WO2019035066A1 - MODIFIED MHRNA VACCINES ENCODING HERPES SIMPLEX VIRUS GLYCOPROTEINS AND USES THEREOF - Google Patents

MODIFIED MHRNA VACCINES ENCODING HERPES SIMPLEX VIRUS GLYCOPROTEINS AND USES THEREOF Download PDF

Info

Publication number
WO2019035066A1
WO2019035066A1 PCT/IB2018/056210 IB2018056210W WO2019035066A1 WO 2019035066 A1 WO2019035066 A1 WO 2019035066A1 IB 2018056210 W IB2018056210 W IB 2018056210W WO 2019035066 A1 WO2019035066 A1 WO 2019035066A1
Authority
WO
WIPO (PCT)
Prior art keywords
hsv
another embodiment
composition
present
mrna
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2018/056210
Other languages
English (en)
French (fr)
Inventor
Harvey Friedman
Drew Weissman
Sita Awasthi
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Pennsylvania Penn
Original Assignee
University of Pennsylvania Penn
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US16/640,008 priority Critical patent/US11141478B2/en
Priority to EP18846061.2A priority patent/EP3668520A4/en
Priority to CN201880068068.XA priority patent/CN111246854A/zh
Priority to CN202410526392.9A priority patent/CN118370812A/zh
Priority to AU2018316811A priority patent/AU2018316811B2/en
Priority to CA3073161A priority patent/CA3073161A1/en
Priority to JP2020509054A priority patent/JP7386535B2/ja
Priority to EP23169155.1A priority patent/EP4242223A3/en
Application filed by University of Pennsylvania Penn filed Critical University of Pennsylvania Penn
Publication of WO2019035066A1 publication Critical patent/WO2019035066A1/en
Anticipated expiration legal-status Critical
Priority to US17/349,929 priority patent/US11793872B2/en
Priority to US18/365,166 priority patent/US20240016922A1/en
Priority to JP2023138084A priority patent/JP7674760B2/ja
Priority to US18/470,325 priority patent/US20240024463A1/en
Priority to AU2023248194A priority patent/AU2023248194A1/en
Priority to JP2025069088A priority patent/JP2025108645A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • A61K39/245Herpetoviridae, e.g. herpes simplex virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/7115Nucleic acids or oligonucleotides having modified bases, i.e. other than adenine, guanine, cytosine, uracil or thymine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0034Urogenital system, e.g. vagina, uterus, cervix, penis, scrotum, urethra, bladder; Personal lubricants
    • A61K9/0036Devices retained in the vagina or cervix for a prolonged period, e.g. intravaginal rings, medicated tampons, medicated diaphragms
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/20Antivirals for DNA viruses
    • A61P31/22Antivirals for DNA viruses for herpes viruses
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N7/00Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/57Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
    • A61K2039/575Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/70Multivalent vaccine
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16611Simplexvirus, e.g. human herpesvirus 1, 2
    • C12N2710/16622New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011Details
    • C12N2710/16011Herpesviridae
    • C12N2710/16611Simplexvirus, e.g. human herpesvirus 1, 2
    • C12N2710/16634Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • the present invention provides compositions for the prevention and treatment of genital herpes, comprising nucleoside modified mRNAs that encode herpes simplex virus (HSV) glycoproteins, including those involved in virus entry and immune evasion, and methods of use thereof.
  • HSV herpes simplex virus
  • a genital herpes vaccine is urgently needed to prevent pain and suffering, reduce the incidence of neonatal herpes, and decrease the risk of HIV acquisition and transmission that accompanies genital infection.
  • HSV-2 herpes simplex virus type 2
  • HSV-2 herpes simplex virus type 2
  • infection results in painful, recurrent genital ulcers, while in others, the infection remains quiescent.
  • infected individuals may transmit virus to their intimate partners.
  • Genital herpes increases the risk that an infected person will acquire HIV if exposed during sexual intercourse.
  • a vaccine for genital herpes is urgently needed, yet none is available.
  • Chiron Corp. evaluated a prophylactic vaccine containing two HSV-2 glycoproteins involved in virus entry, glycoproteins B (gB2) and D (gD2) given with MF59 as adjuvant.
  • the vaccine did not protect seronegative partners from HSV-2 infection, although it delayed onset of infection over the first 5 months after immunization.
  • GlaxoSmithKline (GSK) assessed a prophylactic vaccine using gD2 antigen with monophosphoryl lipid A (MPL) and alum as adjuvants. Overall, no protection against genital lesions was detected, although significant protection was noted in a subgroup of HSV- 1 and HSV-2 doubly seronegative women.
  • HSV-1 and HSV-2 gC are immune evasion molecules that function as regulators of the complement cascade. During complement activation, C3, the most abundant complement protein, is cleaved to C3b, which activates the membrane attack complex leading to virus neutralization and lysis of infected cells. C3b stimulates B- and T-cell responses and serves as a link between innate and acquired immunity. HSV-1 and HSV-2 gC bind C3b to inhibit activities mediated by C3b. Immunization with gCl and gC2 produces antibodies that bind to the glycoprotein and block its immune evasion functions.
  • HSV-1 and HSV-2 glycoprotein E function as immune evasion molecules by binding the Fc domain of an IgG molecule that is bound by its F(ab')2 domain to its target.
  • a vaccine containing gE2 subunit antigen produces antibodies that bind to gE2 and block its immune evasion functions.
  • HSV-2 gC2 and gE2 perform activities similar to mammalian complement and IgG Fc regulatory proteins, yet share no sequence homology with mammalian receptors, which suggests virtually no risk that immunization will induce autoimmunity.
  • nucleic acid vaccines can induce both humoral and cellular immune responses; have low effective dosages; are simple to manipulate; avail rapid testing; are cost-effective and reproducible in large scale production and isolation; can be produced at high frequency and are easily isolated; are more temperature-stable than conventional vaccines; have a long shelf-life; are easy to store and transport; and are unlikely to require a cold chain (Shedlock & Weiner, Leukocyte Biol. Vol 68, 2000).
  • DNA has been used in vaccines with success. DNA is fairly stable and unreactive and can be stored long term. However, DNA is self-replicating and can be easily damaged by ultra-violet radiation. DNA based vaccines may also raise safety concerns due to possible insertion of DNA into the genome, possible interruption of genes and formation of anti-DNA antibodies.
  • RNA vaccines exhibit important safety features. RNA is more reactive than DNA and less stable but is resistant to ultra-violet radiation. mRNA does not integrate into the host chromosomes. The delivery of mRNA results in faster expression of the antigen of interest and requires fewer copies for expression. mRNA expression is transient, which adds to its safety.
  • mRNA is more effective than DNA for protein production in post mitotic and non-dividing cells because DNA requires translocation through the nuclear member and plasma membrane, while mRNA requires translocation only through the plasma membrane.
  • mRNA is not only a template for translation, but also acts as a ligand for toll-like receptors and is nuclease sensitive; therefore it presents less concern for horizontal transmission.
  • RNA vaccines elegantly integrate adjuvanticity and antigen expression, thereby mimicking relevant aspects of viral infections. This increases their efficacy compared to inactivated vaccines that require the use of adjuvants, simplifying handling and production.
  • RNA can address a range of dedicated immunologic pattern recognition receptors, including toll-like receptors 3, 7, and 8, RIG-I, MDA5, PKR, and others that may act synergistically and serve to enhance the induction of antigen-specific adaptive B and T cell responses.
  • mRNA vaccines directly introduce antigen into cellular antigen processing and presentation pathways, granting access to MHC molecules and triggering T cell responses, irrespective of the hosts MHC haplotype.
  • the present invention provides compositions comprising one or more nucleoside modified mRNAs, wherein each of said nucleoside modified mRNAs encodes a Herpes Simplex Virus (HSV) glycoprotein or immunogenic fragment thereof, and wherein said nucleoside modified mRNA comprises one or more pseudouridine residues.
  • HSV Herpes Simplex Virus
  • the present invention provides compositions comprising one or more nucleoside modified mRNAs, wherein each of said modified mRNAs encodes a Herpes Simplex Virus (HSV) glycoprotein or immunogenic fragment thereof, and wherein said nucleoside modified mRNA comprises 1-methylpseudouridine, wherein said pseudouridine residues comprise m'acp 3 *!' (l-methyl-3-(3-amino-5-carboxyl)pseudouridine, m l P (1- methylpseudouridine), fm (2'-0-methylpseudouridine, m 5 D (5-methyldihydrouridine), m 3 ⁇ (3- methylpseudouridine), or any combination thereof.
  • HSV Herpes Simplex Virus
  • the present invention provides compositions comprising modified mRNAs comprising one or more pseudouridine residues, wherein each of said modified mRNAs encode an a) HSV glycoprotein D (gD) or an immunogenic fragment thereof, b) HSV glycoprotein C (gC) or an immunogenic fragment thereof, c) HSV glycoprotein E (gE) or an immunogenic fragment thereof, or any combination thereof.
  • each of said modified mRNAs encode an a) HSV glycoprotein D (gD) or an immunogenic fragment thereof, b) HSV glycoprotein C (gC) or an immunogenic fragment thereof, c) HSV glycoprotein E (gE) or an immunogenic fragment thereof, or any combination thereof.
  • the present invention provides a method of treating a Herpes Simplex Virus (HSV) infection in a subject, the method comprising the step of administering to said subject a composition comprising one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV glycoprotein or immunogenic fragment thereof, and wherein said modified mRNA comprises pseudouridine residues.
  • HSV Herpes Simplex Virus
  • the present invention provides a method of inducing an immune response in a subject, comprising the step of administering to said subject a composition comprising one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV glycoprotein or immunogenic fragment thereof, and wherein said modified mRNA comprises pseudouridine residues.
  • the present invention provides a method of suppressing, inhibiting, or reducing the incidence of a Herpes Simplex Virus (HSV) infection in a subject, the method comprising the step of administering to said subject a composition comprising one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV glycoprotein or immunogenic fragment thereof, and wherein said modified mRNA comprises pseudouridine residues.
  • HSV Herpes Simplex Virus
  • the present invention provides a method of treating a Herpes Simplex Virus (HSV) infection in a subject, the method comprising the step of administering to said subject a composition comprising one or more modified mRNAs encoding a) an HSV glycoprotein D (gD) or an immunogenic fragment thereof, b) an HSV glycoprotein C (gC) or an immunogenic fragment thereof, c) an HSV glycoprotein E (gE) or an immunogenic fragment thereof, or any combination thereof.
  • HSV Herpes Simplex Virus
  • the present invention provides a method of suppressing, inhibiting, or reducing the incidence of a Herpes Simplex Virus (HSV) infection in a subject, the method comprising the step of administering to said subject a composition comprising one to three modified mRNAs, wherein each of said modified mRNAs encodes a) HSV glycoprotein D (gD) or an immunogenic fragment thereof, b) HSV glycoprotein C (gC) or an immunogenic fragment thereof, and c) HSV glycoprotein E (gE) or an immunogenic fragment thereof, or any combination thereof.
  • HSV Herpes Simplex Virus
  • Figures 1A-1C Characterization of the translational product of the ectodomain of gC2-, gD2- and gE2-modified mRNA in Vero cells.
  • Figure 1A Western blot showing expression of gC2 by modified mRNA.
  • Figure IB Western blot showing expression of gD2 by modified mRNA.
  • FIG. 1C Western blot showing expression of gE2 by modified mRNA.
  • Figure 2A gC2 antibody (Ab) response as determined by antigen-specific ELISA in mice immunized with gD2 mRNA; or gC2 mRNA, gD2 mRNA and gE2 mRNA each given at a different intradermal site (Trivalent-I); or gC2 mRNA, gD2 mRNA and gE2 mRNA given in combination (Trivalent-C). I indicates first immunization; II indicates second immunization.
  • FIG. 2B gD2 Ab response as determined by antigen-specific ELISA in mice immunized with gD2 mRNA; or gC2 mRNA, gD2 mRNA and gE2 mRNA each given at a different intradermal site (Trivalent-I); or gC2 mRNA, gD2 mRNA and gE2 mRNA given in combination (Trivalent-C).
  • I indicates first immunization; II indicates second immunization.
