through binding and activation of its receptor APJ (Sorli et al., Drug Discov Today. 11(23- 24): 1100-6 (2006)).
- blockade of apelin action with an apelin-neutralizing mAb could be employed to treat various cancers where the apelin/ APJ axis plays a role in cancer cell growth and/or angiogenesis near the tumor site.
- An apelin-neutralizing mAb could be combined with Avastin® or other anti-VEGF and/or anti-angiogenic agents to achieve an additive or even synergistic effect in cancer treatment. Further, an apelin- neutralizing mAb could be combined with other anti-cancer agents such as those for chemotherapy, inhibition of tumor growth or immune-oncology therapy to achieve greater efficacy.
- Apelin is also associated with hepatic diseases. It is overexpressed in activated hepatic stellate cells (HSCs) of cirrhotic rats and plays an important role in both angiogenesis and fibrosis in these animals (Principe et al., Hepatology. 48(4): 1193-201
- proinflammatory factors upregulate APJ expression in human HSCs and hepatocytes.
- Patients with liver cirrhosis have increased serum levels of apelin.
- serum apelin level is associated with the severity of chronic liver disease.
- Apelin has been shown to promote diabetic nephropathy in rodents by enhancing the permeability of glomerular endothelial cells and inducing podocyte dysfunction (Guo et al., J Cell Mol Med. 19(9):2273-85 (2015)). It has also been found to be involved in the progression of diabetic nephropathy by inhibiting autophagy in podocytes (Liu et al., Cell Death Dis. 8(8):e3006 (2017)). Thus, an apelin-neutralizing mAb could be used in the treatment of diabetic nephropathy and chronic kidney disease. BRIEF SUMMARY OF THE INVENTION
- the invention relates to isolated monoclonal antibodies or antigen-binding fragments thereof that specifically bind apelin.
- HCDR1 heavy chain complementarity determining region 1
- HCDR2 heavy chain complementarity determining region 1
- LCDRl light chain complementarity determining region 1
- SEQ ID NO: 168 is represented by the amino acid sequence XiNRX 2 S, wherein Xi is an amino acid selected from S or T, and X 2 is an amino acid selected from M or V.
- SEQ ID NO: 169 is represented by amino acid sequence
- SIGS SPWXi AS W AX 2 G wherein Xi is an amino acid selected from Y or F, and X 2 is selected from Q or L.
- SEQ ID NO: 170 is represented by amino acid sequence
- SEQ ID NO: 171 is represented by amino acid sequence QSSQSVYDNNDLXi, wherein Xi is an amino acid selected from A or G.
- SEQ ID NO: 172 is represented by amino acid sequence AGGYXiGDIYT, wherein Xi is an amino acid selected from S or N.
- SEQ ID NO: 173 is represented by amino acid sequence XiYAX 2 D, wherein X 1 is an amino acid selected from N or S, and X 2 is selected from M or I.
- SEQ ID NO: 174 is represented by amino acid sequence
- VIAPNX 1 X 2 TX3YPTWARG wherein Xi is an amino acid selected from R, G, or H; X 2 is an amino acid selected from R, A, or Y; and X 3 is an amino acid selected from Y or C.
- SEQ ID NO: 175 is represented by amino acid sequence YPIXiX 2 GX 3 NI, wherein X 1 is an amino acid selected from E or D; X 2 is an amino acid selected from P, A, S, or T; and X 3 is an amino acid selected from A or S.
- SEQ ID NO: 176 is represented by amino acid sequence QSSESVXiX 2 NNQLS, wherein X 1 is an amino acid selected from D or G, and X 2 is an amino acid selected from Y, N, or M.
- SEQ ID NO: 177 is represented by amino acid sequence VIAPSXiTTYYPTWAKG, wherein Xi is an amino acid selected from G or S.
- SEQ ID NO: 178 is represented by amino acid sequence YPIDPGSNXi, wherein X 1 is an amino acid selected from I or V.
- SEQ ID NO: 179 is represented by amino acid sequence XiX 2 AMD, wherein X 1 is an amino acid selected from N or S, and X 2 is an amino acid selected from Y or H.
- SEQ ID NO: 180 is represented by amino acid sequence YPIDXiGANV, wherein X 1 is an amino acid selected from V or A.
- isolated monoclonal antibodies or antigen-binding fragments thereof comprising:
- isolated monoclonal antibodies or antigen-binding fragments thereof to apelin that specifically bind to an epitope comprising the amino acid sequence of SEQ ID NO: 188.
- the isolated monoclonal antibody or antigen-binding fragment thereof can, for example, inhibit apelin activity.
- the isolated monoclonal antibody or antigen-binding fragment thereof can, for example, specifically bind pyro-apelin-13, apelin-13, apelin-17, apelin-36, apelin-55, and/or other forms of apelin that share the same C-terminal end with apelin-13.
- isolated monoclonal antibodies or antigen-binding fragments thereof to apelin that specifically bind to an epitope comprising the amino acid sequence of SEQ ID NO:204.
- the isolated monoclonal antibody or antigen-binding fragment thereof can, for example, inhibit apelin activity.
- the isolated monoclonal antibody or antigen-binding fragment thereof can, for example, specifically bind apelin-13 and pyro- apelin-13.
- the isolated monoclonal antibody or antigen-binding fragment thereof is chimeric.
- the isolated monoclonal antibody or antigen-binding fragment thereof is human or humanized.
- the humanized monoclonal antibody or antigen-binding fragment thereof comprises:
- isolated nucleic acids encoding the monoclonal antibodies or antigen-binding fragment thereof of the invention disclosed herein.
- vectors comprising the isolated nucleic acids encoding the monoclonal antibodies or antigen-binding fragments thereof of the invention.
- host cells comprising the vectors comprising the isolated nucleic acids encoding the monoclonal antibodies or antigen-binding fragments thereof of the invention.
- a pharmaceutical composition comprising an isolated monoclonal antibody or antigen-binding fragment thereof of the invention and a pharmaceutically acceptable carrier.
- DR diabetic retinopathy
- ATD age-related macular degeneration
- DME diabetic macular edema
- RVO retinal vein occlusion
- mCNV myopic choroidal neovascularization
- methods of treating a diabetic neovascularization comprising administering to the subject the pharmaceutical compositions of the invention.
- kidney disease CKD
- methods of treating a chronic kidney disease (CKD) in a subject in need thereof comprising administering to the subject the pharmaceutical compositions of the invention.
- CKD chronic kidney disease
- NASH non-alcoholic steatohepatitis
- CNV corneal neovascularization
- ROP retinopathy of prematurity
- ovarian hyperstimulation syndrome OHSS
- methods of treating ovarian hyperstimulation syndrome (OHSS) in a subject in need thereof comprising administering to the subject the pharmaceutical compositions of the invention.
- the cancer can be any liquid or solid cancer, for example, it can be selected from but not limited to, a lung cancer, a gastric cancer, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a cholangiocarcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non- Hodgkin's lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia
- NHL acute lymphocytic leukemia
- CLL chronic lymphocytic leukemia
- CML chronic myelog
- the pharmaceutical composition further comprises a second therapeutic anti-cancer agent.
- the second therapeutic anti-cancer agent can, for example, be an anti-VEGF agent.
- the anti-VEGF agent can, for example, be Avastin® or a bevacizumab biosimilar agent.
- the anti-VEGF agent can, for example, be a VEGFRl and/or VEGFR2 blocker.
- the methods comprise (a) obtaining a sample from the subject; (b) contacting the sample with an antibody or antigen-binding fragment thereof of the invention; and (c) determining a level of apelin in the subject.
- the sample is a tissue sample.
- the tissue sample can, for example, be a cancer tissue sample, a hepatic tissue sample, or a kidney tissue sample.
- Also provided are methods of producing a pharmaceutical composition comprising the monoclonal antibody or antigen-binding fragment thereof of the invention, comprising combining the monoclonal antibody or antigen-binding fragment with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
- FIGS. 1 A-1C show binding of anti-apelin mAbs to various biotinylated apelin peptides measured by ELISA.
- Biotinylated apelin peptides were immobilized on ELISA plates coated with neutravidin and purified recombinant rabbit anti-apelin mAbs were added for binding to the peptides on the plates. The binding was detected by adding a goat anti-rabbit IgG Fc-conjugated to alkaline phosphatase and PNPP substrate, and measured as the absorbance at 405 nm.
- FIG. 1 A shows a graph demonstrating the binding of anti-apelin mAbs C5, C8, CI 7, C24, C25, C26, C27, C4 and C9 to various biotinylated apelin peptides as measured by ELISA.
- FIG. IB shows a graph demonstrating the binding of anti-apelin mAbs CI, C6, C7, CIO, C12, and C16 to various biotinylated apelin peptides as measured by ELISA.
- FIG. 1C shows a graph demonstrating the binding of anti-apelin mAbs C5, C8, CI 7, C24, C25, C26, C27, C4 and C9 to various biotinylated apelin peptides as measured by ELISA.
- FIG. IB shows a graph demonstrating the binding of anti-apelin mAbs CI, C6, C7, CIO, C12, and C16 to various biotinylated apelin peptides as
- FIGS. 2A-2K show the neutralizing effect of select anti-apelin mAbs in a cell- based assay for apelin activity. Apelin activity was assessed for its ability to
- FIG. 2 A shows a graph of the activity of the anti-apelin mAb C 1.
- FIG. 2B shows a graph of the activity of the anti-apelin mAb C6.
- FIG. 2C shows a graph of the activity of the anti-apelin mAb C7.
- FIG. 2D shows a graph of the activity of the anti-apelin mAb C8.
- FIG. 2E shows a graph of the activity of the anti-apelin mAb C24.
- FIG. 2F shows a graph of the activity of the anti-apelin mAb C25.
- FIG. 2G shows a graph of the activity of the anti-apelin mAb CIO.
- FIG. 2H shows a graph of the activity of the anti-apelin mAb CI 1.
- FIG. 21 shows a graph of the activity of the anti-apelin mAb C12.
- FIG. 2J shows a graph of the activity of the anti-apelin mAb C22.
- FIG. 2K shows a graph of the activity of the anti-apelin mAb C
- FIGS. 3A-3C show graphs demonstrating the inhibition of biotin-apelin-13 (SEQ ID NO: 165) binding to the anti-apelin mAbs C8, C24 and C25 by the competition peptides in Table 7 as measured by ELISA.
- Goat-anti -rabbit IgG was immobilized on an ELISA plate.
- a mixture of a rabbit anti-apelin mAb (C8, C24, or C25) and a competition peptide was preincubated for 30 minutes at room temperature and then biotin-apelin-13 (SEQ ID NO: 165) was added, mixed and the final solution was added on the plate.
- FIGS. 4A-4C show graphs demonstrating the inhibition of biotin-apelin-13 (SEQ ID NO: 165) binding to the anti-apelin mAbs C8, C24 and C25 by the alanine scanning peptides (Table 8) derived from epitope 8-13 (KGPMPF (SEQ ID NO: 188)) as measured by ELISA.