  • FIG. 2C gE2 Ab response as determined by antigen-specific ELISA in mice immunized with gD2 mRNA; or gC2 mRNA, gD2 mRNA and gE2 mRNA each given at a different intradermal site (Trivalent-I); or gC2 mRNA, gD2 mRNA and gE2 mRNA given in combination (Trivalent-C).
  • I indicates first immunization; II indicates second immunization.
  • FIG. 3A Antigen-specific IgGl responses in mRNA vaccinated mice. Antibodies were evaluated after the first and second immunization for IgGl responses. I indicates first immunization; II indicates second immunization.
  • FIG. 3B Antigen-specific IgG2a responses in mRNA vaccinated mice. Antibodies were evaluated after the first and second immunization for IgG2a responses. I indicates first immunization; II indicates second immunization.
  • FIG. 4 Neutralizing antibody titers in mRNA vaccinated mice. 50% endpoint neutralization titers of serum were obtained after the second immunization. Titers were performed using 10% human complement. Trivalent-I animals were immunized with gC2/liposomal nanoparticle (LNP), gD2/LNP, and gE2/LNP, each given at a different site. Trivalent-C animals were immunized with gC2, gD2 and gE2 combined into a single LNP.
  • LNP gC2/liposomal nanoparticle
  • FIG. 5 CD4 + T cell responses to gC2, gD2 and gE2 mRNA each administered at a different intradermal site.
  • Splenocytes were stimulated with subunit antigen glycoproteins (Figure 5A) or 15 amino acid peptides with 11 overlapping amino acids to stimulate HSV-2 specific T cell responses (Figure 5B).
  • Figure 5A subunit antigen glycoproteins
  • Figure 5B 15 amino acid peptides with 11 overlapping amino acids to stimulate HSV-2 specific T cell responses
  • * indicates p ⁇ 0.05 (t test) comparing gC, gD or gE with PBS stimulated CD4 + T cells or DMSO stimulated CD4 + T cells. Error bars represent SD.
  • FIG. 6 CD8 + T cell responses to gC2, gD2 and gE2 mRNA, each administered at a different intradermal site.
  • Splenocytes were stimulated with subunit antigen glycoproteins (Figure 6A) or 15 amino acid peptides with 11 overlapping amino acids to stimulate HSV-2 specific T cell responses (Figure B).
  • Figure 6A subunit antigen glycoproteins
  • Figure B 15 amino acid peptides with 11 overlapping amino acids to stimulate HSV-2 specific T cell responses
  • * indicates p ⁇ 0.05 comparing gE pool 2 with DMSO control. Error bars represent SD.
  • FIG. 7A Survival in BALB/c mice immunized with mRNA twice at 28 day intervals and challenged intravaginally with HSV-2.
  • Trivalent-I represents animals immunized with gC2/LNP, gD2/LNP, and gE2/LNP each given at different intradermal sites.
  • Trivalent-C represents animals immunized with gC2, gD2 and gE2 combined into a single LNP for immunization.
  • FIG. 7B Weight loss (-) or gain (+) and neurological signs in BALB/c mice immunized with mRNA twice at 28 day intervals and challenged intravaginally with HSV-2.
  • Trivalent-I represents animals immunized with gC2/LNP, gD2/LNP, and gE2/LNP each given at different intradermal sites.
  • Trivalent-C represents animals immunized with gC2, gD2 and gE2 combined into a single LNP for immunization.
  • FIGs 8A-8B Vaginal viral titers in mRNA vaccinated mice after intravaginal challenge with HSV-2. Vaginal swab titers were obtained on Day 2 ( Figure 8A) and Day 4 ( Figure B) post-challenge. The dotted lines indicate the limit of detection of the assay at 7 PFU/ml.
  • Figure 9 Genital disease in mRNA-vaccinated mice after HSV-2 vaginal challenge.
  • mice were immunized with poly C as a control, or with gD2 mRNA/LNP, trivalent at individual sites for each glycoprotein mRNA (Trivalent-I) or trivalent with all three mRNAs combined (Trivalent-C). Genital disease was scored for 28 days. All animals in the poly C group died by day 10. ***, indicates p ⁇ 0.001 comparing poly C with the other 3 groups.
  • FIG. 10 HSV-2 DNA copies in dorsal root ganglia (DRG) in mRNA vaccinated mice on day 4 post challenge. HSV-2 DNA in DRG was measured by qPCR. DRG from 4 to 5 animals per group were evaluated for HSV-2 DNA at 4 days post challenge. The bars represent the mean values per group.
  • Figure 11 A The trivalent mRNA-LNP vaccine induces a potent T follicular helper cell response in mice. BALB/c female mice were left un-immunized as naive control animals or immunized intradermally twice at 28 day intervals with poly C mRNA-LNP or trivalent modified mRNA-LNP.
  • the poly C mRNA controls received l( ⁇ g Poly C mRNA-LNP divided into 4 aliquots and administered at 4 separate sites.
  • the trivalent modified mRNA group received 10 ⁇ g gC2 mRNA-LNP, 10ug gD2 mRNA-LNP, and ⁇ g gE2 mRNA-LNP each divided into 2 aliquots and each given at 2 sites.
  • FIG 11B The trivalent mRNA-LNP vaccine induces a potent germinal center B cell response in mice.
  • BALB/c female mice were left un-immunized as naive control animals or immunized intradermally twice at 28 day intervals with poly C mRNA-LNP or trivalent modified mRNA-LNP.
  • the poly C mRNA controls received l( ⁇ g Poly C mRNA-LNP divided into 4 aliquots and administered at 4 separate sites.
  • the trivalent modified mRNA group received 10 ⁇ g gC2 mRNA-LNP, 10ug gD2 mRNA-LNP, and ⁇ g gE2 mRNA-LNP each divided into 2 aliquots and each given at 2 sites. Two weeks after the second immunization, spleens were harvested from 5 animals per group and flow cytometry performed to detect germinal center B cell responses (*p ⁇ 0.05).
  • FIGS 12A-C Genital mucosa IgG antibody responses.
  • BALB/c mice were immunized intradermally twice at 28 day intervals with 10 ⁇ g of ploy C mRNA-LNP, 10 ⁇ g gD2 mRNA-LNP or ⁇ each of gC2, gD2, gE trivalent modified mRNA-LNP.
  • the trivalent mRNA was combined and administered as 10 ⁇ g gC2 mRNA & 10 ⁇ g gD2 mRNA & 10 ⁇ g gE2 mRNA combined into LNP and divided into 4 aliquots and given at 4 sites.
  • 60 ⁇ 1 of media was introduced in the vaginal cavity and retrieved.
  • the trivalent mRNA-LNP vaccine produces antibodies that block gC2 binding to complement component C3b.
  • BALB/c mice were left unimmunized as a source of non-immune IgG, or immunized intradermally with poly C mRNA-LNP or trivalent mRNA-LNP.
  • the poly C rnRNA controls received l( ⁇ g poly C mRNA-LNP divided into 4 aliquots and administered at 4 separate sites.
  • the gD2 rnRNA group received l( ⁇ g gD2 mRNA-LNP administered as described for the poly C mRNA-LNP.
  • the trivalent modified rnRNA group received 10ug gC2 mRNA-LNP, l( ⁇ g gD2 mRNA-LNP, and 10ug gE2 mRNA-LNP combined into LNP and divided into 4 aliquots and given at 4 sites. There were 10 mice in each group. Sera from the 10 mice were pooled and IgG was purified. The IgG was evaluated at 12 ⁇ g/200 ⁇ l for its ability to block complement component C3b binding to gC2. (****p ⁇ 0.0001).
  • FIGS 14A-14F The trivalent mRNA vaccine provides outstanding protection in mice when the vaccine is administered intramuscularly.
  • BALB/c mice were immunized intramuscularly with poly C mRNA-LNP as a control (15/group) or with trivalent mRNA containing 10 ⁇ g each of gC2, gD2 and gE2 mRNA-LNP (20/group).
  • Figure 14A presents data on mouse survival;
  • Figure 14B presents data on weight loss;
  • Figure 14C presents data on genital disease.
  • DRG were harvested from nine poly C animals at the time of euthanasia between days 7 and 12 post-infection or at the end of the experiment on day 28 in the trivalent mRNA group.
  • Figure 14D presents data on HSV-2 DNA in DRG.
  • Figure 14E presents data on vaginal viral cultures on Day 2 and
  • Figure 14F presents data on vaginal viral cultures on Day 4. Difference between poly C and trivalent groups are significant, p ⁇ 0.001 for Figures 14A-14F
  • FIGS 15A-15C The trivalent mRNA vaccine is highly efficacious in the guinea pig genital infection model.
  • animals in the poly C and trivalent mRNA groups were infected intravaginally with 5xl0 5 PFU of HSV-2 strain MS (50 LD50).
  • Figure 15A presents data on survival;
  • Figure 15B provides data on vaginal disease (acute phase); and
  • Figure 15C provides data on vaginal disease (recurrent phase).
  • the present invention provides compositions comprising one or more modified mRNAs, wherein each of said modified mRNAs encodes a Herpes Simplex Virus (HSV) glycoprotein or immunogenic fragment thereof.
  • HSV Herpes Simplex Virus
  • the present invention provides a composition comprising one or more nucleoside modified mRNAs, wherein each of said modified mRNAs encodes a Herpes Simplex Virus (HSV) glycoprotein or immunogenic fragment thereof, and wherein said modified mRNA comprises one or more pseudouridine or pseudouridine family residues.
  • HSV Herpes Simplex Virus
  • the HSV glycoprotein comprises glycoprotein D (gD), glycoprotein C (gC), glycoprotein E (gE), glycoprotein B (gB), glycoprotein H (gH), glycoprotein L (gL) glycoprotein I (gl), or a combination thereof.
  • the present invention provides a composition comprising one or more modified mRNAs encoding HSV gD, gC, gE, gB, gH, gL, gl, or immunogenic fragments thereof.
  • the modified mRNAs comprise pseudouridine-modified mRNAs.
  • the present invention provides compositions comprising a modified mRNA encoding HSV gD or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV gC or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV gE or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV gB or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV gH or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV gL or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV gl or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HSV gD or fragment thereof; and (b) a modified mRNA encoding HSV gC or fragment thereof. [0051] In another embodiment, the present invention provides a composition comprising: (a) a modified mRNA encoding HSV gD or fragment thereof; and (b) a modified mRNA encoding HSV gE or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HSV gC or fragment thereof; and (b) a modified mRNA encoding HSV gE or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HSV gD or fragment thereof; (b) a modified mRNA encoding HSV gC or fragment thereof, and (c) a modified mRNA encoding HSV gE or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HSV gD or fragment thereof; (b) a modified mRNA encoding HSV gC or fragment thereof, (c) a modified mRNA encoding HSV gE or fragment thereof; and (d) a modified mRNA encoding HSV gB or fragment thereof.
  • the HSV glycoproteins are HSV-2 glycoproteins. In another embodiment, the HSV glycoproteins are HSV-1 glycoproteins. In one embodiment, the HSV glycoproteins comprise both HSV-2 glycoproteins and HSV-1 glycoproteins. In another embodiment, the HSV glycoproteins comprise a mixture of HSV-2 glycoproteins and HSV-1 glycoproteins.
  • the present invention provides compositions comprising a modified mRNA encoding HSV-2 gD or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV-2 gC or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV-2 gE or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV-2 gE or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV-2 gB or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV-2 gH or fragment thereof.
  • the present invention provides compositions comprising a modified mRNA encoding HSV-2 gL or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV-2 gl or fragment thereof. [0057] In one embodiment, the present invention provides a composition comprising: (a) a modified mRNA encoding HSV-2 gD or fragment thereof; and (b) a modified mRNA encoding HSV-2 gC or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HSV-2 gD or fragment thereof; and (b) a modified mRNA encoding HSV-2 gE or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HSV-2 gC or fragment thereof; and (b) a modified mRNA encoding HSV-2 gE or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HSV-2 gD or fragment thereof; (b) a modified mRNA encoding HSV- 2 gC or fragment thereof, and (c) a modified mRNA encoding HSV-2 gE or fragment thereof.
  • the present invention provides compositions comprising a modified mRNA encoding HSV-1 gD or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV-1 gC or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HS V- 1 gE or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HS V- 1 gE or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV-1 gB or fragment thereof.