- Goat anti-rabbit IgG was immobilized on an ELISA plate.
- a mixture of a rabbit anti-apelin mAb (C8, C24, or C25) and an alanine scanning peptide was
- biotin-apelin-13 (SEQ ID NO: 165) was added, mixed and the final solution was added on the plate.
- Several competition peptides were used as controls.
- FIGS. 5A-5C show graphs demonstrating the inhibition of apelin-13-biotin ((QRPRLSHKGPMPF-biotin (SEQ ID NO: 165)) binding to the anti-apelin mAbs CI, C6 and C7 by the competition peptides in Table 9 as measured by ELISA.
- Goat-anti -rabbit IgG was immobilized on an ELISA plate.
- a mixture of a rabbit anti-apelin mAb (CI, C6, or C7) and a competition peptide was preincubated for 30 minutes at room temperature and then apelin-13-biotin (SEQ ID NO: 165) was added, mixed and the final solution was added on the plate.
- FIGS. 6A-6B show graphs demonstrating the inhibition of apelin-13-biotin (SEQ ID NO: 165) binding to the anti-apelin mAbs C6 (FIG. 6A) and C7 (FIG. 6B) by the alanine scanning peptides (Table 10) derived from epitope 1-5 (QRPRL (SEQ ID NO: 204)) as measured by ELISA described above.
- FIGS. 7A-7B show the IC50 curves of humanized anti-apelin mAb A31 in a cell- based assay.
- Apelin activity was assessed for its ability to downregulate the forskolin (FSK)-induced cAMP production in cAMP HunterTM CHO-K1 AGTRL1 Gi cells (DiscoverX #95-0147C2) and the activity of the anti-apelin mAb was assessed for its ability to reverse the inhibitory effect of apelin.
- FIG. 7A shows an IC50 graph when apelin 13 (APL13) was used in the assay.
- FIG. 7B shows an IC50 graph when pyro- apelin 13 (pyroAPL13) was used in the assay.
- CPS counts per second.
- FIG. 8 shows the effect of humanized anti-apelin mAb A31 on tumor growth in a xenograft model. The mAb was tested either alone or in combination with
- any numerical values such as a concentration or a concentration range described herein, are to be understood as being modified in all instances by the term "about.”
- a numerical value typically includes ⁇ 10% of the recited value.
- a concentration of 1 mg/mL includes 0.9 mg/mL to 1.1 mg/mL.
- a concentration range of 1% to 10% (w/v) includes 0.9% (w/v) to 11%) (w/v).
- the use of a numerical range expressly includes all possible subranges, all individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise.
- the terms "comprises,” “comprising,” “includes,” “including,” “has,” “having,” “contains” or “containing,” or any other variation thereof, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers and are intended to be non-exclusive or open-ended.
- a composition, a mixture, a process, a method, an article, or an apparatus that comprises a list of elements is not necessarily limited to only those elements but can include other elements not expressly listed or inherent to such
- composition, mixture, process, method, article, or apparatus refers to an inclusive or and not to an exclusive or.
- a condition A or B is satisfied by any one of the following: A is true (or present) and B is false (or not present), A is false (or not present) and B is true (or present), and both A and B are true (or present).
- the conjunctive term "and/or" between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by "and/or," a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term "and/or" as used herein.
- subject means any animal, preferably a mammal, most preferably a human.
- mammal encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc., more preferably a human.
- nucleic acids or polypeptide sequences e.g., anti-apelin antibodies, apelin polypeptides, and polynucleotides that encode them
- sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
- sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by visual inspection (see generally, Current Protocols in Molecular Biology, F.M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement) (Ausubel)).
- BLAST and BLAST 2.0 algorithms are described in Altschul et al. (1990) J. Mol. Biol. 215: 403-410 and Altschul et al. (1997) Nucleic Acids Res. 25: 3389-3402, respectively.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
- This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra).
- HSPs high scoring sequence pairs
- T is referred to as the neighborhood word score threshold (Altschul et al, supra).
- These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them.
- the word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased.
- the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89: 10915 (1989)).
- the BLAST algorithm In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
- a further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below.
- a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative
- nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions.
- the terms “inhibit,” “inhibiting,” and “inhibition,” mean to decrease an activity, response, condition, disease or other biological parameter. This can include, but is not limited to complete ablation of the activity, response, condition, or disease. This can also include, for example, a 10% reduction in the activity, response, condition, or disease as compared to the native or control level. Thus, the reduction can be a 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between as compared to native or control levels.
- an antibody of the invention can inhibit the activity of an apelin protein. The activity of the apelin protein can be reduced or ablated relative to the native apelin protein activity. Antibodies
- the invention generally relates to isolated anti-apelin antibodies, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies.
- DR diabetic retinopathy
- PDR proliferative diabetic retinopathy
- PDR non-proliferative diabetic retinopathy
- AMD age
- CNV neovascularization
- ROP retinopathy of prematurity
- OHSS ovarian hyperstimulation syndrome
- endometriosis endometrial hyperplasia and cancer, myometrial leiomyomas,
- adenomyosis e.g., cancer (e.g., solid tumors and hematologic malignancies), and fibrosis (e.g., pathological and physiological fibrosis, renal fibrosis, cardiac fibrosis, liver fibrosis, and pulmonary fibrosis), are also provided.
- the antibodies of the invention possess one or more desirable functional properties, including but not limited to high-affinity binding to apelin, high specificity to apelin, and the ability to block the binding of apelin to an apelin receptor.
- the invention relates to isolated monoclonal antibodies or antigen-binding fragments thereof that specifically bind apelin.
- antibody is used in a broad sense and includes immunoglobulin or antibody molecules including human, humanized, composite and chimeric antibodies and antibody fragments that are monoclonal or polyclonal. In general, antibodies are proteins or peptide chains that exhibit binding specificity to a specific antigen. Antibody structures are well known. Immunoglobulins can be assigned to five major classes (i.e., IgA, IgD, IgE, IgG and IgM), depending on the heavy chain constant domain amino acid sequence. IgA and IgG are further sub-classified as the isotypes IgAl, IgA2, IgGl, IgG2, IgG3 and IgG4.
- the antibodies of the invention can be of any of the five major classes or corresponding sub-classes.
- the antibodies of the invention are IgGl, IgG2, IgG3 or IgG4.
- Antibody light chains of vertebrate species can be assigned to one of two clearly distinct types, namely kappa and lambda, based on the amino acid sequences of their constant domains.
- the antibodies of the invention can contain a kappa or lambda light chain constant domain.
- the antibodies of the invention include heavy and/or light chain constant regions from rat or human antibodies.
- antibodies contain an antigen-binding region that is made up of a light chain variable region and a heavy chain variable region, each of which contains three domains (i.e., complementarity determining regions 1-3; (CDR1, CDR2, and CDR3)).
- the light chain variable region domains are alternatively referred to as LCDR1, LCDR2, and LCDR3, and the heavy chain variable region domains are alternatively referred to as HCDR1, HCDR2, and HCDR3.
- an "isolated antibody” refers to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to apelin and is substantially free of antibodies that do not bind to apelin). In addition, an isolated antibody is substantially free of other cellular material and/or chemicals.
- the term "monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that can be present in minor amounts.
- the monoclonal antibodies of the invention can be made by the hybridoma method, phage display technology, single lymphocyte gene cloning technology, or by recombinant DNA methods.
- the monoclonal antibodies can be produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, such as a transgenic mouse or rat, having a genome comprising a human heavy chain transgene and a light chain transgene.
- the term "antigen-binding fragment” refers to an antibody fragment such as, for example, a diabody, a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv) 2 , a bispecific dsFv (dsFv-dsFv 1 ), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), a single domain antibody (sdab) an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure.
- an antibody fragment such as, for example, a diabody, a Fab
- an antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment binds.
- the antigen-binding fragment comprises a light chain variable region, a light chain constant region, and an Fd segment of the heavy chain.
- the antigen-binding fragment comprises Fab and F(ab').
- single-chain antibody refers to a conventional single- chain antibody in the field, which comprises a heavy chain variable region and a light chain variable region connected by a short peptide of about 15 to about 20 amino acids.
- single domain antibody refers to a conventional single domain antibody in the field, which comprises a heavy chain variable region and a heavy chain constant region or which comprises only a heavy chain variable region.
- human antibody refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide.
- humanized antibody refers to a non-human antibody that is modified to increase the sequence homology to that of a human antibody, such that the antigen-binding properties of the antibody are retained, but its antigenicity in the human body is reduced.
- chimeric antibody refers to an antibody wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
- the variable region of both the light and heavy chains often corresponds to the variable region of an antibody derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) having the desired specificity, affinity, and capability, while the constant regions correspond to the sequences of an antibody derived from another species of mammal (e.g., human) to avoid eliciting an immune response in that species.
- multispecific antibody refers to an antibody that comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
- the first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein).
- the first and second epitopes overlap or substantially overlap.
- the first and second epitopes do not overlap or do not substantially overlap.
- the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
- a multispecific antibody comprises a third, fourth, or fifth immunoglobulin variable domain.
- a multispecific antibody is a bispecific antibody molecule, a trispecific antibody, or a tetraspecific antibody molecule.
- bispecifc antibody refers to a multispecific antibody that binds no more than two epitopes or two antigens.
- a bispecific antibody is
- first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein). In an embodiment, the first and second epitopes overlap or substantially overlap. In an embodiment the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
- a bispecific antibody comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
- a bispecific antibody comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
- a bispecific antibody comprises a scFv, or fragment thereof, having binding specificity for a first epitope, and a scFv, or fragment thereof, having binding specificity for a second epitope.
- the first epitope is located on apelin and the second epitope is located on VEGF, Angiopoietin-2 (ANG-2), leucine-rich alpha-2-glycoprotein 1 (LRG1), PD-1, PD-L1, LAG-3, TIM-3, CTLA-4, HER-2, EGFR, CD19, CD73, CD47, CD20, CD33, DLL3, claudinl8.2, TIP-1, CD3, PDGFp, collagen type VI receptor, TGF-beta receptors, LOXL2, p75 neurotrophin receptor (NGFR p75), and/or Insulin-like growth factor 2 receptor (IGF2R).
- ANG-2 Angiopoietin-2
- LRG1 leucine-rich alpha-2-glycoprotein 1
- PD-1 PD-1
- PD-L1 leucine-rich alpha-2-glycoprotein 1
- LRG1 leucine-rich alpha-2-glycoprotein 1
- an anti- apelin monoclonal antibody or antigen-binding fragment thereof of the invention and an anti-VEGF antibody (e.g., Avastin® or a bevacizumab biosimilar agent) or antigen- binding fragment thereof are engineered to form a bispecific antibody that targets both apelin and VEGF.
- apelin refers to a 77 amino acid precursor protein, termed preproapelin, and its processed isoforms, which include apelin-13, apelin-16, apelin-17, apelin-36, apelin-55, and other forms derived from the 77-amino acid precursor.