  • the present invention provides compositions comprising a modified mRNA encoding HS V- 1 gH or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HSV-1 gL or fragment thereof. In another embodiment, the present invention provides compositions comprising a modified mRNA encoding HS V- 1 gl or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HSV-1 gD or fragment thereof; and (b) a modified mRNA encoding HS V- 1 gC or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HSV-1 gD or fragment thereof; and (b) a modified mRNA encoding HS V- 1 gE or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HSV-1 gC or fragment thereof; and (b) a modified mRNA encoding HS V- 1 gE or fragment thereof.
  • the present invention provides a composition comprising: (a) a modified mRNA encoding HS V- 1 gD or fragment thereof; (b) a modified mRNA encoding HS V- 1 gC or fragment thereof, and (c) a modified mRNA encoding HS V- 1 gE or fragment thereof.
  • any of the compositions as described herein consists essentially of one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV glycoprotein or immunogenic fragment thereof. In another embodiment, any of the compositions as described herein consists of one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV glycoprotein or immunogenic fragment thereof.
  • the present invention provides compositions comprising a modified mRNA encoding an HSV gD protein, a modified mRNA encoding an HSV gC protein, a modified mRNA encoding an HSV gE protein and modified mRNAs encoding one or more additional HSV glycoproteins.
  • said additional HSV glycoproteins comprise gB or immunogenic fragment thereof, gH or immunogenic fragment thereof, gL or immunogenic fragment thereof, gl or immunogenic fragment thereof, or any combination thereof.
  • said additional HSV glycoproteins comprise glycoprotein M (gM), glycoprotein N (gN), glycoprotein K (gK), glycoprotein G (gG), glycoprotein J (gj), or an immunogenic fragment thereof.
  • compositions of the present invention and for use in the methods of the present invention comprise both HSV-2 glycoproteins or glycoprotein fragments and HSV-1 glycoproteins or glycoprotein fragments.
  • compositions of the present invention and for use in the methods of the present invention comprise a mixture of HSV-2 glycoproteins or glycoprotein fragments and HSV- 1 glycoproteins or glycoprotein fragments.
  • a composition of the present invention comprises HSV-2 gC, HSV- 1 gD, and HSV-2 gE, or fragments thereof.
  • a composition of the present invention comprises HSV-1 gC, HSV-2 gD, and HSV-2 gE, or fragments thereof.
  • a composition of the present invention comprises HSV-2 gC, HSV-2 gD, and HSV-
  • a composition of the present invention comprises HSV-1 gC, HSV-1 gD, and HSV-2 gE, or fragments thereof.
  • a composition of the present invention comprises HSV-1 gC, HSV-2 gD, and HSV-1 gE, or fragments thereof.
  • a composition of the present invention comprises HSV-
  • HSV-1 gD HSV-1 gD
  • HSV-1 gE HSV-1 gE
  • compositions of the present invention comprise one or more additional HSV- 1 glycoproteins or HSV-2 glycoproteins or both HSV- 1 and HSV-2 glycoproteins, as described herein.
  • a composition of the present invention comprising HSV-2 gC, HSV-1 gD, and HSV-2 gE may further comprise HSV-1 gl.
  • a composition of the present invention comprising HSV-2 gC, HSV-2 gD, and HSV- 2 gE may further comprise HSV-1 gB.
  • Encoding refers, in one embodiment, to an RNA molecule that contains a gene that encodes the protein of interest.
  • the RNA molecule comprises a protein coding sequence that encodes the protein of interest.
  • one or more other proteins is also encoded.
  • the protein of interest is the only protein encoded.
  • Immunogenic fragment refers, in another embodiment, to a portion of a protein that is immunogenic and elicits a protective immune response when administered to a subject.
  • immunogenicity or “immunogenic” is used herein to refer to the innate ability of a protein, peptide, nucleic acid, antigen or organism to elicit an immune response in an animal when the protein, peptide, nucleic acid, antigen or organism is administered to the animal.
  • enhancing the immunogenicity in one embodiment, refers to increasing the ability of a protein, peptide, nucleic acid, antigen or organism to elicit an immune response in an animal when the protein, peptide, nucleic acid, antigen or organism is administered to an animal.
  • the increased ability of a protein, peptide, nucleic acid, antigen or organism to elicit an immune response can be measured by, in one embodiment, a greater number of antibodies to a protein, peptide, nucleic acid, antigen or organism, a greater diversity of antibodies to an antigen or organism, a greater number of T-cells specific for a protein, peptide, nucleic acid, antigen or organism, a greater cytotoxic or helper T-cell response to a protein, peptide, nucleic acid, antigen or organism, and the like.
  • an immunogenic polypeptide is also antigenic.
  • Antigenic refers, in another embodiment, to a peptide capable of specifically interacting with an antigen recognition molecule of the immune system, e.g. an immunoglobulin (antibody) or T cell antigen receptor.
  • An antigenic peptide contains, in another embodiment, an epitope of at least about 8 amino acids (AA).
  • An antigenic portion of a polypeptide, also called herein the epitope in one embodiment can be that portion that is immunodominant for antibody or T cell receptor recognition, or it can be a portion used to generate an antibody to the molecule by conjugating the antigenic portion to a carrier polypeptide for immunization.
  • a molecule that is antigenic need not be itself immunogenic, i.e., capable of eliciting an immune response without a carrier.
  • "functional" within the meaning of the invention is used herein to refer to the innate ability of a protein, peptide, nucleic acid, fragment or a variant thereof to exhibit a biological activity or function.
  • a biological function is its binding property to an interaction partner, e.g., a membrane-associated receptor, and in another embodiment, its trimerization property.
  • these biological functions may in fact be changed, e.g., with respect to their specificity or selectivity, but with retention of the basic biological function.
  • fragment is used herein to refer to a protein or polypeptide that is shorter or comprises fewer amino acids than the full length protein or polypeptide.
  • fragment refers to a nucleic acid encoding the protein fragment that is shorter or comprises fewer nucleotides than the full length nucleic acid.
  • the fragment is an N-terminal fragment.
  • the fragment is a C-terminal fragment.
  • the fragment is an intrasequential section of the protein, peptide, or nucleic acid.
  • the fragment is an immunogenic intrasequential section of the protein, peptide or nucleic acid.
  • the fragment is a functional intrasequential section within the protein, peptide or nucleic acid.
  • the fragment is an N-terminal immunogenic fragment.
  • the fragment is a C-terminal immunogenic fragment.
  • the fragment is an N-terminal functional fragment.
  • the fragment is a C-terminal functional fragment.
  • the fragment contains pieces of the protein linked together or pieces of multiple proteins linked together.
  • an "immunogenic fragment" of a protein as described in the present invention refers to a portion of the protein that is immunogenic, in one embodiment and in another embodiment, elicits a protective immune response when administered to a subject.
  • compositions comprising modified mRNAs, wherein each of said modified mRNAs encodes a) HSV glycoprotein D (gD) or an immunogenic fragment thereof, b) HSV glycoprotein C (gC) or an immunogenic fragment thereof, c) HSV glycoprotein E (gE) or an immunogenic fragment thereof, or any combination thereof.
  • the present invention provides a composition comprising a modified mRNA encoding an HSV gD or an immunogenic fragment thereof, a modified mRNA encoding an HSV gC or an immunogenic fragment thereof, and a modified mRNA encoding an HSV gE or an immunogenic fragment thereof.
  • compositions of modified mRNA encoding gD-1 are protective against HSV-1 infection. Further, combination compositions of modified mRNA encoding gC- 1/gD-l/gE-l confer superior protection compared with compositions containing modified mRNA encoding gC-1 alone, gD-1 alone, or gE-1 alone. Further, as provided herein, compositions of modified mRNA encoding gD-2 are protective against HSV-2 infection ( Figures 7-10). Further, combination compositions of modified mRNA encoding gC-2/gD-2/gE-2 confer superior protection compared with compositions containing modified mRNA encoding gC-2 alone, gD-2 alone, or gE-2 alone.
  • inclusion of a modified mRNA encoding gC, and/or a modified mRNA encoding gE in the composition of the present invention increases the efficaciousness of anti-gD antibodies elicited by the composition.
  • inclusion of a modified mRNA encoding gC, and/or a modified mRNA encoding gE in the composition of the present invention increases the dose of modified mRNA encoding gD required to elicit antibodies that inhibit binding of gD to a cellular receptor.
  • inclusion of a modified mRNA encoding gC, and/or a modified mRNA encoding gE in the composition of the present invention decreases the dose of modified mRNA encoding gD required to elicit antibodies that inhibit binding of gD to a cellular receptor when a dose of modified mRNA encoding a gD is administered separately from modified mRNAs encoding the gC protein or gE protein.
  • inclusion of a modified mRNA encoding gC, and/or a modified mRNA encoding gE in the composition of the present invention enhances the effectiveness of an innate immune response.
  • the innate immune response is an antibody- mediated immune response.
  • the innate immune response is a non- antibody-mediated immune response.
  • the innate immune response is an NK (natural killer) cell response.
  • the innate immune response is any other innate immune response known in the art.
  • inclusion of a modified mRNA encoding gC, and/or a modified mRNA encoding gE in the composition of the present invention increases the efficaciousness of antibodies elicited by the composition against one of the above glycoproteins.
  • inclusion of a modified mRNA encoding gC, and/or a modified mRNA encoding gE in the composition of the present invention decreases the dose of one of the above glycoproteins required to elicit antibodies that inhibit binding of the glycoprotein to a cellular receptor thereof, when a dose of one of the glycoproteins is administered separately from one of the other glycoproteins.
  • a composition of the present invention comprises a modified mRNA encoding HSV-1 gD protein. In another embodiment, the composition comprises a modified mRNA encoding a fragment of an HSV-1 gD protein.
  • the nucleotide sequence of the modified mRNA encoding an HSV-1 gD fragment comprises:
  • underlined residues represent 5' untranslated sequences.
  • bold residues represent a signal sequence (leader sequence) to assist expression of the gDl fragment.
  • italicized residues represent 3' untranslated sequences and poly adenylation tail.
  • the nucleotide sequence of the modified mRNA encoding an HSV- 1 gD fragment lacks the 5' untranslated sequences, the signal sequence, the 3' untranslated sequences, the poly adenylation tail, or a combination thereof.
  • the HSV-1 gD fragment encoded by modified mRNA utilized in the methods and compositions of the present invention comprises amino acids 26-331 of gD from HSV-1 Patton strain, as set forth in the following amino acid sequence: KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITV YYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVME YTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKIN DWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRT VAVYSLKIAGWHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAP QIPPNWHIPSIQDAATPY (SEQ ID NO: 2)
  • the full length HSV-1 gD encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the following amino acid sequence:
  • the HSV-1 gD encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the amino acid sequences as set forth in any one of the following GenBank Accession Numbers: AAL90884.1 (KHS2 strain), AAL90883.1 (KHS1 strain), AAK93950.1 (F strain), AAB59754.1 (F strain), AAA19631.1 (mutant strain not identified), AAA19630.1 (mutant strain not identified), or AAA19629.1 (strain not identified).
  • the HSV-1 gD encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the amino acid sequences as set forth in any of the following GenBank Accession Numbers: A1Z0Q5.2, AAA45780.1 AAA45785.1, AAA45786.1, AAA96682.1, AAK19597.1, AAN74642.1, ABI63524.1 ABM52978.1, ABM52979.1, ABM52980.1, ABM52981.1, ABM66847.1, ABM66848.1 ACM62295.1, ADD60053.1, ADD60130.1, ADM22389.1, ADM22466.1, ADM22542.1 ADM22619.1, ADM22696.1, ADM22773.1, ADM22849.1, ADM22926.1, ADM23003.1 ADM23079.1, ADM23155.1, ADM23231.1, ADM23309.1, ADM23383.1, ADM23457.1 ADM23531.1, ADM23605.1, ADM23680.1,
  • L AR037968.1 AR037969.1 ARO37970.1 AR037971.1 AR037972.1 AR037973.
  • the composition comprises a modified mRNA encoding an HSV- 2 gD protein.
  • the composition comprises a modified mRNA encoding an HSV- 2 gD protein.