- Each isoform has a distinct activity and acts by being a ligand for the apelin receptor APJ (also referred to as apelinR, AGTRLl, or APL R), which is a class A, rhodopsin-like, G-protein coupled receptor (GPCR).
- APJ also referred to as apelinR, AGTRLl, or APL R
- GPCR G-protein coupled receptor
- the receptor binding affinities for apelin isoforms are different, which can account for different potencies in triggering intracellular signaling of the apelin receptor APJ.
- the apelin/ APJ system plays important and various roles in the physiology and pathophysiology of many organs, including, but not limited to, regulation of blood pressure, cardiac contractility, cardiovascular tone, tissue angiogenesis, water homeostasis, gastrointestinal track physiology, metabolic balance, proliferation of vascular smooth muscle cell (VSMC) and other cell types, monocyte adhesion of human umbilical vein endothelial cells, cardiac repair post myocardial infarction, and pathological fibrosis in several tissues or organs.
- VSMC vascular smooth muscle cell
- monocyte adhesion of human umbilical vein endothelial cells cardiac repair post myocardial infarction
- pathological fibrosis in several tissues or organs.
- human apelin refers to a apelin originated from a human.
- An exemplary amino acid sequence of the precursor human apelin is
- AAF25815.1 (SEQ ID NO:221).
- an antibody that "specifically binds to apelin” refers to an antibody that binds to a apelin, preferably a human apelin, with a KD of 1 ⁇ 10 ⁇ 7 M or less, preferably 1 ⁇ 10 ⁇ 8 M or less, more preferably 5 10 ⁇ 9 M or less, 1 ⁇ 10 ⁇ 9 M or less, 5 10 ⁇ 10 M or less, or 1 ⁇ 10 ⁇ 10 M or less.
- KD refers to the dissociation constant, which is obtained from the ratio of Kd to Ka (i.e., Kd/Ka) and is expressed as a molar concentration (M). KD values for antibodies can be determined using methods in the art in view of the present disclosure.
- the KD of an antibody can be determined by using surface plasmon resonance, such as by using a biosensor system, e.g., a Biacore® system, or by using bio-layer interferometry technology, such as a Octet RED96 system.
- a biosensor system e.g., a Biacore® system
- bio-layer interferometry technology such as a Octet RED96 system.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), a HCDR2, a HCDR3, a light chain complementarity determining region 1 (LCDR1), a LCDR2, and a LCDR3, having the polypeptide sequences of:
- the antibody or antigen-binding fragment thereof specifically binds apelin, preferably human apelin.
- SEQ ID NO: 168 is represented by the amino acid sequence XiNRX 2 S, wherein Xi is an amino acid selected from S or T, and X 2 is an amino acid selected from M or V.
- SEQ ID NO: 169 is represented by amino acid sequence
- SIGS SPWXi AS W AX 2 G wherein Xi is an amino acid selected from Y or F, and X 2 is selected from Q or L.
- SEQ ID NO: 170 is represented by amino acid sequence GGYRPGX 1 SX 2 , wherein Xi is an amino acid selected from A or G, and X 2 is an amino acid selected from V or I.
- SEQ ID NO: 171 is represented by amino acid sequence QSSQSVYDNNDLXi, wherein X 1 is an amino acid selected from A or G.
- SEQ ID NO: 172 is represented by amino acid sequence AGGYXiGDIYT, wherein X 1 is an amino acid selected from S or N.
- SEQ ID NO: 173 is represented by amino acid sequence XiYAX 2 D, wherein Xi is an amino acid selected from N or S, and X 2 is selected from M or I.
- SEQ ID NO: 174 is represented by amino acid sequence
- VIAPNX 1 X 2 TX3YPTWARG wherein Xi is an amino acid selected from R, G, or H; X 2 is an amino acid selected from R, A, or Y; and X 3 is an amino acid selected from Y or C.
- SEQ ID NO: 175 is represented by amino acid sequence YPIXiX 2 GX 3 NI, wherein Xi is an amino acid selected from E or D; X 2 is an amino acid selected from P, A, S, or T; and X 3 is an amino acid selected from A or S.
- SEQ ID NO: 176 is represented by amino acid sequence QSSESVXiX 2 NNQLS, wherein X 1 is an amino acid selected from D or G, and X 2 is an amino acid selected from Y, N, or M.
- SEQ ID NO: 177 is represented by amino acid sequence
- VIAPSXiTTYYPTWAKG wherein Xi is an amino acid selected from G or S.
- SEQ ID NO: 178 is represented by amino acid sequence YPIDPGSNXi, wherein X 1 is an amino acid selected from I or V.
- SEQ ID NO: 179 is represented by amino acid sequence XiX 2 AMD, wherein Xi is an amino acid selected from N or S, and X 2 is an amino acid selected from Y or H.
- SEQ ID NO: 180 is represented by amino acid sequence YPIDXiGANV, wherein X 1 is an amino acid selected from V or A.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to one of SEQ ID NOs: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, or 39, or a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to one of SEQ ID NOs:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, or 40.
- the isolated monoclonal antibody or antigen-binding fragment thereof of the invention comprises a heavy chain variable region having the polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to
- SEQ ID NO: 1 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, or 39, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, or 40, respectively.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, comprising: a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 1, and a light chain variable region having the polypeptide sequence of SEQ ID NO:2;
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:41, 42, 43, 101, 102, and 103, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 1, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:2.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 1; and a light chain variable region having the polypeptide sequence of SEQ ID NO:2.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1,
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:3, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:4.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:3; and a light chain variable region having the polypeptide sequence of SEQ ID NO:4.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1,
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:5, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:6.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 5; and a light chain variable region having the polypeptide sequence of SEQ ID NO:6.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:50, 51, 52, 110, 111, and 112, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 7, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:8.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 7; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 8.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:53, 54, 55, 113, 114, and 115, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 9, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 10.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 9; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 10.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:56, 57, 58, 116, 117, and 118, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 11, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 12.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 11 ; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 12.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:59, 60, 61, 119, 120, and 121, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 13, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 14.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 13; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 14.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:62, 63, 64, 122, 123, and 124, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 15, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 16.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 15; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 16.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:65, 66, 67, 125, 126, and 127, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 17, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 18.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 17; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 18.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1,
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 19, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:20.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 19; and a light chain variable region having the polypeptide sequence of SEQ ID NO:20.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:71, 72, 73, 131, 132, and 133, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:21, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:22.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:21; and a light chain variable region having the polypeptide sequence of SEQ ID NO:22.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:74, 75, 76, 134, 135, and 136, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:23, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:24.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:23; and a light chain variable region having the polypeptide sequence of SEQ ID NO:24.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:77, 78, 79, 137, 138, and 139, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:25, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:26.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:25; and a light chain variable region having the polypeptide sequence of SEQ ID NO:26.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:80, 81, 82, 140, 141, and 142, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:27, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:28.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:27; and a light chain variable region having the polypeptide sequence of SEQ ID NO:28.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:83, 84, 85, 143, 144, and 145, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:29, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:30.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:29; and a light chain variable region having the polypeptide sequence of SEQ ID NO:30.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:86, 87, 88, 146, 147, and 148, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 31, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:32.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:31; and a light chain variable region having the polypeptide sequence of SEQ ID NO:32.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:89, 90, 91, 149, 150, and 151, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:33, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:34.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:33; and a light chain variable region having the polypeptide sequence of SEQ ID NO:34.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1,
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:35, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:36.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:35; and a light chain variable region having the polypeptide sequence of SEQ ID NO:36.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:95, 96, 97, 155, 156, and 157, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 37, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:38.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 37; and a light chain variable region having the polypeptide sequence of SEQ ID NO:38.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:98, 99, 100, 158, 159, and 160, respectively.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 39, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:40.
- the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 39; and a light chain variable region having the polypeptide sequence of SEQ ID NO:40.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof to apelin that specifically binds to an epitope comprising the amino acid sequence of SEQ ID NO: 188.
- the isolated monoclonal antibody or antigen-binding fragment thereof can, for example, inhibit apelin activity.
- the monoclonal antibody or antigen-binding fragment thereof can, for example, specifically bind pyro-apelin-13, apelin-13, apelin-17, apelin-36, apelin-55, and/or other forms of apelin that share the same C-terminal end with apelin-13.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof to apelin that specifically binds to an epitope comprising the amino acid sequence of SEQ ID NO:204.
- the isolated monoclonal antibody or antigen-binding fragment thereof can, for example, inhibit apelin activity.
- the monoclonal antibody or antigen-binding fragment thereof can, for example, specifically bind apelin-13 and/or pyro-apelin-13.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the antibody or antigen-binding fragment thereof is chimeric.
- the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the antibody or antigen-binding fragment thereof is human or humanized.
- the invention relates to an isolated humanized monoclonal antibody or antigen-binding fragment, wherein the isolated humanized antibody or antigen-binding fragment thereof comprises:
- the invention relates to an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention.
- the coding sequence of a protein can be changed (e.g., replaced, deleted, inserted, etc.) without changing the amino acid sequence of the protein. Accordingly, it will be understood by those skilled in the art that nucleic acid sequences encoding monoclonal antibodies or antigen-binding fragments thereof of the invention can be altered without changing the amino acid sequences of the proteins.
- the invention in another general aspect, relates to a vector comprising an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention.
- Any vector known to those skilled in the art in view of the present disclosure can be used, such as a plasmid, a cosmid, a phage vector or a viral vector.
- the vector is a recombinant expression vector such as a plasmid.
- the vector can include any element to establish a conventional function of an expression vector, for example, a promoter, ribosome binding element, terminator, enhancer, selection marker, and origin of replication.
- the promoter can be a constitutive, inducible or repressible promoter.
- a number of expression vectors capable of delivering nucleic acids to a cell are known in the art and can be used herein for production of an antibody or antigen-binding fragment thereof in the cell.
- Conventional cloning techniques or artificial gene synthesis can be used to generate a recombinant expression vector according to embodiments of the invention.
- the invention in another general aspect, relates to a host cell comprising an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention.
- a host cell comprising an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention.
- Any host cell known to those skilled in the art in view of the present disclosure can be used for recombinant expression of antibodies or antigen- binding fragments thereof of the invention.
- the host cells are E. coli TGI or BL21 cells (for expression of, e.g., an scFv or Fab antibody), CHO-DG44 or CHO-K1 cells or HEK293 cells (for expression of, e.g., a full-length IgG antibody).
- the recombinant expression vector is transformed into host cells by conventional methods such as chemical transfection, heat shock, or electroporation, where it is stably integrated into the host cell genome such that the recombinant nucleic acid is effectively expressed.
- the invention relates to a method of producing a monoclonal antibody or antigen-binding fragment thereof of the invention, comprising culturing a cell comprising a nucleic acid encoding the monoclonal antibody or antigen- binding fragment thereof under conditions to produce a monoclonal antibody or antigen- binding fragment thereof of the invention, and recovering the antibody or antigen-binding fragment thereof from the cell or cell culture (e.g., from the supernatant). Expressed antibodies or antigen-binding fragments thereof can be harvested from the cells and purified according to conventional techniques known in the art and as described herein. Pharmaceutical Compositions
- the invention in another general aspect, relates to a pharmaceutical composition, comprising an isolated monoclonal antibody or antigen-binding fragment thereof of the invention and a pharmaceutically acceptable carrier.
- a pharmaceutical composition comprising an isolated monoclonal antibody or antigen-binding fragment thereof of the invention and a pharmaceutically acceptable carrier.
- composition means a product comprising an antibody of the invention together with a pharmaceutically acceptable carrier. Antibodies of the invention and compositions comprising them are also useful in the manufacture of a medicament for therapeutic applications mentioned herein.
- carrier refers to any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, oil, lipid, lipid containing vesicle, microsphere, liposomal encapsulation, or other material well known in the art for use in pharmaceutical formulations. It will be understood that the characteristics of the carrier, excipient or diluent will depend on the route of administration for a particular application.
- pharmaceutically acceptable carrier refers to a non-toxic material that does not interfere with the effectiveness of a composition according to the invention or the biological activity of a composition according to the invention. According to particular embodiments, in view of the present disclosure, any pharmaceutically acceptable carrier suitable for use in an antibody pharmaceutical composition can be used in the invention.
- compositions of the invention are known in the art, e.g., Remington: The Science and Practice of Pharmacy (e.g. 21st edition (2005), and any later editions).
- additional ingredients include: buffers, diluents, solvents, tonicity regulating agents, preservatives, stabilizers, and chelating agents.
- One or more pharmaceutically acceptable carriers can be used in formulating the pharmaceutical compositions of the invention.
- the pharmaceutical composition is a liquid formulation.
- a preferred example of a liquid formulation is an aqueous
- the liquid formulation can comprise a solution, a suspension, an emulsion, a microemulsion, a gel, and the like.
- An aqueous formulation typically comprises at least 50% w/w water, or at least 60%>, 70%, 75%, 80%, 85%, 90%, or at least 95% w/w of water.
- the pharmaceutical composition can be formulated as an injectable which can be injected, for example, via an injection device (e.g., a syringe or an infusion pump).
- the injection can be delivered subcutaneously, intramuscularly, intraperitoneally, intravitreally, or intravenously, for example.
- the pharmaceutical composition is a solid formulation, e.g., a freeze-dried or spray-dried composition, which can be used as is, or whereto the physician or the patient adds solvents, and/or diluents prior to use.
- Solid dosage forms can include tablets, such as compressed tablets, and/or coated tablets, and capsules (e.g., hard or soft gelatin capsules).
- the pharmaceutical composition can also be in the form of sachets, dragees, powders, granules, lozenges, or powders for reconstitution, for example.
- the dosage forms can be immediate release, in which case they can comprise a water-soluble or dispersible carrier, or they can be delayed release, sustained release, or modified release, in which case they can comprise water-insoluble polymers that regulate the rate of dissolution of the dosage form in the gastrointestinal tract or under the skin.
- the pharmaceutical composition can be delivered intranasally, intrabuccally, or sublingually.
- the pH in an aqueous formulation can be between pH 3 and pH 10.
- the pH of the formulation is from about 7.0 to about 9.5. In another embodiment of the invention, the pH of the formulation is from about 3.0 to about 7.0.
- the pharmaceutical composition comprises a buffer.
- buffers include: arginine, aspartic acid, bicine, citrate, disodium hydrogen phosphate, fumaric acid, glycine, glycylglycine, histidine, lysine, maleic acid, malic acid, sodium acetate, sodium carbonate, sodium dihydrogen phosphate, sodium phosphate, succinate, tartaric acid, tricine, and
- the buffer can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml.
- compositions comprising each one of these specific buffers constitute alternative embodiments of the invention.
- the pharmaceutical composition comprises a preservative.
- preservatives include: benzethonium chloride, benzoic acid, benzyl alcohol, bronopol, butyl 4-hydroxybenzoate, chlorobutanol, chlorocresol, chlorohexidine, chlorphenesin, o-cresol, m-cresol, p-cresol, ethyl 4- hydroxybenzoate, imidurea, methyl 4-hydroxybenzoate, phenol, 2-phenoxyethanol, 2- phenylethanol, propyl 4-hydroxybenzoate, sodium dehydroacetate, thiomerosal, and mixtures thereof.
- the preservative can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml.
- Pharmaceutical compositions comprising each one of these specific preservatives constitute alternative embodiments of the invention.
- the pharmaceutical composition comprises an isotonic agent.
- an isotonic agent such as sodium chloride
- an amino acid such as glycine, histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, and threonine
- an alditol such as glycerol, 1,2- propanediol propyleneglycol), 1,3 -propanediol, and 1,3-butanediol
- poly ethylenegly col e.g. PEG400
- Another example of an isotonic agent includes a sugar.
- Non-limiting examples of sugars can be mono-, di-, or polysaccharides, or water- soluble glucans, including for example fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, alpha and beta HPCD, soluble starch, hydroxyethyl starch, and sodium carboxymethylcellulose.
- Another example of an isotonic agent is a sugar alcohol, wherein the term "sugar alcohol” is defined as a C(4-8) hydrocarbon having at least one -OH group.
- Non-limiting examples of sugar alcohols include mannitol, sorbitol, inositol, galactitol, dulcitol, xylitol, and arabitol.
- the isotonic agent can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml.
- Pharmaceutical compositions comprising each one of these specific isotonic agents constitute alternative embodiments of the invention.
- the pharmaceutical composition comprises a chelating agent.
- chelating agents include citric acid, aspartic acid, salts of ethylenediaminetetraacetic acid (EDTA), and mixtures thereof.
- the chelating agent can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml.
- Pharmaceutical compositions comprising each one of these specific chelating agents constitute alternative embodiments of the invention.
- the pharmaceutical composition comprises a stabilizer.
- stabilizers include one or more aggregation inhibitors, one or more oxidation inhibitors, one or more surfactants, and/or one or more protease inhibitors.
- the pharmaceutical composition comprises a stabilizer, wherein said stabilizer is carboxy-/hydroxycellulose and derivates thereof (such as HPC, HPC-SL, HPC-L and HPMC), cyclodextrins, 2-methylthioethanol, polyethylene glycol (such as PEG 3350), polyvinyl alcohol (PVA), polyvinyl pyrrolidone, salts (such as sodium chloride), sulphur-containing substances such as monothioglycerol), or thioglycolic acid.
- the stabilizer can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific stabilizers constitute alternative embodiments of the invention.
- the pharmaceutical composition comprises one or more surfactants, preferably a surfactant, at least one surfactant, or two different surfactants.
- surfactant refers to any molecules or ions that are comprised of a water-soluble (hydrophilic) part, and a fat-soluble (lipophilic) part.
- the surfactant can, for example, be selected from the group consisting of anionic surfactants, cationic surfactants, nonionic surfactants, and/or zwitterionic surfactants.
- the surfactant can be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific surfactants constitute alternative embodiments of the invention.
- the pharmaceutical composition comprises one or more protease inhibitors, such as, e.g., EDTA, and/or benzamidine hydrochloric acid (HC1).
- the protease inhibitor can be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml.
- Pharmaceutical compositions comprising each one of these specific protease inhibitors constitute alternative embodiments of the invention.
- the invention relates to a method of producing a pharmaceutical composition comprising a monoclonal antibody or antigen-binding fragment thereof of the invention, comprising combining a monoclonal antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
- the invention in another general aspect, relates to a method of blocking the binding of apelin to an apelin receptor, the method comprising administering to the subject a pharmaceutical composition of the invention.
- the functional activity of antibodies and antigen-binding fragments thereof that bind apelin can be characterized by methods known in the art and as described herein.
- Methods for characterizing antibodies and antigen-binding fragments thereof that bind apelin include, but are not limited to, affinity and specificity assays including Biacore, ELISA, and OctetRed analysis; receptor ligand binding assays to detect blocking of the binding of apelin to an apelin receptor; cell-based assays to detect neutralizing activity of a mAb on apelin-stimulated intracellular signaling.
- the methods for characterizing antibodies and antigen-binding fragments thereof that bind apelin include those described below.
- the invention relates to a method of treating a diabetic retinopathy (DR) in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- DR diabetic retinopathy
- AMD age- related macular degeneration
- the invention in another general aspect, relates to a method of treating a diabetic macular edema (DME) in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- DME diabetic macular edema
- the invention in another general aspect, relates to a method of treating a macular edema following retinal vein occlusion (RVO) in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- RVO retinal vein occlusion
- the invention in another general aspect, relates to a method of treating a retinal degeneration in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- the invention relates to a method of a myopic choroidal neovascularization (mCNV) in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- mCNV myopic choroidal neovascularization
- the invention in another general aspect, relates to a method of treating a diabetic nephropathy in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- the invention in another general aspect, relates to a method of treating a chronic kidney disease (CKD) in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- CKD chronic kidney disease
- the invention in another general aspect, relates to a method of treating a nonalcoholic steatohepatitis (NASH) in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- NASH nonalcoholic steatohepatitis
- the invention in another general aspect, relates to a method of treating liver cirrhosis in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- the invention in another general aspect, relates to a method of treating plaque neovascularization in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention. [00170] In another general aspect, the invention relates to a method of treating rubeosis iridis in a subject in need thereof, comprising administering to the subject a
- the invention in another general aspect, relates to a method of treating neovascular glaucoma in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- the invention in another general aspect, relates to a method of treating corneal neovascularization (CNV) in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- CNV corneal neovascularization
- the invention in another general aspect, relates to a method of treating retinopathy of prematurity (ROP) in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- ROP retinopathy of prematurity
- the invention in another general aspect, relates to a method of treating retinopathy in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- the invention in another general aspect, relates to a method of treating macular degeneration in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- the invention in another general aspect, relates to a method of treating ovarian hyperstimulation syndrome (OHSS) in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- OHSS ovarian hyperstimulation syndrome
- the invention in another general aspect, relates to a method of treating uterine bleeding in a subject in need thereof, comprising administering to the subject a
- the invention in another general aspect, relates to a method of treating endometriosis in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- the invention in another general aspect, relates to a method of treating endometrial hyperplasia and cancer in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- the invention in another general aspect, relates to a method of treating myometrial leiomyomas in a subject in need thereof, comprising administering to a subject the pharmaceutical composition of the invention.
- the invention in another general aspect, relates to a method of treating adenomyosis in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- the invention in another general aspect, relates to a method of treating a fibrosis in a subject in need thereof, comprising administering to the subject a
- the fibrosis can, for example, be selected from a pathological and physiological fibrosis, a renal fibrosis, a cardiac fibrosis, a liver fibrosis, or a pulmonary fibrosis.
- the invention relates to a method of treating a cancer in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
- the cancer can be any liquid or solid cancer, for example, it can be selected from but not limited to, a lung cancer, a gastric cancer, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a cholangiocarcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin's lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma
- NHL non-Ho
- the pharmaceutical composition further comprises a second therapeutic anti-cancer agent.