  • nucleotide sequence of the modified mRNA encoding an HSV-2 gD fragment comprises:
  • AAAA UGUUGUCCCCCAAAAUCUA GCCA UUCGUA UCUGCUCCUAA UAAAAA GAAA GUUU
  • all uridine residues are 1-methyl-pseudouridine.
  • underlined residues represent 5' untranslated sequences.
  • bold residues represent a signal sequence (leader sequence) to assist expression of the gD2 fragment.
  • italicized residues represent 3' untranslated sequences and poly adenylation tail.
  • the nucleotide sequence of the modified mRNA encoding an HSV- 2 gD fragment lacks the 5' untranslated sequences, the signal sequence, the 3' untranslated sequences, the poly adenylation tail, or a combination thereof.
  • the HSV-2 gD fragment encoded by modified mRNA utilized in the methods and compositions of the present invention comprises amino acids 26-331 of gD from HSV-2 strain 333, as set forth in the following amino acid sequence:
  • the full length HSV-2 gD encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the following amino acid sequence:
  • the HSV-2 gD encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the amino acid sequences as set forth in GenBank Accession Numbers: 1003204A, AAA45841.1, AAA45842.1, AAB60552.1, AAB60553.1, AAB60554.1, AAB60555.1, AAB72102.1, AAS01730.1, AAW23130.1 AAW23131.1, AAW23132.1, AAW23133.1, AAW23134.1, ABS84899.1, ABU45433.1 ABU45434.1, ABU45435.1, ABU45461.1, ABU45462.1, ACA28831.1, AEV91405.1 AFM93876.1, AFS18198.1, AFS18199.1, AFS 18200.1, AFS18201.1, AFS 18202.1, AFS18203.1 AFS 18204.1, AFS 18205.1, AFS 18206.1, AFS 18207.1, AFS 18208.1, AFS 18209.1, AFS18
  • the gD protein or fragment includes Y63. In another embodiment, the gD protein or fragment includes R159. In another embodiment, the gD protein or fragment includes D240. In another embodiment, the gD protein or fragment includes P246. In another embodiment, the gD protein or fragment includes a residue selected from Y63, R159, D240, and P246. In another embodiment, inclusion of one of these residues elicits antibodies that inhibit binding to nectin- 1.
  • Each modified mRNA encoding gD-1 and gD-2 protein or fragment thereof represents a separate embodiment of the present invention.
  • HSV gD, gC, and gE proteins, and fragments thereof, encoded by the modified mRNA as disclosed herein are described in US Patent Publication No. 2013-0028925-A1, which is incorporated by reference herein in its entirety.
  • a gD protein fragment encoded by modified mRNA utilized in the methods and compositions of the present invention is an immunogenic fragment.
  • a gD immunoprotective antigen need not be the entire protein.
  • the protective immune response generally involves, in another embodiment, an antibody response.
  • mutants, sequence conservative variants, and functional conservative variants of gD are useful in methods and compositions of the present invention, provided that all such variants retain the required immuno-protective effect.
  • the immunogenic fragment can comprise an immuno-protective gD antigen from any strain of HSV.
  • the immunogenic fragment can comprise sequence variants of HSV, as found in infected individuals.
  • a composition of the present invention comprises a modified mRNA encoding HSV-1 gC protein.
  • the composition comprises a modified mRNA encoding a fragment of an HSV- 1 gC protein.
  • HSV-1 gC fragment comprises:
  • AAAAAAAAAAC SEQ ID NO: 7
  • all uridine residues are 1-methyl-pseudouridine.
  • underlined residues represent 5' untranslated sequences.
  • bold residues represent a signal sequence (leader sequence) to assist expression of the gCl fragment.
  • italicized residues represent 3' untranslated sequences and poly adenylation tail.
  • the nucleotide sequence of the modified mRNA encoding an HSV- 1 gC fragment does not comprise the 5' untranslated sequences, the signal sequence, the 3' untranslated sequences, the poly adenylation tail, or a combination thereof.
  • the HSV-1 gC fragment encoded by modified mRNA utilized in the methods and compositions of the present invention comprises amino acids 27-457 of gC from HSV-1 KOS strain, as set forth in the following amino acid sequence:
  • the gC fragment encoded by modified mRNA utilized in the methods and compositions of the present invention comprises amino acids 27-457 of gC from an HSV-1 strain.
  • the full length HSV- 1 gC encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the following amino acid sequence:
  • the HSV-1 gC encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the amino acid sequences as set forth in any of the following GenBank Accession Numbers: AAA45779.1, AAA96680.1 ABI63505.1, ABM52973.1, ABM52976.1, ABM52977.1, ACM62267.1, ADD60042.1 ADD60119.1, ADM22367.1, ADM22444.1, ADM22520.1, ADM22597.1 ADM22674.1 ADM22751.1, ADM22827.1, ADM22904.1, ADM22981.1, ADM23057.1 ADM23133.1 ADM23210.1, ADM23287.1, ADM23361.1, ADM23435.1, ADM23509.1 ADM23583.1 ADM23658.1, ADM23733.1, ADM23809.1, AEQ77075.1, AEQ77099.1 , AER37628.1
  • composition comprises a modified mRNA encoding an
  • the composition comprises a modified mRNA encoding a fragment of an HSV-2 gC protein.
  • HSV-2 gC fragment comprises:
  • all uridine residues are 1-methyl-pseudouridine.
  • underlined residues represent 5' untranslated sequences.
  • bold residues represent a signal sequence (leader sequence) to assist expression of the gC2 fragment.
  • italicized residues represent 3' untranslated sequences and poly adenylation tail.
  • the nucleotide sequence of the modified mRNA encoding an HSV-2 gC fragment lacks the 5' untranslated sequences, the signal sequence, the 3' untranslated sequences, the poly adenylation tail, or a combination thereof.
  • the HSV-2 gC fragment encoded by modified mRNA utilized in the methods and compositions of the present invention comprises amino acids 27-426 of gC from HSV-2 strain 333, as set forth in the following amino acid sequence:
  • the full length HSV-2 gC encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the following amino acid sequence:
  • V A V VL AGT A V V YLTH AS S VR YRRLR (SEQ ID NO: 12).
  • the HSV-2 gC encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the amino acid sequences as set forth in any of the following GenBank Accession Numbers: AAA20532.1, AAA66442.1, AAB60549.1, AAB60550.1, AAB60551.1, AAB72101.1, ABU45429.1, ABU45430.1, ABU45431.1, ABU45432.1, ABU45459.1, ABU45460.1, AEV91348.1, AEV91383.1,
  • the gC protein fragment encoded by modified mRNA utilized in the methods and compositions of the present invention comprises a properdin interfering domain
  • Properdin-interfering domain refers, in one embodiment, to a domain that blocks or inhibits binding of a host C3b molecule with a host properdin molecule. In another embodiment, the term refers to a domain that blocks or inhibits an interaction of a host C3b molecule with a host properdin molecule.
  • the gC protein fragment encoded by modified mRNA utilized in the methods and compositions of the present invention is a C5 interfering domain.
  • the gC protein fragment is a portion of a C5 interfering domain.
  • C5-interfering domain refers, in another embodiment, to a domain that interferes with binding of a host C3b molecule with a host C5 molecule.
  • the term refers to a domain that interferes with the interaction of a host C3b molecule with a host C5 molecule.
  • a gC protein fragment encoded by modified mRNA utilized in the methods and compositions of the present invention is an immunogenic fragment.
  • a gC immunoprotective antigen need not be the entire protein.
  • the protective immune response generally involves, in another embodiment, an antibody response.
  • mutants, sequence conservative variants, and functional conservative variants of gC are useful in methods and compositions of the present invention, provided that all such variants retain the required immuno-protective effect.
  • the immunogenic fragment can comprise an immuno-protective gC antigen from any strain of HS V.
  • the immunogenic fragment can comprise sequence variants of HSV, as found in infected individuals.
  • a composition of the present invention comprises a modified mRNA encoding HSV-1 gE protein.
  • the composition comprises a modified mRNA encoding a fragment of an HSV- 1 gE protein.
  • nucleotide sequence of the modified mRNA encoding an HSV- 1 gD fragment comprises:
  • all uridine residues are 1 -methyl-pseudouridine.
  • underlined residues represent 5' untranslated sequences.
  • bold residues represent a signal sequence (leader sequence) to assist expression of the gEl fragment.
  • italicized residues represent 3' untranslated sequences and poly adenylation tail.
  • the nucleotide sequence of the modified mRNA encoding an HSV- 1 gE fragment lacks the 5' untranslated sequences, the signal sequence, the 3' untranslated sequences, the poly adenylation tail, or a combination thereof.
  • the HSV- 1 gE fragment encoded by modified mRNA utilized in the methods and compositions of the present invention comprises amino acids 24-409 of gE from HSV-1 NS strain, as set forth in the following amino acid sequence:
  • VYVNDHIHAWGHITINTAAQYRNAVVEQPLPQRGADLAEPTHPHVGA SEQ ID NO:
  • the gE fragment encoded by modified mRNA utilized in the methods and compositions of the present invention comprises amino acids 24-409 of gE from an HSV-1 strain.
  • the full length HSV-1 gE encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the following amino acid sequence:
  • GFEILSPTAPSVYPRSDGHQSRRQLTTFGSGRPDRRYSQASDSSVFW SEQ ID NO: 15.
  • the HSV-1 gE encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the amino acid sequences as set forth in any of the following GenBank Accession Numbers: AAA45779.1, AAA96680.1 ABI63526.1, ACM62297.1, ADD60055.1, ADD60132.1, ADM22391.1, ADM22468.1 ADM22544.1, ADM22621.1, ADM22698.1, ADM22775.1, ADM22851.1, ADM22928.1 ADM23005.1, ADM23081.1, ADM23157.1, ADM23233.1, ADM23311.1, ADM23385.1 ADM23459.1, ADM23533.1, ADM23607.1, ADM23682.1, ADM23757.1, ADM23833.1 ADN34689.1, ADN34692.1, ADN34695.1, AEQ77099.1, AER37649.1, AER37717.1 AER37788.1, AER37859.1, AER37931.1,
  • AKG60048.1 AKG60120.1, AKG60191.1, AKG60263.1, AKG60336.1, AKG60406.1
  • AMB65664.1 AMB65737.1, AMB65811.1, AMB65887.1, AMB65958.1, AMN09834.1
  • ANN84885.1 ANN84961.1, ANN85038.1, ANN85114.1, ANN85189.1, ANN85266.1
  • the composition comprises a modified mRNA encoding an HSV-2 gE protein. In another embodiment, the composition comprises a modified mRNA encoding a fragment of an HSV-2 gE protein.
  • nucleotide sequence of the modified mRNA encoding an HSV- 2 gE fragment comprises:
  • all uridine residues are 1 -methyl-pseudouridine.
  • underlined residues represent 5' untranslated sequences.
  • bold residues represent a signal sequence (leader sequence) to assist expression of the gE2 fragment.
  • italicized residues represent 3' untranslated sequences and poly adenylation tail.
  • nucleotide sequence of the modified mRNA encoding an HSV-2 gE fragment lacks the 5' untranslated sequences, the signal sequence, the 3' untranslated sequences, the poly adenylation tail, or a combination thereof.
  • the HSV-2 gE fragment encoded by modified mRNA utilized in the methods and compositions of the present invention comprises amino acids 24-405 of gE from HSV-2 strain 2.12 as set forth in the following amino acid sequence:
  • the full length HSV-2 gE encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the following amino acid sequence: MARGAGLVFFVGVWVVSCLAAAPRTSWKRVTSGEDVVLLPAPAERTRAHKLLWA
  • PTAPSVYPHSEGRKSRRPLTTFGSGSPGRRHSQASYPSVLW (SEQ ID NO: 18).
  • the HSV-2 gE encoded by modified mRNA utilized in the methods and compositions of the present invention comprises the amino acid sequences as set forth in any of the following GenBank Accession Numbers: ABU45436.1, ABU45437.1 ABU45438.1, ABU45439.1, ABW83306.1, ABW83308.1, ABW83310.1 ABW83312.1
  • a gE fragment encoded by modified mRNA utilized in the methods and compositions of the present invention comprises an IgG Fc-binding domain of the gE protein.