- the second therapeutic anti-cancer agent can, for example be an anti-VEGF agent.
- the anti-VEGF agent can, for example, be Avastin® or a bevacizumab biosimilar agent.
- the anti-VEGF agent can, for example, be a VEGFRl and/or VEFR2 blocker.
- the anti-apelin monoclonal antibody or antigen-binding fragment thereof and the second therapeutic anti-cancer agent are coadministered in separate formulations.
- the anti-apelin monoclonal antibody or antigen-binding fragment thereof and the second therapeutic anti-cancer agent are co-administered in a single formulation.
- the anti-apelin monoclonal antibody or antigen-binding fragment thereof and the second therapeutic anti-cancer agent e.g., the anti-VEGF agent, such as Avastin®, are co-administered in a single formulation.
- the anti-apelin monoclonal antibody or antigen-binding fragment thereof and the second therapeutic anti-cancer agent e.g., the anti-VEGF agent, such as Avastin®
- the pharmaceutical composition comprises a therapeutically effective amount of the anti-apelin antibody or antigen- binding fragment thereof.
- therapeutically effective amount refers to an amount of an active ingredient or component that elicits the desired biological or medicinal response in a subject.
- a therapeutically effective amount can be determined empirically and in a routine manner, in relation to the stated purpose.
- a therapeutically effective amount means an amount of the anti-apelin antibody or antigen-binding fragment thereof that modulates an immune response in a subject in need thereof. Also as used herein with reference to anti-apelin antibodies or antigen-binding fragments thereof, a therapeutically effective amount means an amount of the anti-apelin antibody or antigen-binding fragment thereof that results in treatment of a disease, disorder, or condition; prevents or slows the progression of the disease, disorder, or condition; or reduces or completely alleviates symptoms associated with the disease, disorder, or condition.
- the disease, disorder or condition to be treated is cancer, preferably a cancer selected from the group consisting of lung cancer, gastric cancer, colon cancer, hepatocellular carcinoma, renal cell carcinoma, bladder urothelial carcinoma, cholangiocarcinoma, metastatic melanoma, breast cancer, ovarian cancer, cervical cancer, head and neck cancer, pancreatic cancer, glioma, glioblastoma, and other solid tumors, and non-Hodgkin's lymphoma (NHL), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), multiple myeloma (MM), acute myeloid leukemia (AML), and other liquid tumors.
- NHL non-Hodgkin's lymphoma
- ALL acute lymphocytic leukemia
- CLL chronic lymphocytic leukemia
- CML chronic myelogenous leukemia
- MM multiple myel
- a therapeutically effective amount refers to the amount of therapy which is sufficient to achieve one, two, three, four, or more of the following effects: (i) reduce or ameliorate the severity of the disease, disorder or condition to be treated or a symptom associated therewith; (ii) reduce the duration of the disease, disorder or condition to be treated, or a symptom associated therewith; (iii) prevent the progression of the disease, disorder or condition to be treated, or a symptom associated therewith; (iv) cause regression of the disease, disorder or condition to be treated, or a symptom associated therewith; (v) prevent the development or onset of the disease, disorder or condition to be treated, or a symptom associated therewith; (vi) prevent the recurrence of the disease, disorder or condition to be treated, or a symptom associated therewith; (vii) reduce hospitalization of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (viii) reduce
- hospitalization length of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith (ix) increase the survival of a subject with the disease, disorder or condition to be treated, or a symptom associated therewith; (xi) inhibit or reduce the disease, disorder or condition to be treated, or a symptom associated therewith in a subject; and/or (xii) enhance or improve the prophylactic or therapeutic effect(s) of another therapy.
- the therapeutically effective amount or dosage can vary according to various factors, such as the disease, disorder or condition to be treated, the means of
- compositions described herein are formulated to be suitable for the intended route of administration to a subject.
- the compositions described herein can be formulated to be suitable for intravenous, subcutaneous, or intramuscular administration.
- the terms “treat,” “treating,” and “treatment” are all intended to refer to an amelioration or reversal of at least one measurable physical parameter related to a cancer, a diabetic retinopathy (DR) disease, disorder or condition, an age-related macular degeneration (AMD) disease, disorder or condition, a diabetic macular edema (DME) disease, disorder or condition, a macular edema following retinal vein occlusion (RVO) disease, disorder or condition, a retinal degeneration disease, disorder or condition, a myopic choroidal neovascularization (mCNV) disease, disorder or condition, a diabetic nephropathy disease, disorder or condition, a chronic kidney disease (CKD), disorder or condition, a non-alcoholic steatohepatitis (NASH) disease, disorder or condition, a liver cirrhosis disease, disorder or condition, a plaque neovascularization disease, disorder or condition, a rubeos
- DR diabetic reti
- treatment can also refer to causing regression, preventing the progression, or at least slowing down the progression of the disease, disorder, or condition.
- “treat,” “treating,” and “treatment” refer to an alleviation, prevention of the development or onset, or reduction in the duration of one or more symptoms associated with the disease, disorder, or condition, such as a tumor or more preferably a cancer.
- “treat,” “treating,” and “treatment” refer to prevention of the recurrence of the disease, disorder, or condition.
- “treat,” “treating,” and “treatment” refer to an increase in the survival of a subject having the disease, disorder, or condition.
- “treat,” “treating,” and “treatment” refer to elimination of the disease, disorder, or condition in the subject.
- a composition used in the treatment of a cancer a diabetic retinopathy (DR) disease, disorder or condition, an age-related macular degeneration (AMD) disease, disorder or condition, a diabetic macular edema (DME) disease, disorder or condition, a macular edema following retinal vein occlusion (RVO) disease, disorder or condition, a retinal degeneration disease, disorder or condition, a myopic choroidal neovascularization (mCNV) disease, disorder or condition, a diabetic nephropathy disease, disorder or condition, a chronic kidney disease (CKD), disorder or condition, a non-alcoholic steatohepatitis (NASH) disease, disorder or condition, a liver cirrhosis disease, disorder or condition, a plaque neovascularization disease, disorder or condition, a rubeosis iridis disease, disorder or condition, a neovascular glaucoma disease, disorder or condition,
- DR diabetic retinopathy
- the composition can be used in combination with another treatment including, but not limited to, a chemotherapy, a therapy that blocks the VEGF/VEGFR1/VEGFR2 axis such as AVASTIN®, an anti-CD20 mAb, an anti-CTLA- 4 antibody, an anti-LAG-3 mAb, an anti-EGFR mAb, an anti-HER-2 mAb, an anti-CD 19 mAb, an anti-CD33 mAb, an anti-CD73 mAb, an anti-CD47 mAb, an anti-DLL-3 mAb, an anti-apelin mAb, an anti-TIP-1 mAb, an anti-CLDN18.2 mAb, an anti-FOLRl mAb, an anti-PD-Ll antibody, an anti-PD-1 antibody, a PD-l/PD-Ll therapy, or other immuno- oncology drugs, a targeted therapy, an anti angiogenic agent, a radiation therapy, or other anticancer drugs.
- Anti-apelin antibodies can be used to construct bispecific antibodies with partner mAbs against VEGF, angiopoietin-2 (ANG-2), leucine-rich alpha-2- glycoprotein 1 (LRG1), CD73, PD-1, PD-L1, LAG-3, TIM-3, CTLA-4, EGFR, HER-2, CD19, CD20, CD33, CD47, DLL3, claudinl8.2, TIP-1, CD3, PDGF , collagen type VI receptor, TGF-beta receptors, LOXL2, p75 neurotrophin receptor (NGFR p75), Insulinlike growth factor 2 receptor (IGF2R), and/or other mAbs to tumor surface antigens to treat cancers/tumors.
- VEGF angiopoietin-2
- LRG1 leucine-rich alpha-2- glycoprotein 1
- LRG1 leucine-rich alpha-2- glycoprotein 1
- CD73 CD73
- PD-1 PD-1
- the composition can be used in combination with another treatment including, but not limited to a VEGF blocker (e.g., ranibizumab (LUCENTIS®), aflibercept (EYLEA®, conbercept) or another anti-DR, anti-AMD, and/or anti-DME drug.
- a VEGF blocker e.g., ranibizumab (LUCENTIS®), aflibercept (EYLEA®, conbercept
- another anti-DR, anti-AMD, and/or anti-DME drug e.g., ranibizumab (LUCENTIS®), aflibercept (EYLEA®, conbercept
- Anti-apelin antibodies can be used to construct bispecific antibodies with partner mAbs against VEGF, ANG-2, and/or other mAbs to DR, AMD, and/or DME specific antigens to treat DR, AMD, and/or DME that express both apelin and the specific DR, AMD, and/or DME antigen.
- the term "in combination,” in the context of the administration of two or more therapies to a subject, refers to the use of more than one therapy.
- the use of the term “in combination” does not restrict the order in which therapies are
- a first therapy e.g., a composition described herein
- a first therapy can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapy to a subject.
- the invention in another general aspect, relates to a method of determining a level of apelin in a subject.
- the methods comprise (a) obtaining a sample from the subject; (b) contacting the sample with an antibody or antigen-binding fragment thereof of the invention; and (c) determining a level of apelin in the subject.
- sample refers to a biological sample isolated from a subject and can include, but is not limited to, whole blood, serum, plasma, blood cells, endothelial cells, tissue biopsies (e.g., a cancer tissue, a hepatic tissue, etc.), lymphatic fluid, ascites fluid, interstitial fluid, bone marrow, cerebrospinal fluid, saliva, mucous, sputum, sweat, urine, or any other secretion, excretion, or other bodily fluids.
- tissue biopsies e.g., a cancer tissue, a hepatic tissue, etc.
- the level of apelin in the subject can be determined utilizing assays selected from, but not limited to, a Western blot assay, an ELISA assay, and/or a radioimmunoassay (RIA).
- Relative protein levels can be determined by utilizing Western blot analysis and immunohistochemistry (IHC), and absolute protein levels can be determined by utilizing an ELISA assay or a RIA assay.
- IHC Western blot analysis and immunohistochemistry
- absolute protein levels can be determined by utilizing an ELISA assay or a RIA assay.
- the levels of apelin can be determined between at least two samples, e.g., between samples from the same subject at different time points, between samples from different tissues in the same subject, and/or between samples from different subjects.
- the absolute level of apelin in the sample can be determined by creating a standard for the ELISA assay prior to testing the sample, and when utilizing a RIA assay, the absolute level of apelin in the sample can be determined by mixing the sample with radiolabeled apelin and a known amount of the antibodies or antigen-binding fragments thereof of the invention to allow them to bind, separating the bound apelin (including the radiolabeled and native ones) from the free (unbound) ones (also including the radiolabeled and native ones), and measuring the radioactivity of the free (unbound) apelin.
- a person skilled in the art would understand which analytical techniques to utilize to determine the level of apelin in a sample from the subject utilizing the antibodies or antigen-binding fragments thereof of the invention.
- a level of apelin in a sample from a subject can lead to the diagnosis of abnormal (elevated, reduced, or insufficient) apelin levels in a disease and making appropriate therapeutic decisions.
- a disease can be selected from, but not limited to, a cardiovascular disease, a heart failure, a diabetes, an obesity, a diabetic retinopathy (DR), an age-related macular degeneration (AMD), a diabetic macular edema (DME), a macular edema following retinal vein occlusion (RVO), a retinal degeneration, a myopic choroidal neovascularization (mCNV), a diabetic nephropathy, a chronic kidney disease (CKD), a non-alcoholic steatohepatitis (NASH), a liver cirrhosis, a plaque neovascularization, a rubeosis iridis, a neovascular glaucoma, a corneal n
- Embodiment 1 is an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDRl), LCDR2, and LCDR3, having the polypeptide sequences of:
- the antibody or antigen-binding fragment thereof specifically binds apelin, preferably human apelin.
- Embodiment 2 is the isolated monoclonal antibody or antigen-binding fragment of embodiment 1, comprising a heavy chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, or 39, or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, or 40.
- Embodiment 3 is the isolated monoclonal antibody or antigen-binding fragment of embodiment 1 or 2, comprising
- Embodiment 4 is an isolated monoclonal antibody or antigen-binding fragment thereof to apelin that specifically binds to an epitope comprising the amino acid sequence of SEQ ID NO: 188.
- Embodiment 5 is an isolated monoclonal antibody or antigen-binding fragment thereof to apelin that specifically binds to an epitope comprising the amino acid sequence of SEQ ID NO:204.
- Embodiment 6 is the isolated monoclonal antibody or antigen-binding fragment thereof of embodiment 4 or 5, wherein the antibody or antigen-binding fragment thereof inhibits apelin activity.
- Embodiment 7 is the isolated monoclonal antibody or antigen-binding fragment thereof of embodiment 4, wherein the antibody or antigen-binding fragment thereof is capable of binding pyro-apelin-13, apelin-13, apelin-17, apelin-36, apelin-55, and/or other forms of apelin that share the same C-terminal end with apelin-13.
- Embodiment 8 is the isolated monoclonal antibody or antigen-binding fragment thereof of embodiment 5, wherein the antibody or antigen-binding fragment thereof is capable of binding apelin-13 and/or pyro-apelin-13.
- Embodiment 9 is the isolated monoclonal antibody or antigen-binding fragment of any one of embodiments 1 to 8, wherein the antibody or antigen-binding fragment thereof is chimeric.
- Embodiment 10 is the isolated monoclonal antibody or antigen-binding fragment of any one of embodiments 1 to 9, wherein the antibody or antigen-binding fragment thereof is human or humanized.
- Embodiment 11 is the isolated monoclonal antibody or antigen-binding fragment of embodiment 10, wherein the antibody or antigen-binding fragment thereof comprises:
- SEQ ID NO:215 b. a heavy chain variable region having the polypeptide sequence of SEQ ID NO:212, and a light chain variable region having the polypeptide sequence of SEQ ID NO:215;
- Embodiment 12 is an isolated nucleic acid encoding the monoclonal antibody or antigen-binding fragment of any one of embodiments 1 to 11.
- Embodiment 13 is a vector comprising the isolated nucleic acid of embodiment 12.
- Embodiment 14 is a host cell comprising the vector of embodiment 13.
- Embodiment 15 is a pharmaceutical composition, comprising the isolated monoclonal antibody or antigen-binding fragment of any one of embodiments 1 to 11 and a pharmaceutically acceptable carrier.
- Embodiment 16 is a method of blocking binding of apelin to an apelin receptor in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 17 is a method of treating a diabetic retinopathy (DR) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- DR diabetic retinopathy
- Embodiment 18 is a method of treating an age-related macular degeneration (AMD) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- AMD age-related macular degeneration
- Embodiment 19 is a method of treating a diabetic macular edema (DME) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- DME diabetic macular edema
- Embodiment 20 is a method of treating a macular edema following retinal vein occlusion (RVO) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- RVO retinal vein occlusion
- Embodiment 21 is a method of treating a retinal degeneration in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 22 is a method of treating a myopic choroidal neovascularization (mCNV) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- mCNV myopic choroidal neovascularization
- Embodiment 23 is a method of treating a diabetic nephropathy in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 24 is a method of treating a chronic kidney disease (CKD) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- CKD chronic kidney disease
- Embodiment 25 is a method of treating a non-alcoholic steatohepatitis (NASH) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 26 is a method of treating a liver cirrhosis in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- NASH non-alcoholic steatohepatitis
- Embodiment 27 is a method of treating a plaque neovascularization in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 28 is a method of treating a rubeosis iridis in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 29 is a method of treating a neovascular glaucoma in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 30 is a method of treating a corneal neovascularization (CNV) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- CNV corneal neovascularization
- Embodiment 31 is a method of treating a retinopathy of prematurity (ROP) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- ROP retinopathy of prematurity
- Embodiment 32 is a method of treating a retinopathy in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 33 is a method of treating a macular degeneration in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 34 is a method of treating a ovarian hyperstimulation syndrome (OHSS) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- OHSS ovarian hyperstimulation syndrome
- Embodiment 35 is a method of treating a uterine bleeding in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 36 is a method of treating an endometriosis in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 37 is a method of treating an endometrial hyperplasia and cancer in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 38 is a method of treating a myometrial leiomyomas in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 39 is a method of treating an adenomyosis in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 40 is a method of treating a cancer in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 41 is the method of embodiment 40, wherein the pharmaceutical composition further comprises a second anti-cancer agent.
- Embodiment 42 is the method of embodiment 41, wherein the second anticancer agent is an anti-VEGF agent.
- Embodiment 43 is the method of embodiment 42, wherein the anti-VEGF agent is AVASTIN® or a bevacizumab biosimilar agent.
- Embodiment 44 is the method of embodiment 42, wherein the anti-VEGF agent is a VEGFR1 and/or VEGFR2 blocker.
- Embodiment 45 is the method of any one of embodiments 40 to 44, wherein the cancer is selected from the group consisting of lung cancer, gastric cancer, colon cancer, hepatocellular carcinoma, renal cell carcinoma, bladder urothelial carcinoma, cholangiocarcinoma, metastatic melanoma, breast cancer, ovarian cancer, cervical cancer, head and neck cancer, pancreatic cancer, glioma, glioblastoma, and other solid tumors, and non-Hodgkin's lymphoma (NHL), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), multiple myeloma (MM), acute myeloid leukemia (AML), and other liquid tumors.
- Embodiment 46 is the method of embodiment 45, wherein the cancer is cholangiocarcinoma.
- Embodiment 47 is a method of treating a tissue fibrosis in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 15.
- Embodiment 48 is a method of determining a level of apelin in a subject, the method comprising (a) obtaining a sample from the subject; (b) contacting the sample with an antibody or antigen-binding fragment of any one of embodiments 1 to 11; and (c) determining a level of apelin in the subject.
- Embodiment 49 is the method of embodiment 48, wherein the sample is a tissue sample.
- Embodiment 50 is the method of embodiment 49, wherein the tissue sample is a cancer tissue sample.
- Embodiment 51 is the method of embodiment 49, wherein the tissue sample is a hepatic tissue sample.
- Embodiment 52 is the method of embodiment 49, wherein the tissue sample is a kidney tissue sample.
- Embodiment 53 is a method of producing the monoclonal antibody or antigen- binding fragment of any one of embodiments 1 to 11, comprising culturing a cell comprising a nucleic acid encoding the monoclonal antibody or antigen-binding fragment under conditions to produce the monoclonal antibody or antigen-binding fragment, and recovering the antibody or antigen-binding fragment from the cell or culture.
- Embodiment 54 is a method of producing a pharmaceutical composition comprising the monoclonal antibody or antigen-binding fragment of any one of embodiments 1 to 11, comprising combining the monoclonal antibody or antigen-binding fragment with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
- the rabbit antibody binding to pyr-apelin-13 was further confirmed by differential bindings of the antibodies to pyr-apelin-13-Cys (pE-RPRLSHKGPMPF-C (SEQ ID NO: 162)), Cys-(Q) apelin-13 (CQRPRLSHKGPMPF (SEQ ID NO: 164)) and Cys-apelin-17
- rabbit IgG cDNA was made from total RNA prepared from the identified B cells, amplified by PCR, and then cloned into an expression vector.
- variable regions of the heavy and light chains were sequenced.
- the sequences of heavy and light chain variable regions of the anti-apelin mAbs are listed in Table 1 and Table 2, respectively.
- the sequences of heavy and light chain CDRs of these mAbs are listed in Table 3 and Table 4, respectively.
- the heavy and light chain CDRs for the anti-apelin mAbs were determined utilizing the Kabat method.
- Table 1 Sequences of heavy chain variable regions for anti-apelin monoclonal antibodies
- VH heavy c lain variable region
- VL light chain variable region
- HC heavy chain
- CDR complementarity determining region
- HC CDRs for the anti-apelin mAbs were determined utilizing the EVIGT method (Lefranc, M.-P. et al., Nucleic Acids Res. 1999; 27:209-212).
- Table 4 CDR regions 1-3 of light chain for anti-apelin mAbs
- LC light chain
- CDR complementarity determining region
- the LC CDRs for the anti-apelin mAbs were determined utilizing the IMGT method (Lefranc, M.-P. et al., Nucleic Acids Res. 1999; 27:209-212).
- Example 2 Production and purification of recombinant mAbs
- the expression vector containing the rabbit IgG cDNA was transiently transfected into HEK293 cells.
- the recombinant antibodies were produced in the suspension of these HEK293 cells and purified using Protein A affinity chromatography.
- Example 3 Assessment of specific binding of anti-apelin mAbs to apelin peptides
- biotin-apelin-13 biotin- QRPRL SHKGPMPF (SEQ ID NO: 165)
- apelin- 13 -biotin QRPRLSHKGPMPF-biotin
- pyr-apelin- 13 -biotin pE-RPRLSHKGPMPF -biotin
- biotin-apelin-17 biotin-KFRRQRPRLSHKGPMPF (SEQ ID NO: 166)
- apelin- 17-biotin KFRRQRPRL SHKGPMPF -bi otin (SEQ ID NO: 166)
- biotin- apelin-(27-14) biotin-GPGAWQGGRRKFRR (SEQ ID NO: 167)
- neutravidin in carbonate coating buffer was coated on high binding ELISA plates at 1 ⁇ g/ml overnight.
- Peptides were added at 4 ⁇ g/ml after the plates were blocked with 1% BSA in TBS. After incubation of the plates at room temperature for 60 minutes, the plates were washed and then purified recombinant rabbit antibodies were added at 200 ng/ml. Following rabbit antibody binding to the peptides on the plates at room
- FIG. 1A-C Binding of anti-apelin mAbs to the apelin peptides are shown in Figures 1A-C (Biotin- APL13, biotin-apelin-13; APL13-Biotin, apelin- 13 -biotin; pyrAPL13-Biotin, pyr-apelin- 13-biotin; Biotin-APL17, biotin-apelin-17; APL17-Biotin, apelin- 17-biotin; Biotin- APL27-14, biotin-apelin-(27-14)).