  • the gE domain encoded by modified mRNA utilized in the methods and compositions of the present invention is any other gE domain known in the art to mediate binding to IgG Fc.
  • the gE protein encoded by modified mRNA utilized in the methods and compositions of the present invention comprises a gE domain involved in cell-to-cell spread.
  • the gE fragment encoded by modified mRNA fragment utilized in the methods and compositions of the present invention comprises an immune evasion domain. In another embodiment, the gE fragment encoded by modified mRNA fragment utilized in the methods and compositions of the present invention comprises a portion of an immune evasion domain.
  • Each modified mRNA encoding gE-1 or gE-2 protein or fragment thereof represents a separate embodiment of the present invention.
  • a gE protein fragment encoded by modified mRNA utilized in the methods and compositions of the present invention is an immunogenic fragment.
  • a gE immunoprotective antigen need not be the entire protein.
  • the protective immune response generally involves, in another embodiment, an antibody response.
  • mutants, sequence conservative variants, and functional conservative variants of gE are useful in methods and compositions of the present invention, provided that all such variants retain the required immuno-protective effect.
  • the immunogenic fragment can comprise an immuno-protective gE antigen from any strain of HS V.
  • the immunogenic fragment can comprise sequence variants of HSV, as found in infected individuals.
  • an HSV glycoprotein encoded by modified mRNA utilized in the methods and compositions of the present invention is a homologue of the sequence provided herein.
  • an HSV glycoprotein encoded by modified mRNA utilized in the methods and compositions of the present invention is an isoform of the sequence provided herein.
  • an HSV glycoprotein encoded by modified mRNA utilized in the methods and compositions of the present invention is a variant of the sequence provided herein.
  • an HSV glycoprotein encoded by modified mRNA utilized in the methods and compositions of the present invention is a fragment of the sequence provided herein.
  • the glycoprotein fragment encoded by modified mRNA of the methods and compositions of the present invention comprises the ectodomain of the glycoprotein.
  • the glycoprotein fragment encoded by modified mRNA of the methods and compositions of the present invention consists of the ectodomain of the glycoprotein.
  • the glycoprotein fragment encoded by modified mRNA of the methods and compositions of the present invention comprises a fragment of the ectodomain of the glycoprotein.
  • the glycoprotein fragment may be any glycoprotein fragment known in the art.
  • the glycoprotein or immunogenic fragment encoded by modified mRNA fragment utilized in the methods and compositions of the present invention may be from any strain of HSV.
  • the immunogenic fragment encoded by modified mRNA fragment utilized in the methods and compositions of the present invention may comprise sequence variants of HSV, as found in infected individuals.
  • variant refers to an amino acid or nucleic acid sequence (or in other embodiments, an organism or tissue) that is different from the majority of the population but is still sufficiently similar to the common mode to be considered to be one of them, for example splice variants.
  • the variant may a sequence conservative variant, while in another embodiment, the variant may be a functional conservative variant.
  • a variant may comprise an addition, deletion or substitution of one or more amino acids.
  • Immunune evasion domain refers, in one embodiment, to a domain that interferes with or reduces in vivo anti-HSV efficacy of anti-HSV antibodies (e.g. anti-gD antibodies). In another embodiment, the domain interferes or reduces in vivo anti-HSV efficacy of an anti-HSV immune response. In another embodiment, the domain reduces the immunogenicity of an HSV protein (e.g. gD) during subsequent infection. In another embodiment, the domain reduces the immunogenicity of an HSV protein during subsequent challenge. In another embodiment, the domain reduces the immunogenicity of HSV during subsequent challenge. In another embodiment, the domain reduces the immunogenicity of an HSV protein in the context of ongoing HSV infection.
  • the domain reduces the immunogenicity of HSV in the context of ongoing HSV infection.
  • the domain functions as an IgG Fc receptor.
  • the domain promotes antibody bipolar bridging, which in one embodiment, is a term that refers to an antibody molecule binding by its Fab domain to an HSV antigen and by its Fc domain to a separate HSV antigen, such as in one embodiment, gE, thereby blocking the ability of the Fc domain to activate complement.
  • the present invention also provides for modified mRNA encoding analogs of HSV proteins or polypeptides, or fragments thereof. Analogs may differ from naturally occurring proteins or peptides by conservative amino acid sequence substitutions or by modifications which do not affect sequence, or by both.
  • an HSV glycoprotein encoded by modified mRNA of the present invention is homologous to a sequence set forth hereinabove, either expressly or by reference to a GenBank entry.
  • the terms "homology,” “homologous,” etc, when in reference to any protein or peptide, refer, in one embodiment, to a percentage of amino acid residues in the candidate sequence that are identical with the residues of a corresponding native polypeptide, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent homology, and not considering any conservative substitutions as part of the sequence identity. Methods and computer programs for the alignment are well known in the art.
  • identity refers to identity of a protein sequence encoded by a modified mRNA to a sequence disclosed herein of greater than 70%.
  • identity is greater than 72%.
  • identity is greater than 75%.
  • identity is greater than 78%.
  • identity is greater than 80%.
  • identity is greater than 82%.
  • identity is greater than 83%.
  • identity is greater than 85%.
  • identity is greater than 87%.
  • identity is greater than 88%.
  • identity is greater than 90%.
  • identity is greater than 92%. In another embodiment, the identity is greater than 93%.
  • the identity is greater than 95%. In another embodiment, the identity is greater than 96%. In another embodiment, the identity is greater than 97%. In another embodiment, the identity is greater than 98%. In another embodiment, the identity is greater than 99%. In another embodiment, the identity is 100%.
  • isoform refers to a version of a molecule, for example, a protein, with only slight differences to another isoform of the same protein.
  • iso forms may be produced from different but related genes, or in another embodiment, may arise from the same gene by alternative splicing.
  • isoforms are caused by single nucleotide polymorphisms.
  • the modified mRNA encoding a glycoprotein or glycoprotein fragment as described herein further encodes an antigenic tag.
  • the tag is a histidine (“His") tag.
  • the His tag comprises 5 histidine residues.
  • the His tag comprises 6 histidine residues.
  • methods and compositions of the present invention utilize a chimeric molecule, comprising a fusion of a modified mRNA encoding an HSV protein with a modified mRNA encoding a tag polypeptide that provides an epitope to which an anti-tag antibody can selectively bind.
  • the epitope tag is placed, in other embodiments, at the amino- or carboxyl- terminus of the protein or in an internal location therein. The presence of such epitope -tagged forms of the recombinant HSV protein is detected, in another embodiment, using an antibody against the tag polypeptide.
  • inclusion of the epitope tag enables the recombinant HSV protein to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag.
  • an anti-tag antibody or another type of affinity matrix that binds to the epitope tag Various tag polypeptides and their respective antibodies are known in the art.
  • the compositions of the present invention comprise an adjuvant, while in another embodiment, the compositions do not comprise an adjuvant.
  • adjuvant refers, in another embodiment, to compounds that, when administered to an individual or tested in vitro, increase the immune response to an antigen in the individual or test system to which the antigen is administered.
  • an immune adjuvant enhances an immune response to an antigen that is weakly immunogenic when administered alone, i.e., inducing no or weak antibody titers or cell-mediated immune response.
  • the adjuvant increases antibody titers to the antigen.
  • the adjuvant lowers the dose of the antigen effective to achieve an immune response in the individual.
  • the present invention provides compositions comprising modified mRNAs and methods of use thereof.
  • the modified mRNA comprises one or more modified nucleoside residues.
  • the modified nucleoside of the methods and compositions of the present invention is m5C (5-methylcytidine). In another embodiment, the modified nucleoside is m5U (5-methyluridine). In another embodiment, the modified nucleoside is m6A (N6- methyladenosine). In another embodiment, the modified nucleoside is s2U (2-thiouridine). In another embodiment, the modified nucleoside is ⁇ (pseudouridine). In another embodiment, the modified nucleoside is Um (2'-0-methyluridine).
  • the modified nucleoside is m ! A (1 -methyladenosine), m 2 A (2- methyladenosine), m 6 A (N6-methyladenosine), Am (2'-0-methyladenosine), ms 2 m 6 A (2- methylthio-N6-methyladenosine), i 6 A (N6-isopentenyladenosine), ms 2 i 6 A (2-methylthio-N6- isopentenyladenosine), io 6 A (N6-(cis-hydroxyisopentenyl)adenosine), ms 2 io 6 A (2-methylthio- N6-(cis-hydroxyisopentenyl) adenosine), g 6 A (N6-glycinylcarbamoyladenosine), t 6 A (N6- threonylcarbamoyladenosine), ms 2 ! A (1 -methyladen
  • G 1-methylguanosine
  • m 2 G N2-methylguanosine
  • m 7 G 7-methylguanosine
  • Gm (2'-0-methylguanosine
  • m 2 2 G N2,N2-dimethylguanosine
  • m 2 Gm N2,2'-0-dimethylguanosine
  • m 2 2Gm N2,N2,2'-0-trimethylguanosine
  • Gr(p) (2'-0- ribosylguanosine (phosphate)
  • yW wybutosine
  • o 2 yW peroxywybutosine
  • OHyW hydroxy wybutosine
  • OHyW* undermodified hydroxywybutosine
  • imG wyosine
  • mimG mimG
  • mimG methylwyosine
  • Q queuosine
  • oQ epoxyqueuosine
  • galQ galactosyl-que
  • acp 3 (1-methyl- 3-(3-amino-3-carboxypropyl) pseudouridine), cm 5 U (5-carboxymethyluridine), m 6 Am (N6,2'-0- dimethyladenosine), m 6 2 Am (N6,N6,2'-0-trimethyladenosine), m 2 7 G (N2,7-dimethylguanosine), m 2 ' 2 ' 7 G (N2,N2,7-trimethylguanosine), m 3 Um (3,2'-0-dimethyluridine), m 5 D (5- methyldihydrouridine), ⁇ (3-methylpseudouridine), ⁇ Cm (5-formyl-2'-0-methylcytidine), m'Gm (l,2'-0-dimethylguanosine), m'Am (l,2'-0-dimethyladenosine), Tm 5 U (5- taurinomethyluridine), Tm 5 s 2 U (5-taurino
  • the modified nucleoside residues are pseudouridine or pseudouridine family residues.
  • the modified mRNA comprises pseudouridine residues.
  • pseudouridine refers to the C-glycoside isomer of the nucleoside uridine.
  • pseudouridine residues comprise m'acp 3 *!' (l-methyl-3-(3-amino-5- carboxypropyl)pseudouridine, m l P (1-methylpseudouridine), tm (2'-0-methylpseudouridine, m 5 D (5-methyldihydrouridine), m 3 P (3-methylpseudouridine), or a combination thereof.
  • said pseudouridine residues comprise 1-methylpseudouridine residues instead of uridine.
  • the modified nucleoside residues are pseudouridine analogues.
  • a "pseudouridine analog” is any modification, variant, isoform or derivative of pseudouridine.
  • pseudouridine analogs include but are not limited to 1- carboxymethyl-pseudouridine, 1 -propynyl-pseudouridine, 1 -taurinomethyl-pseudouridine, 1- taurinomethyl-4-thio-pseudouridine, 1-methylpseudouridine ( ⁇ 1 ⁇ ), l-methyl-4-thio- pseudouridine (m's ⁇ ), 4-thio- 1 -methyl-pseudouridine, 3-methyl-pseudouridine ( ⁇ 3 ⁇ ), 2-thio-l- methyl-pseudouridine, 1 -methyl- 1 -deaza-pseudouridine, 2-thio- 1 -methyl- 1 -deaza-pseudouridine, 2-thi
  • the modified nucleobase is a modified uracil.
  • exemplary nucleobases and nucleosides having a modified uracil include pseudouridine ( ⁇ ), pyridin-4-one ribonucleoside, 5-aza-uridine, 6-aza-uridine, 2-thio-5-aza-uridine, 2-thio-uridine (s 2 U), 4-thio- uridine (s 4 U), 4-thio-pseudouridine, 2-thio-pseudouridine, 5 -hydroxy-uridine (ho 5 U), 5- aminoallyl-uridine, 5 -halo -uridine (e.g., 5-iodo-uridine or 5-bromo-uridine), 3-methyl-uridine (m 3 U), 5-methoxy-uridine (mo 5 U), uridine 5-oxyacetic acid (cmo 5 U), uridine 5-oxyacetic acid methyl ester (mcmo 5 U), 5-carboxymethyl-uridine
  • the modified nucleobase is a modified cytosine.