- FIG. 1 A is affected by biotinylation of the C-terminus of the apelin peptides, suggesting that the C-terminal end of apelin is important for apelin binding by these mAbs.
- Apelin binding by certain mAbs in Figure IB is affected by biotinylation of the N-terminus of apelin-13.
- the mAbs in FIG. 1C have different binding profiles from those in FIGS. 1 A and IB.
- Example 4 Cell-based assay to evaluate the neutralizing effect of anti- apelin mAbs
- the HitHunter® cAMP assay was carried out using the cAMP HunterTM CHO- Kl AGTRL1 Gi cell line (#95-0147C2) (DiscoverX; Fremont, CA; USA). Cells were seeded in 384-well white tissue culture-treated plates (Corning # 3570) (Corning;
- the chemiluminescent signal was read on an En Vision plate reader (384 US Lum) (Perkin Elmer; Waltham, MA; USA). Each mAb was assayed in triplicate at a given dilution. To calculate the % inhibition by a mAb at a given concentration, 0% inhibition was defined as the signal from the FSK-stimulated cells with apelin treatment and 100% inhibition was defined as the signal from the FSK-stimulated cells with no apelin treatment. The neutralizing effects of select anti-apelin mAbs are shown in FIGS. 2A-K.
- Example 5 Affinity analysis of anti-apelin mAbs
- biotin-apelin-13 biotin-QRPRLSHKGPMPF (SEQ ID NO: 165)
- CM5-SA streptavidin
- Anti-apelin mAbs at four different concentrations (12.5 nM, 25 nM, 50 nM and 100 nM) were captured on the chip surface.
- the on- and off-rate for antibody-antigen binding were measured, curve fitted and calculated. The data are shown in Table 5.
- the antibody binding sites for anti-apelin mAbs C8, C24, and C25 were mapped using an ELISA-based peptide competition assay. Briefly, the mAb was captured on the ELISA plate and biotin-apelin-13 (SEQ ID NO: 165) binding to the mAb was measured. Each of the competition peptides (Table 7) was assessed for its ability to inhibit biotin-apelin-13 binding to the mAb. An inhibition signal reflects the ability of the competition peptide to bind to the mAb in solution.
- peptide competition assay goat anti-rabbit IgG in carbonate coating buffer was coated on high binding ELISA plates at 1 ⁇ g/ml overnight.
- FIGS. 3A-3C Each competition peptide or control sample was assayed in duplicate for a given mAb. Inhibition of biotin-apelin-13 (SEQ ID NO: 165) binding to the anti-apelin mAbs by the competition peptides are shown in FIGS. 3A-3C. "No comp:” no competition peptide was added; “No Ab, No Comp:” neither competition peptide nor anti-apelin mAb was added. As shown in FIG. 3 A, when one amino acid is deleted from the C-terminus of apelin 13, the peptide does not bind to C8. Serial deletion of the N-terminal amino acids of apelin 13 does not have effect on its binding to C8 until residue number 8 is deleted.
- mapping result indicates that C8 binds to the epitope comprising amino acids KGPMPF (SEQ ID NO: 188).
- C24 and C25 The same results were observed for C24 and C25. Therefore, C8, C24, and C25 all bind to the epitope comprising amino acids KGPMPF (SEQ ID NO: 188).
- alanine scanning peptides (Table 8) were generated and assessed for their ability to inhibit the binding of biotin-apelin-13 (SEQ ID NO: 165) to these mAbs using the ELISA-based peptide competition assay described above. Inhibition of biotin-apelin-13 (SEQ ID NO: 165) binding to the anti-apelin mAb C8, C24, or C25 by the alanine scanning peptides are shown in FIGS. 4A-4C.
- peptide 8 A still blocks binding of biotin-apelin-13 (SEQ ID NO: 165) to C8 but to a less extent compared with apelin 13 (peptide 1-13), 9A, or 10A.
- Peptides 11 A, 12A, and 13A largely lost the ability to block the binding of biotin-apelin-13 (SEQ ID NO: 165) to C8.
- Table 7 Apelin peptides used in the competition assay for anti-apelin mAbs C8, C24, and C25.
- FIGS. 5A-5C The antibody binding sites for anti-apelin mAbs CI, C6, and C7 were mapped with the ELISA-based peptide competition assay described above using apelin-13-biotin (QRPRL SHKGPMPF -bi otin (SEQ ID NO: 165)) and the competition peptides shown in Table 9.
- FIGS. 5A-5C Inhibition of apelin-13-biotin (SEQ ID NO: 165) binding to the anti-apelin mAbs CI, C6, and C7 by the competition peptides are shown in FIGS. 5A-5C. As shown in FIG. 5A, when one amino acid is deleted from the N-terminus of apelin 13, the peptide does not bind to CI .
- alanine scanning peptides (Table 10) were generated and assessed for their ability to inhibit the binding of apelin- 13 -biotin (SEQ ID NO: 165) to these mAbs using the ELISA-based peptide competition assay described above. Inhibition of apelin- 13 -biotin (SEQ ID NO: 165) binding to the anti-apelin mAb C6 or C7 by the alanine scanning peptides are shown in FIGS. 6A-6B.
- peptides 1 A, 2A, 3A, 4A and 5A lost the ability to block the binding of apelin- 13 -biotin (SEQ ID NO: 165) to C6 or C7.
- SEQ ID NO: 165 the side chains of residues 1, 2, 3, 4, and 5 are required for apelin binding to C6 or C7.
- the rabbit anti-apelin mAb C8 was humanized to reduce the potential of immunogenicity when used in human patients.
- the sequences of the variable regions of the heavy and light chains (VH and VL) were compared with the human antibody sequences in the Protein Data Bank (PDB) database and a homology model was built by applying SWISS-modeling.
- the CDRs in both the heavy and light chains of the rabbit mAb were grafted into human frameworks that have the highest possibility of maintaining the proper structure likely required for antigen binding. Backmutations from human residue to rabbit residue were designed when necessary.
- the sequences of the humanized VH and VL regions are shown in Table 11 and Table 12, respectively.
- the humanized VH and VL regions were fused to human IgGl heavy chain and kappa light chain constant regions, respectively, to generate humanized mAbs. Constructs
- FIG. 7A shows an IC50 graph when apelin 13 (APL13) was used in the assay;
- FIG. 7B shows an IC50 graph when pyro-apelin 13 (pyroAPL13) was used in the assay.
- CPS counts per second.
- FIG. 8 shows the tumor volumes in different groups during the study. The data indicate that the combination of mAb A31 with bevacizumab has a strong inhibitory effect on tumor growth.
- SSLDSGVPSRFSGSGSGTEFTLTISSLQCEDVATYYCAGGYSGDIYTFGGGTEVV VE (SEQ ID NO: 216)
- VL light chain variable region
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Immunology (AREA)
- Urology & Nephrology (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Endocrinology (AREA)
- Physics & Mathematics (AREA)
- Ophthalmology & Optometry (AREA)
- Food Science & Technology (AREA)
- Cell Biology (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Vascular Medicine (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Mycology (AREA)
- Epidemiology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (12)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US16/639,808 US11365242B2 (en) | 2017-08-24 | 2018-08-21 | Anti-apelin antibodies and uses thereof |
| AU2018322452A AU2018322452A1 (en) | 2017-08-24 | 2018-08-21 | Anti-apelin antibodies and uses thereof |
| EA202090531A EA202090531A1 (ru) | 2018-04-16 | 2018-08-21 | Антитела к апелину и их применение |
| MX2020002042A MX2020002042A (es) | 2017-08-24 | 2018-08-21 | Anticuerpos anti-apelin y sus usos. |
| KR1020207008305A KR20200038311A (ko) | 2017-08-24 | 2018-08-21 | 항-아펠린 항체 및 그의 용도 |
| CA3072261A CA3072261A1 (en) | 2017-08-24 | 2018-08-21 | Anti-apelin antibodies and uses thereof |
| BR112020003584-0A BR112020003584A2 (pt) | 2017-08-24 | 2018-08-21 | anticorpos antiapelina e usos dos mesmos |
| SG11202000899PA SG11202000899PA (en) | 2017-08-24 | 2018-08-21 | Anti-apelin antibodies and uses thereof |
| JP2020511350A JP7219265B2 (ja) | 2017-08-24 | 2018-08-21 | 抗アペリン抗体及びその使用 |
| CN201880055019.2A CN111032689B (zh) | 2017-08-24 | 2018-08-21 | 抗爱帕琳肽抗体及其用途 |
| EP18848958.7A EP3672987B1 (en) | 2017-08-24 | 2018-08-21 | Anti-apelin antibodies and uses thereof |
| IL272476A IL272476A (en) | 2017-08-24 | 2020-02-05 | Anti-Apelin antibodies and their uses |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762549523P | 2017-08-24 | 2017-08-24 | |
| US62/549,523 | 2017-08-24 | ||
| US201762579287P | 2017-10-31 | 2017-10-31 | |
| US62/579,287 | 2017-10-31 | ||
| US201862656586P | 2018-04-12 | 2018-04-12 | |
| US62/656,586 | 2018-04-12 | ||
| US201862658111P | 2018-04-16 | 2018-04-16 | |
| US62/658,111 | 2018-04-16 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019040390A1 true WO2019040390A1 (en) | 2019-02-28 |
Family
ID=65440110
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/047144 Ceased WO2019040390A1 (en) | 2017-08-24 | 2018-08-21 | ANTI-APELIN ANTIBODIES AND USES THEREOF |
Country Status (12)
| Country | Link |
|---|---|
| US (1) | US11365242B2 (enExample) |
| EP (1) | EP3672987B1 (enExample) |
| JP (1) | JP7219265B2 (enExample) |
| KR (1) | KR20200038311A (enExample) |
| CN (1) | CN111032689B (enExample) |
| AU (1) | AU2018322452A1 (enExample) |
| BR (1) | BR112020003584A2 (enExample) |
| CA (1) | CA3072261A1 (enExample) |
| IL (1) | IL272476A (enExample) |