  • exemplary nucleobases and nucleosides having a modified cytosine include 5-aza-cytidine, 6-aza-cytidine, pseudoisocytidine, 3-methyl-cytidine (m 3 C), N4-acetyl-cytidine (ac 4 C), 5-formyl-cytidine (f ⁇ C), N4-methyl-cytidine (m 4 C), 5-methyl-cytidine (m 5 C), 5-halo-cytidine (e.g., 5-iodo-cytidine), 5- hydroxymethyl-cytidine (hm 5 C), 1-methyl-pseudoisocytidine, pyrrolo-cytidine, pyrrolo- pseudoisocytidine, 2-thio-cytidine (s 2 C), 2-thio-5-methyl-cytidine, 4-thio-pseudoisocytidine
  • the modified nucleobase is a modified adenine.
  • exemplary nucleobases and nucleosides having a modified adenine include 2-amino-purine, 2,6- diaminopurine, 2-amino-6-halo-purine (e.g., 2-amino-6-chloro-purine), 6-halo-purine (e.g., 6- chloro-purine), 2-amino-6-methyl-purine, 8-azido-adenosine, 7-deaza-adenine, 7-deaza-8-aza- adenine, 7-deaza-2-amino-purine, 7-deaza-8-aza-2-amino-purine, 7-deaza-2,6-diaminopurine, 7- deaza-8-aza-2,6-diaminopurine, 1-methyl-adenosine (m !
  • the modified nucleobase is a modified guanine.
  • exemplary nucleobases and nucleosides having a modified guanine include inosine (I), 1-methyl-inosine (m'l), wyosine (imG), methylwyosine (mimG), 4-demethyl-wyosine (imG- 14), isowyosine (imG2), wybutosine (yW), peroxywybutosine (o 2 yW), hydroxywybutosine (OHyW), undermodified hydroxywybutosine (OHyW*), 7-deaza-guanosine, queuosine (Q), epoxyqueuosine (oQ), galactosyl-queuosine (galQ), mannosyl-queuosine (manQ), 7-cyano-7- deaza-guanosine (preQo), 7-aminomethyl-7-deaza-
  • the nucleobase of the nucleotide can be independently selected from a purine, a pyrimidine, a purine or pyrimidine analog.
  • the nucleobase can each be independently selected from adenine, cytosine, guanine, uracil, or hypoxanthine.
  • the nucleobase can also include, for example, naturally-occurring and synthetic derivatives of a base, including pyrazolo[3,4-d]pyrimidines, 5-methylcytosine (5-me-C), 5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo (e.g., 8-bromo), 8-amino, 8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines and
  • each letter refers to the representative base and/or derivatives thereof, e.g., A includes adenine or adenine analogs, e.g., 7-deaza adenine).
  • the modified nucleotides which may be incorporated into a polynucleotide, primary construct, or mRNA molecule, can be modified on the internucleoside linkage (e.g., phosphate backbone).
  • internucleoside linkage e.g., phosphate backbone
  • the phrases "phosphate” and "phosphodiester” are used interchangeably.
  • Backbone phosphate groups can be modified by replacing one or more of the oxygen atoms with a different substituent.
  • the modified nucleosides and nucleotides can include the wholesale replacement of an unmodified phosphate moiety with another internucleoside linkage as described herein.
  • modified phosphate groups include, but are not limited to, phosphorothioate, phosphoroselenates, boranophosphates, boranophosphate esters, hydrogen phosphonates, phosphoramidates, phosphorodiamidates, alkyl or aryl phosphonates, and phosphotriesters.
  • Phosphorodithioates have both non-linking oxygens replaced by sulfur.
  • the phosphate linker can also be modified by the replacement of a linking oxygen with nitrogen (bridged phosphoramidates), sulfur (bridged phosphorothioates), and carbon (bridged methylene -phosphonates).
  • the a-thio substituted phosphate moiety is provided to confer stability to RNA and DNA polymers through the unnatural phosphorothioate backbone linkages.
  • Phosphorothioate DNA and RNA have increased nuclease resistance and subsequently a longer half-life in a cellular environment.
  • Phosphorothioate linked polynucleotides, primary constructs, or mmRNA molecules are expected to also reduce the innate immune response through weaker binding/activation of cellular innate immune molecules.
  • a modified nucleoside includes an alpha-thio-nucleoside (e.g., 5'-0-(l-thiophosphate)-adenosine, 5'-0-(l-thiophosphate)-cytidine (a-thio-cytidine), 5'-0-(l- thiophosphate)-guanosine, 5'-0-(l-thiophosphate)-uridine, or 5'-0-(l-thiophosphate)- pseudouridine).
  • alpha-thio-nucleoside e.g., 5'-0-(l-thiophosphate)-adenosine, 5'-0-(l-thiophosphate)-cytidine (a-thio-cytidine), 5'-0-(l- thiophosphate)-guanosine, 5'-0-(l-thiophosphate)-uridine, or 5'-0-(l-thiophosphate)- pseudouridine).
  • internucleoside linkages that may be employed according to the present invention, including internucleoside linkages which do not contain a phosphorous atom, are described herein below.
  • polynucleotides, primary constructs, and mmRNA of the invention can include a combination of modifications to the sugar, the nucleobase, and/or the internucleoside linkage.
  • the purified preparation of RNA, oligoribonucleotide, or polyribonucleotide of the methods and compositions of the present invention comprises a combination of two or more of the above-described modifications.
  • the purified preparation of the RNA or ohgoribonucleotide comprises a combination of three or more of the above-described modifications.
  • the purified preparation of the RNA or ohgoribonucleotide comprises a combination of more than three of the above-described modifications.
  • the modified mRNAs comprise in vzVro-synthesized modified mRNAs.
  • the present invention comprises one or more modified mRNAs encoding an HSV glycoprotein.
  • the modified RNA comprises pseudouridine or pseudouridine family residues.
  • the modified mRNAs of the present invention are capable of directing protein expression of HSV glycoproteins encoded thereon.
  • the present invention provides an in vzYro-transcribed mRNA molecule encoding an HSV glycoprotein, comprising a pseudouridine.
  • the present invention provides a synthetic mRNA molecule encoding an HSV glycoprotein, comprising a pseudouridine.
  • an in vzzro-transcribed mRNA molecule of the methods and compositions of the present invention is synthesized by T7 phage RNA polymerase.
  • the molecule is synthesized by SP6 phage RNA polymerase.
  • the molecule is synthesized by T3 phage RNA polymerase.
  • the molecule is synthesized by a polymerase selected from the above polymerases.
  • the mRNA is synthesized chemically on a column similar to DNA.
  • the nucleoside that is modified in an RNA, ohgoribonucleotide, or polyribonucleotide of the methods and compositions of the present invention is uridine (U).
  • the modified nucleoside is cytidine (C).
  • the modified nucleoside is adenine (A).
  • the modified nucleoside is guanine (G).
  • the modified mRNA of the methods and compositions of the present invention further comprises a poly-A tail. In another embodiment, the modified mRNA of the methods and compositions of the present invention does not comprise a poly-A tail. Each possibility represents a separate embodiment of the present invention.
  • the modified mRNA of the methods and compositions of the present invention comprises an m7GpppG cap. In another embodiment, the modified mRNA of the methods and compositions of the present invention does not comprise an m7GpppG cap. In another embodiment, the modified mRNA of the methods and compositions of the present invention comprises a 3'-0-methyl-m7GpppG.
  • the modified mRNA of methods and composition of the present invention comprise a non-reversible cap analog, which, in one embodiment, is added during transcription of the mRNA.
  • the modified mRNA of methods and composition of the present invention comprise an anti-reverse cap analog.
  • the modified mRNA of the methods and compositions of the present invention further comprises a cap-independent translational enhancer.
  • the modified mRNA of the methods and compositions of the present invention does not comprise a cap-independent translational enhancer.
  • the cap- independent translational enhancer is a tobacco etch virus (TEV) cap-independent translational enhancer.
  • the cap-independent translational enhancer is any other cap- independent translational enhancer known in the art. Each possibility represents a separate embodiment of the present invention.
  • "pseudouridine” refers to m'acp 3 *!' (l-methyl-3-(3-amino-5- carboxypropyl)pseudouridine.
  • the term refers to m l P (1- methylpseudouridine).
  • the term refers to tm (2'-0-methylpseudouridine.
  • the term refers to m 5 D (5-methyldihydrouridine).
  • the term refers to m 3 P (3-methylpseudouridine).
  • the modified nucleoside is 4' (pseudouridine).
  • the term refers to a pseudouridine moiety that is not further modified.
  • the term refers to a monophosphate, diphosphate, or triphosphate of any of the above pseudouridines.
  • the term refers to any other pseudouridine known in the art. Each possibility represents a separate embodiment of the present invention.
  • the modified RNA comprises a modified nucleoside, which in one embodiment, comprises m 5 C, m5U, m 6 A, s 2 U, ⁇ , 2'-0-methyl-U, 2'-0-methylpseudouridine, or a combination thereof.
  • the present invention provides a method for delivering a recombinant protein to a subject, the method comprising the step of contacting the subject with a modified mRNA of the methods and compositions of the present invention, thereby delivering a recombinant protein to a subject.
  • a method of the present invention comprises increasing the number, percentage, or frequency of modified uridine nucleosides in the RNA molecule to decrease immunogenicity or increase efficiency of translation.
  • the number of modified uridine residues in an RNA, oligoribonucleotide, or polyribonucleotide molecule determines the magnitude of the effects observed in the present invention.
  • the fraction is 0.1%. In another embodiment, the fraction is 0.4%. In another embodiment, the fraction is 0.5%. In another embodiment, the fraction is 0.6%. In another embodiment, the fraction is 0.8%. In another embodiment, the fraction is 1%. In another embodiment, the fraction is 1.5%. In another embodiment, the fraction is 2%. In another embodiment, the fraction is 2.5% In another embodiment, the fraction is 3%. In another embodiment, the fraction is 4%. In another embodiment, the fraction is 5%.
  • the fraction is 6%. In another embodiment, the fraction is 8%. In another embodiment, the fraction is 10%. In another embodiment, the fraction is 12%. In another embodiment, the fraction is 14%. In another embodiment, the fraction is 16%. In another embodiment, the fraction is 18%. In another embodiment, the fraction is 20%. In another embodiment, the fraction is 25%. In another embodiment, the fraction is 30%. In another embodiment, the fraction is 35%. In another embodiment, the fraction is 40%. In another embodiment, the fraction is 45%. In another embodiment, the fraction is 50%. In another embodiment, the fraction is 60%. In another embodiment, the fraction is 70%. In another embodiment, the fraction is 80%. In another embodiment, the fraction is 90%. In another embodiment, the fraction is 100%.
  • the fraction is less than 5%. In another embodiment, the fraction is less than 3%. In another embodiment, the fraction is less than 1%. In another embodiment, the fraction is less than 2%. In another embodiment, the fraction is less than 4%. In another embodiment, the fraction is less than 6%. In another embodiment, the fraction is less than 8%. In another embodiment, the fraction is less than 10%. In another embodiment, the fraction is less than 12%. In another embodiment, the fraction is less than 15%. In another embodiment, the fraction is less than 20%. In another embodiment, the fraction is less than 30%. In another embodiment, the fraction is less than 40%. In another embodiment, the fraction is less than 50%. In another embodiment, the fraction is less than 60%. In another embodiment, the fraction is less than 70%
  • the fraction of the nucleotide is 0.2%. In another embodiment, the fraction is 0.3%. In another embodiment, the fraction is 0.4%. In another embodiment, the fraction is 0.5%. In another embodiment, the fraction is 0.6%. In another embodiment, the fraction is 0.8%. In another embodiment, the fraction is 1%. In another embodiment, the fraction is 1.5%. In another embodiment, the fraction is 2%. In another embodiment, the fraction is 2.5%. In another embodiment, the fraction is 3%. In another embodiment, the fraction is 4%. In another embodiment, the fraction is 5%. In another embodiment, the fraction is 6%. In another embodiment, the fraction is 8%.
  • the fraction is 10%. In another embodiment, the fraction is 12%. In another embodiment, the fraction is 14%. In another embodiment, the fraction is 16%. In another embodiment, the fraction is 18%. In another embodiment, the fraction is 20%. In another embodiment, the fraction is 25%. In another embodiment, the fraction is 30%. In another embodiment, the fraction is 35%. In another embodiment, the fraction is 40%. In another embodiment, the fraction is 45%. In another embodiment, the fraction is 50%. In another embodiment, the fraction is 60%. In another embodiment, the fraction is 70%. In another embodiment, the fraction is 80%. In another embodiment, the fraction is 90%. In another embodiment, the fraction is 100%.
  • the fraction of the given uridine nucleotide is less than 8%. In another embodiment, the fraction is less than 10%. In another embodiment, the fraction is less than 5%. In another embodiment, the fraction is less than 3%. In another embodiment, the fraction is less than 1%. In another embodiment, the fraction is less than 2%. In another embodiment, the fraction is less than 4%. In another embodiment, the fraction is less than 6%. In another embodiment, the fraction is less than 12%. In another embodiment, the fraction is less than 15%. In another embodiment, the fraction is less than 20%. In another embodiment, the fraction is less than 30%. In another embodiment, the fraction is less than 40%. In another embodiment, the fraction is less than 50%. In another embodiment, the fraction is less than 60%. In another embodiment, the fraction is less than 70%.
  • ribonucleotide refers to, in one embodiment, compounds comprising nucleotides in which the sugar moiety is ribose.
  • the term includes both RNA and RNA derivates in which the backbone is modified. Numerous RNA backbone modifications are known in the art and contemplated in the present invention.
  • modified RNA is a PNA (peptide nucleic acid). PNA contain peptide backbones and nucleotide bases and are able to bind, in another embodiment, to both DNA and RNA molecules.
  • the nucleotide is modified by replacement of one or more phosphodiester bonds with a phosphorothioate bond.
  • the artificial nucleic acid contains any other variant of the phosphate backbone of native nucleic acids known in the art. Each nucleic acid derivative represents a separate embodiment of the present invention.
  • the nucleic acid of interest can be purified by any method known in the art, or any method to be developed, so long as the method of purification removes contaminants from the nucleic acid preparation and thereby substantially reduces the immunogenicity potential of the nucleic acid preparation.
  • the nucleic acid of interest is purified using high-performance liquid chromatography (HPLC).
  • HPLC high-performance liquid chromatography
  • the nucleic acid of interest is purified by contacting the nucleic acid of interest with the bacterial enzyme RNase III.
  • any method of nucleic acid purification that substantially reduces the immunogenicity of the nucleic acid preparation can be used.
  • Non-limiting examples of purification methods that can be used with the compositions and methods of the invention liquid chromatography separation and enzyme digestion, each used alone or in any combination, simultaneously or in any order.
  • Non-limiting examples of liquid chromatography separation include HPLC and fast protein liquid chromatography (FPLC).
  • Materials useful in the HPLC and FPLC methods of the invention include, but are not limited to, cross-linked polystyrene/divinylbenzene (PS/DVB), PS/DVB-C18, PS/DVB-alkylated, Helix DNA columns (Varian), Eclipse dsDNA Analysis Columns (Agilent Technologies), Reverse -phase 5 (RPC-5) exchange material, DNAPac, ProSwift, and bio-inert UltiMate.RTM. 3000 Titanium columns (Dionex).
  • Enzymes useful in the enzyme digestion methods of the invention include any enzyme able to digest any contaminant in a nucleic acid preparation of the invention, such as, for example a dsRNA contaminant, and include but are not limited to, RNase III, RNase VI , Dicer, and Chipper (see Fruscoloni et al., 2002, PNAS 100: 1639)
  • Non- limiting examples of assays for assessing the purity of the nucleic acid of interest include a dot -blot assay, a Northern blot assay, and a dendritic cell activation assay, as described elsewhere herein.
  • the modified mRNA of the methods and compositions of the present invention is significantly less immunogenic than an unmodified in vzVro-synthesized mRNA molecule with the same sequence.
  • the modified mRNA molecule is 2-fold less immunogenic than its unmodified counterpart.
  • immunogenicity is reduced by a 3-fold factor.
  • immunogenicity is reduced by a 5-fold factor.
  • immunogenicity is reduced by a 7-fold factor.
  • immunogenicity is reduced by a 10-fold factor.
  • immunogenicity is reduced by a 15-fold factor.
  • immunogenicity is reduced by a fold factor.
  • immunogenicity is reduced by a 50-fold factor. In another embodiment, immunogenicity is reduced by a 100-fold factor. In another embodiment, immunogenicity is reduced by a 200-fold factor. In another embodiment, immunogenicity is reduced by a 500-fold factor. In another embodiment, immunogenicity is reduced by a 1000-fold factor. In another embodiment, immunogenicity is reduced by a 2000-fold factor. In another embodiment, immunogenicity is reduced by another fold difference.
  • "significantly less immunogenic” refers to a detectable decrease in immunogenicity.
  • the term refers to a fold decrease in immunogenicity (e.g. 1 of the fold decreases enumerated above).
  • the term refers to a decrease such that an effective amount of the modified mRNA can be administered without triggering a detectable immune response.
  • the term refers to a decrease such that the modified mRNA can be repeatedly administered without eliciting an immune response sufficient to detectably reduce expression of the recombinant protein.
  • the decrease is such that the modified mRNA can be repeatedly administered without eliciting an immune response sufficient to eliminate detectable expression of the recombinant protein.
  • the modified mRNA of the methods and compositions of the present invention is translated in the cell more efficiently than an unmodified mRNA molecule with the same sequence.
  • the modified mRNA exhibits enhanced ability to be translated by a target cell.
  • translation is enhanced by a factor of 2-fold relative to its unmodified counterpart.
  • translation is enhanced by a 3-fold factor.
  • translation is enhanced by a 5-fold factor.
  • translation is enhanced by a 7-fold factor.
  • translation is enhanced by a 10- fold factor.
  • translation is enhanced by a 15-fold factor.
  • translation is enhanced by a 20-fold factor.
  • translation is enhanced by a 50-fold factor.
  • translation is enhanced by a 100-fold factor. In another embodiment, translation is enhanced by a 200-fold factor. In another embodiment, translation is enhanced by a 500-fold factor. In another embodiment, translation is enhanced by a 1000-fold factor. In another embodiment, translation is enhanced by a 2000-fold factor. In another embodiment, the factor is 10-1000-fold. In another embodiment, the factor is 10-100-fold. In another embodiment, the factor is 10-200-fold. In another embodiment, the factor is 10-300-fold. In another embodiment, the factor is 10-500-fold. In another embodiment, the factor is 20-1000- fold. In another embodiment, the factor is 30-1000-fold. In another embodiment, the factor is 50- 1000-fold. In another embodiment, the factor is 100-1000-fold. In another embodiment, the factor is 200-1000-fold. In another embodiment, translation is enhanced by any other significant amount or range of amounts. Each possibility represents a separate embodiment of the present invention.
  • Methods of determining translation efficiency include, e.g. measuring the activity of an encoded reporter protein (e.g luciferase or renilla or green fluorescent protein [Wall A A, Phillips A M et al, Effective translation of the second cistron in two Drosophila dicistronic transcripts is determined by the absence of in-frame AUG codons in the first cistron.
  • an encoded reporter protein e.g luciferase or renilla or green fluorescent protein
  • the target cell of the method of the present invention is a dendritic cell.
  • the target cell of the method of the present invention is a macrophage.
  • the target cell of the method of the present invention is a B cell.
  • the target cell of the method of the present invention is another antigen presenting cell.
  • the target cell of methods of the present invention is a mucosal cell.
  • the target cell of methods of the present invention is an epithelial cell.
  • the cell is a skin cell.
  • the cell is an epidermal cell.
  • the cell is a keratinocyte.
  • the cell is a Merkel cell, melanocyte or Langerhans cell. Each possibility represents a separate embodiment of the present invention.
  • the present invention also provides methods of vaccinating a subject against HSV and treating, impeding, inhibiting, reducing the incidence of, or suppressing an HSV infection or a symptom or manifestation thereof, comprising administration of a composition of the present invention.
  • the present invention provides a method for treating an HSV infection in a subject, comprising contacting said subject with a composition comprising one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV glycoprotein or immunogenic fragment thereof.
  • the present invention provides a method for suppressing an HSV infection in a subject, comprising contacting said subject with a composition comprising one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV glycoprotein or immunogenic fragment thereof.
  • the present invention provides a method for inhibiting an HSV infection in a subject, comprising contacting said subject with a composition comprising one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV glycoprotein or immunogenic fragment thereof.
  • the present invention provides a method for reducing the incidence of HSV infection in a subject, comprising contacting said subject with a composition comprising one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV glycoprotein or immunogenic fragment thereof.
  • the HSV infection is an HSV-1 infection. In another embodiment, the HSV infection is an HSV-2 infection.
  • the subject is administered HSV-1 glycoproteins for methods of treating, inhibiting, suppressing, etc. an HSV-1 infection.
  • the subject is administered HSV-2 glycoproteins for methods of treating, inhibiting, suppressing, etc. an HSV- 2 infection.
  • the subject is administered HSV-1 glycoproteins for methods of treating, inhibiting, suppressing, etc. an HSV-1 infection, HSV-2 infection, or a combination thereof.
  • the subject is administered HSV-2 glycoproteins for methods of treating, inhibiting, suppressing, etc. an HSV-1 infection, HSV-2 infection, or a combination thereof.
  • HSV-1 glycoproteins e.g., gCl, gDl, gEl, or a combination thereof
  • HSV-2 glycoproteins e.g., gC2, gD2 and gE2, or a combination thereof
  • the present invention provides a method for treating, suppressing, inhibiting, or reducing the incidence of Herpes Simplex Virus 1 (HSV- 1) infection in a subject, comprising contacting said subject with a composition comprising one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV- 1 glycoprotein or immunogenic fragment thereof.
  • HSV- 1 Herpes Simplex Virus 1
  • the present invention provides a method for treating, suppressing, inhibiting, or reducing the incidence of Herpes Simplex Virus 2 (HSV-2) infection in a subject, comprising contacting said subject with a composition comprising one or more modified mRNAs, wherein each of said modified mRNAs encodes an HSV-2 glycoprotein or immunogenic fragment thereof.
  • said contacting is via administration to said subject.
  • the present invention provides a method of treating, suppressing, inhibiting, or reducing the incidence of an HSV infection in a subject, the method comprising the step of administering to said subject an immunogenic composition comprising modified mRNAs encoding: (a) an HSV gD or immunogenic fragment thereof; (b) an HSV gC or fragment thereof as described herein; (c) an HSV gE or fragment thereof as described herein, or a combination thereof.
  • the present invention provides a method of treating, suppressing, inhibiting, or reducing the incidence of an HSV infection in a subject, the method comprising the step of administering to said subject an immunogenic composition comprising modified mRNAs encoding: (a) an HSV-2 gD or immunogenic fragment thereof; (b) an HSV-2 gC or fragment thereof as described herein; and (c) an HSV-2 gE or fragment thereof as described herein, or a combination thereof.
  • the present invention provides a method of treating, suppressing, inhibiting, or reducing the incidence of an HSV infection in a subject, the method comprising the step of administering to said subject an immunogenic composition comprising modified mRNAs encoding: (a) an HSV-1 gD or immunogenic fragment thereof; (b) an HSV-1 gC or fragment thereof as described herein; and (c) an HSV-1 gE or fragment thereof as described herein, or a combination thereof.
  • the present invention provides a method of inducing an anti-HSV immune response in a subject, the method comprising the step of administering to said subject an immunogenic composition comprising modified mRNAs encoding: (a) an HSV gD or immunogenic fragment thereof; (b) an HSV gC or fragment thereof as described herein; (c) an HSV gE or fragment thereof as described herein, or a combination thereof.