| MX (1) | MX2020002042A (enExample) |
| SG (1) | SG11202000899PA (enExample) |
| WO (1) | WO2019040390A1 (enExample) |
Cited By (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020257460A3 (en) * | 2019-06-19 | 2021-02-25 | Ab Initio Biotherapeutics, Inc. | Apj modulators and uses thereof |
| US20210163614A1 (en) * | 2018-06-13 | 2021-06-03 | Gmax Biopharm Llc | Apj antibody, fusion protein thereof with elabela, and pharmaceutical compositions and use thereof |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP2023511652A (ja) * | 2019-12-17 | 2023-03-22 | フェインズ セラピューティクス,インコーポレーテッド | 鎖間システインが選択的にマッチングされた二重特異性抗体及びその使用 |
| CN112442534B (zh) * | 2020-11-06 | 2022-03-15 | 温州医科大学 | 循环血外泌体miR-146a-5p作为视网膜静脉阻塞治疗及预后评估标志物中的应用 |
| CN114539415B (zh) * | 2020-11-24 | 2024-02-02 | 普米斯生物技术(珠海)有限公司 | 一种抗PD-L1/VEGF/TGF-β多特异性抗体及其用途 |
| CN112480267A (zh) * | 2020-12-04 | 2021-03-12 | 复旦大学附属华山医院 | 一种可特异性识别增殖状态内皮细胞的启动分子及工程细胞 |
| CN112546198B (zh) * | 2020-12-17 | 2022-03-25 | 温州医科大学慈溪生物医药研究院 | 一种用于治疗脑中风和急性脑梗的药物组合物 |
| CN114099642A (zh) * | 2021-11-12 | 2022-03-01 | 南通大学 | 基因Apln在制备治疗与细胞成血管有关疾病药物中的应用 |
| CN114031686A (zh) * | 2021-12-23 | 2022-02-11 | 杭州百凌生物科技有限公司 | 一种四型胶原蛋白ɑ5的抗体、检测试剂盒及其应用 |
Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160053000A1 (en) | 2011-07-18 | 2016-02-25 | Amgen Inc. | Apelin antigen-binding proteins and uses thereof |
| US20160130327A1 (en) * | 2013-06-10 | 2016-05-12 | Merck Sharp & Dohme Corp. | Cmv neutralizing antigen binding proteins |
Family Cites Families (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8946382B2 (en) * | 2009-02-27 | 2015-02-03 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Apelin peptides and methods of use |
| WO2013153049A1 (en) * | 2012-04-11 | 2013-10-17 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Polypeptides as apelin inhibitors and uses thereof |
| HK1220466A1 (zh) * | 2013-03-14 | 2017-05-05 | Regeneron Pharmaceuticals, Inc. | 爱帕琳融合蛋白和其用途 |
-
2018
- 2018-08-21 WO PCT/US2018/047144 patent/WO2019040390A1/en not_active Ceased
- 2018-08-21 KR KR1020207008305A patent/KR20200038311A/ko not_active Withdrawn
- 2018-08-21 JP JP2020511350A patent/JP7219265B2/ja active Active
- 2018-08-21 BR BR112020003584-0A patent/BR112020003584A2/pt not_active IP Right Cessation
- 2018-08-21 AU AU2018322452A patent/AU2018322452A1/en not_active Abandoned
- 2018-08-21 SG SG11202000899PA patent/SG11202000899PA/en unknown
- 2018-08-21 CN CN201880055019.2A patent/CN111032689B/zh active Active
- 2018-08-21 US US16/639,808 patent/US11365242B2/en active Active
- 2018-08-21 CA CA3072261A patent/CA3072261A1/en active Pending
- 2018-08-21 EP EP18848958.7A patent/EP3672987B1/en active Active
- 2018-08-21 MX MX2020002042A patent/MX2020002042A/es unknown
-
2020
- 2020-02-05 IL IL272476A patent/IL272476A/en unknown
Patent Citations (2)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20160053000A1 (en) | 2011-07-18 | 2016-02-25 | Amgen Inc. | Apelin antigen-binding proteins and uses thereof |
| US20160130327A1 (en) * | 2013-06-10 | 2016-05-12 | Merck Sharp & Dohme Corp. | Cmv neutralizing antigen binding proteins |
Non-Patent Citations (44)
| Title |
|---|
| "Current Protocols", 1995, GREENE PUBLISHING ASSOCIATES, INC., article "Current Protocols in Molecular Biology" |
| "GenBank", Database accession no. AAF25815.1 |
| "Remington: The Science and Practice of Pharmacy", 2005 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| DATABASE GenBank [o] 1 September 2011 (2011-09-01), "Polyketide Synthase [Streptomyces sp. SN-593", XP055579529, Database accession no. BAK64637.1 * |
| DATABASE GenBank [o] 24 July 2016 (2016-07-24), "Antibody Variable Domain, Partial [Oryctolagus Cuniculus", XP055579531, Database accession no. AAO06456.1 * |
| DE MOTA, NEUROENDOCRINOLOGY, vol. 72, no. 6, 2000, pages 400 - 7 |
| GUO ET AL., J CELL MOL MED., vol. 19, no. 9, 2015, pages 2273 - 85 |
| HABATA ET AL., BIOCHIM BIOPHYS ACTA, vol. 1452, no. 1, 1999, pages 25 - 35 |
| HENIKOFFHENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915 |
| ITURRIOZ ET AL., J BIOL CHEM., vol. 285, no. 42, 2010, pages 32627 - 37 |
| KALIN ET AL., DEV BIOL., vol. 305, no. 2, 2007, pages 599 - 614 |
| KARLINALTSCHUL, PROC. NAT'1. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5787 |
| KASAI ET AL., ARTERIOSCLER THROMB VASC BIOL., vol. 28, no. 10, 2008, pages 1717 - 22 |
| KASAI ET AL., ARTERIOSCLER THROMB VASC BIOL., vol. 30, no. 11, 2010, pages 2182 - 7 |
| KASAI ET AL., BIOCHEM BIOPHYS RES COMMUN, vol. 325, no. 2, 2004, pages 395 - 400 |
| KIDOYA ET AL., EMBO J., vol. 27, no. 3, 2008, pages 522 - 34 |
| LEE ET AL., J. NEUROCHEM., vol. 74, no. 1, 2000, pages 34 - 41 |
| LI ET AL., FRONT BIOSCI., vol. 13, 2008, pages 3786 - 92 |
| LIU ET AL., BIOCHEM BIOPHYS RES COMMUN., vol. 468, no. 4, 2015, pages 617 - 21 |
| LIU ET AL., CELL DEATH DIS., vol. 8, no. 8, 2017, pages e3006 |
| MASRI ET AL., BIOCHEM BIOPHYS RES COMMUN., vol. 290, no. 1, 2002, pages 539 - 45 |
| MASRI ET AL., FASEB J., vol. 18, no. 15, 2004, pages 1909 - 11 |
| MEDHURST ET AL., J NEUROCHEM., vol. 84, no. 5, 2003, pages 1162 - 72 |
| MELGAR-LESMES ET AL., ENDOCRINOLOGY, vol. 151, no. 11, 2010, pages 5306 - 14 |
| MESMIN ET AL., J PROTEOME RES., vol. 10, no. 11, 2011, pages 5222 - 31 |
| MUTO ET AL., ANTICANCER RES., vol. 34, no. 10, 2014, pages 5313 - 20 |
| NEEDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| O'CARROLL ET AL., J ENDOCRINOL, vol. 219, no. 1, 2013, pages R13 - 35 |
| O'CARROLL ET AL., J ENDOCRINOL., vol. 219, no. 1, 2013, pages R13 - 35 |
| PEARSONLIPMAN: "Proc. Nat'1. Acad. Sci. USA", vol. 85, 1988, pages: 2444 |
| PICAULT ET AL., EUR J CANCER., vol. 50, no. 3, 2014, pages 663 - 74 |
| PRINCIPE ET AL., HEPATOLOGY, vol. 48, no. 4, 2008, pages 1193 - 201 |
| SAINT-GENIEZ ET AL., MECH DEV., vol. 110, no. 1-2, 2002, pages 183 - 6 |
| See also references of EP3672987A4 |
| SHIN ET AL., BIOCHIM BIOPHYS ACTA, vol. 1861, no. 8, 2017, pages 1901 - 12 |
| SMITHWATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
| SORLI ET AL., DRUG DISCOV TODAY, vol. 11, no. 23-24, 2006, pages 1100 - 6 |
| SORLI ET AL., ONCOGENE, vol. 26, no. 55, 2007, pages 7692 - 9 |
| TAO ET AL., INVEST OPHTHALMOL VIS SCI., vol. 51, no. 8, 2010, pages 4237 - 42 |
| TATEMOTO ET AL., BIOCHEM BIOPHYS RES. COMMUN, vol. 251, no. 2, 1998, pages 471 - 6 |
| YOKOMORI ET AL., J GASTROENTEROL., vol. 46, no. 2, 2011, pages 222 - 31 |
| ZUURBIER, ONCOTARGET, vol. 8, no. 26, 2017, pages 42949 - 42961 |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20210163614A1 (en) * | 2018-06-13 | 2021-06-03 | Gmax Biopharm Llc | Apj antibody, fusion protein thereof with elabela, and pharmaceutical compositions and use thereof |
| US12221488B2 (en) * | 2018-06-13 | 2025-02-11 | Gmax Biopharm Llc | APJ antibody, fusion protein thereof with Elabela, and pharmaceutical compositions and use thereofus01 |
| WO2020257460A3 (en) * | 2019-06-19 | 2021-02-25 | Ab Initio Biotherapeutics, Inc. | Apj modulators and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| CN111032689A (zh) | 2020-04-17 |
| BR112020003584A2 (pt) | 2020-09-01 |
| AU2018322452A1 (en) | 2020-03-05 |
| SG11202000899PA (en) | 2020-03-30 |
| MX2020002042A (es) | 2020-08-13 |
| EP3672987B1 (en) | 2025-04-16 |
| US11365242B2 (en) | 2022-06-21 |
| EP3672987C0 (en) | 2025-04-16 |
| CA3072261A1 (en) | 2019-02-28 |
| EP3672987A4 (en) | 2021-08-18 |
| CN111032689B (zh) | 2024-02-27 |
| JP7219265B2 (ja) | 2023-02-07 |
| JP2020536492A (ja) | 2020-12-17 |
| EP3672987A1 (en) | 2020-07-01 |
| US20200362021A1 (en) | 2020-11-19 |
| IL272476A (en) | 2020-03-31 |
| KR20200038311A (ko) | 2020-04-10 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11365242B2 (en) | Anti-apelin antibodies and uses thereof | |
| AU2019232762B2 (en) | Anti-claudin 18.2 antibodies and uses thereof | |
| AU2018312222B2 (en) | Anti-CD47 antibodies and uses thereof | |
| US12325745B2 (en) | Anti-DLL3 antibodies and uses thereof | |
| US11214615B2 (en) | Anti-TIM-3 antibodies and uses thereof | |
| US11390679B2 (en) | Anti-LAG-3 antibodies and uses thereof | |
| AU2019236091B2 (en) | Anti-folate receptor 1 antibodies and uses thereof | |
| EP3762028A1 (en) | Anti-tip-1 antibodies and uses thereof | |
| HK40019122A (en) | Anti-apelin antibodies and uses thereof | |
| HK40019122B (zh) | 抗爱帕琳肽抗体及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18848958 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3072261 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2020511350 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112020003584 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2018322452 Country of ref document: AU Date of ref document: 20180821 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20207008305 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018848958 Country of ref document: EP Effective date: 20200324 |
|
| ENP | Entry into the national phase |
Ref document number: 112020003584 Country of ref document: BR Kind code of ref document: A2 Effective date: 20200220 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2018848958 Country of ref document: EP |