  • the present invention provides a method of inducing an anti-HSV immune response in a subject, the method comprising the step of administering to said subject an immunogenic composition comprising modified mRNAs encoding: (a) an HSV-2 gD or immunogenic fragment thereof; (b) an HSV-2 gC or fragment thereof as described herein; and (c) an HSV-2 gE or fragment thereof as described herein, or a combination thereof.
  • the present invention provides a method of inducing an anti-HSV immune response in a subject, the method comprising the step of administering to said subject an immunogenic composition comprising modified mRNAs encoding: (a) an HSV-1 gD or immunogenic fragment thereof; (b) an HSV-1 gC or fragment thereof as described herein; and (c) an HSV- 1 gE or fragment thereof as described herein, or a combination thereof.
  • the present invention provides a method of inhibiting a primary HSV infection in a subject, the method comprising the step of administering to the subject a composition of the present invention.
  • the present invention provides a method of treating an HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of reducing the incidence of an HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of inhibiting a flare following a primary HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides methods of treating and/or suppressing a primary HSV infection and/or a secondary HSV infection.
  • a "primary" infection refers to a first -time infection.
  • a "secondary” infection refers to a recurrence of an HSV infection.
  • a "flare” or “recurrence” refers to reinfection of skin tissue following latent neuronal HSV infection.
  • the terms refer to reactivation of HSV after a latency period.
  • the terms refer to symptomatic HSV lesions following a non-symptomatic latency period.
  • the present invention provides a method of inhibiting spread of HSV.
  • the spread from DRG to skin is inhibited.
  • cell-to- cell spread of HSV is inhibited.
  • anterograde spread is inhibited.
  • retrograde spread is inhibited.
  • DRG refers, in one embodiment, to a neuronal cell body and in another embodiment, contain the neuron cell bodies of nerve fibers. In another embodiment, the term refers to any other definition of "DRG" used in the art.
  • spread of HSV to neural tissue is inhibited.
  • the present invention provides a method of inhibiting a recurrence following a primary HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of preventing a recurrence following a primary HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of inhibiting an HSV labialis following a primary HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of preventing a recurrence of an HSV infection, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of diminishing the severity of a recurrence of an HSV infection, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of reducing the frequency of a recurrence of an HSV infection, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides any of the described methods in an HIV-infected subject.
  • the present invention provides a method of treating an HSV encephalitis in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of reducing the incidence of an HSV encephalitis in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • HSV encephalitis refers, in one embodiment, to an encephalitis caused by a Herpes Simplex Virus- 1 (HSV).
  • HSV Herpes Simplex Virus- 1
  • the term refers to an encephalitis associated with HSV.
  • the term refers to any other type of HSV-mediated encephalitis known in the art.
  • the present invention provides a method of treating or reducing an HSV neonatal infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method for introducing an HSV glycoprotein to a cell of a subject, comprising contacting said cell with an in vzVro-transcribed mRNA molecule encoding the recombinant protein, wherein said in vzYro-transcribed mRNA molecule further comprises a modified nucleoside, thereby introducing said HSV glycoprotein into said cell of said subject.
  • the present invention provides a method for inducing a mammalian cell to produce an HSV glycoprotein, comprising contacting said mammalian cell with an in vzzro-synthesized mRNA molecule encoding the HSV glycoprotein, the in vzzro-synthesized mRNA molecule comprising a pseudouridine, thereby inducing said mammalian cell to produce said HSV glycoprotein.
  • HSV refers in one embodiment, to HSV-1 , while in another embodiment, to HSV-2, while in another embodiment, to HSV- 1 and HSV-2.
  • HSV- 1 refers, in another embodiment, to a Herpes Simplex Virus- 1.
  • the term refers to a KOS strain.
  • the term refers to an F strain.
  • the term refers to an NS strain.
  • the term refers to a CL101 strain.
  • the term refers to a "17" strain.
  • the term refers to a "17+syn" strain.
  • the term refers to a Maclntyre strain.
  • the term refers to an MP strain.
  • the term refers to an HF strain.
  • the term refers to any other HSV- 1 strain known in the art.
  • HSV-2 refers, in another embodiment, to a Herpes Simplex Virus-2.
  • the term refers to an HSV-2 333 strain.
  • the term refers to a 2.12 strain.
  • the term refers to an HG52 strain.
  • the term refers to an MS strain.
  • the term refers to a G strain.
  • the term refers to a 186 strain.
  • the term refers to any other HSV-2 strain known in the art.
  • the present invention provides a method of vaccinating a subject against an HSV infection, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of suppressing an HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of impeding an HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of impeding a primary HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of impeding neuronal HSV spread in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the terms “impeding an HSV infection” and “impeding a primary HSV infection” refer, in another embodiment, to decreasing the titer of infectious virus. In another embodiment, the terms refer to decreasing the extent of viral replication.
  • the present invention provides a method of reducing the incidence of an HSV-mediated herpetic ocular disease in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of treating an HSV- 1 corneal infection or herpes keratitis in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of reducing the incidence of an HSV-1 corneal infection or herpes keratitis in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of treating, suppressing or inhibiting an HSV genital infection, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of treating, suppressing or inhibiting any manifestation of recurrent HSV infection, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of reducing the incidence of an HSV-mediated genital ulcer disease in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of impeding an establishment of a latent HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of treating, suppressing or inhibiting a genital herpes infection in a subject, comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of treating, suppressing or inhibiting an oral herpes infection in a subject, comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of reducing the incidence of an HSV-mediated encephalitis in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the herpes-mediated encephalitis treated or prevented by a method of the present invention is a focal herpes encephalitis.
  • the herpes- mediated encephalitis is a neonatal herpes encephalitis.
  • the herpes- mediated encephalitis is any other type of herpes-mediated encephalitis known in the art.
  • the present invention provides a method of treating or reducing the incidence of a disease, disorder, or symptom associated with or secondary to an HSV-mediated encephalitis in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of treating, reducing the pathogenesis of, ameliorating the symptoms of, ameliorating the secondary symptoms of, reducing the incidence of, prolonging the latency to a relapse of an HSV infection in a subject, comprising the step of administering to the subject a composition of the present invention.
  • the present invention provides a method of protecting a subject against formation of a zosteriform lesion or an analogous outbreak in a human subject. In another embodiment, the present invention provides a method of inhibiting the formation of an HSV zosteriform lesion or an analogous outbreak in a human subject.
  • Zosteriform refers, in one embodiment, to skin lesions characteristic of an HSV infection, particularly during reactivation infection, which, in one embodiment, begin as a rash and follow a distribution near dermatomes, commonly occurring in a strip or belt-like pattern. In one embodiment, the rash evolves into vesicles or small blisters filled with serous fluid. In one embodiment, zosteriform lesions form in mice as a result of contact with HSV. In another embodiment, zosteriform lesions form in humans as a result of contact with HSV. "Zosteriform spread” refers, in one embodiment, to an HSV infection that spreads from the ganglia to secondary skin sites within the dermatome.
  • the term refers to spread within the same dermatome as the initial site of infection.
  • the term refers to any other definition of "zosteriform spread” known in the art.
  • "Outbreak" in another embodiment, refers to a sudden increase in symptoms of a disease or in the spread or prevalence of a disease, and in one embodiment, refers to a sudden increase in zosteriform lesions, while in another embodiment, "outbreak” refers to a sudden eruption of zosteriform lesions.
  • the present invention provides a method of impeding the formation of a dermatome lesion or an analogous condition in a subject.
  • dermatome lesions form as a result of contact with HSV.
  • dermatome lesions most often develop when the virus reactivates from latency in the ganglia and in one embodiment, spreads down nerves, in one embodiment, causing a recurrent infection.
  • the methods of the present invention may be used to treat, inhibit, suppress, etc an HSV infection or primary or secondary symptoms related to such an infection following exposure of the subject to HSV.
  • the subject has been infected with HSV before vaccination.
  • the subject is at risk for HSV infection.
  • vaccination by a method of the present invention is efficacious in treating, inhibiting, suppressing, etc. an HSV infection or primary or secondary symptoms related to such an infection.
  • treating refers to either therapeutic treatment or prophylactic or preventative measures, wherein the object is to prevent or lessen the targeted pathologic condition or disorder as described hereinabove.
  • treating may include directly affecting or curing, suppressing, inhibiting, preventing, reducing the severity of, delaying the onset of, reducing symptoms associated with the disease, disorder or condition, or a combination thereof.
  • "treating” refers inter alia to delaying progression, expediting remission, inducing remission, augmenting remission, speeding recovery, increasing efficacy of or decreasing resistance to alternative therapeutics, or a combination thereof.
  • preventing refers, inter alia, to delaying the onset of symptoms, preventing relapse to a disease, decreasing the number or frequency of relapse episodes, increasing latency between symptomatic episodes, or a combination thereof.
  • “suppressing” or “inhibiting” refers inter alia to reducing the severity of symptoms, reducing the severity of an acute episode, reducing the number of symptoms, reducing the incidence of disease-related symptoms, reducing the latency of symptoms, ameliorating symptoms, reducing secondary symptoms, reducing secondary infections, prolonging patient survival, or a combination thereof.
  • compositions and methods of the present invention are effective in lowering HSV acquisition rates, duration of HSV infection, frequency of HSV reactivation, or a combination thereof.
  • the compositions and methods of the present invention are effective in treating or inhibiting genital ulcer disease, which in one embodiment, entails decreasing the severity or frequency of HSV genital ulcer disease.
  • the compositions and methods of the present invention block immune evasion from complement.
  • vaccination with mRNA-encoded HSV subunits may produce high titers of neutralizing antibodies or potent T-cell responses; however, upon subsequent infection, HSV immune evasion molecules may block the activities of antibodies or T cells, thereby reducing composition efficacy.
  • the compositions and methods of the present invention incorporate strategies to block virus mediated immune evasion by, in one embodiment, enhancing the effectiveness of e.g. a gD-1 subunit composition using gC-1 to prevent immune evasion from complement.
  • compositions and methods of the present invention are useful for preventing or inhibiting recurrent HSV infections.
  • antibodies to e.g. gC-1 block domains involved in immune evasion, which enhances complement activity, improves neutralizing activity of anti-gD-1 IgG, increases antibody- and complement-dependent cellular cytotoxicity, and augments complement- mediated neutralization and lysis of infected cells.
  • symptoms are primary, while in another embodiment, symptoms are secondary.
  • compositions and strains for use in the present invention treat primary or secondary symptoms or secondary complications related to HSV infection.
  • symptoms may be any manifestation of an HSV infection, comprising blisters, ulcerations, or lesions on the urethra, cervix, upper thigh, and/or anus in women and on the penis, urethra, scrotum, upper thigh, and anus in men, inflammation, swelling, fever, flu-like symptoms, sore mouth, sore throat, pharyngitis, pain, blisters on tongue, mouth or lips, ulcers, cold sores, neck pain, enlarged lymph nodes, reddening, bleeding, itching, dysuria, headache, muscle pain, etc., or a combination thereof.
  • the disease, disorder, or symptom is fever. In another embodiment, the disease, disorder, or symptom is headache. In another embodiment, the disease, disorder, or symptom is stiff neck. In another embodiment, the disease, disorder, or symptom is seizures. In another embodiment, the disease, disorder, or symptom is partial paralysis. In another embodiment, the disease, disorder, or symptom is stupor. In another embodiment, the disease, disorder, or symptom is coma. In another embodiment, the disease, disorder, or symptom is any other disease, disorder, or symptom known in the art that is associated with or secondary to a herpes-mediated encephalitis.
  • the present invention provides a method of treating or reducing the incidence of a disease, disorder, or symptom associated with an HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the disease, disorder, or symptom secondary to an HSV infection is oral lesions.
  • the disease, disorder, or symptom is genital lesions.
  • the disease, disorder, or symptom is oral ulcers.
  • the disease, disorder, or symptom is genital ulcers.
  • the disease, disorder, or symptom is fever.
  • the disease, disorder, or symptom is headache.
  • the disease, disorder, or symptom is muscle ache. In another embodiment, the disease, disorder, or symptom is swollen glands in the groin area. In another embodiment, the disease, disorder, or symptom is painful urination. In another embodiment, the disease, disorder, or symptom is vaginal discharge. In another embodiment, the disease, disorder, or symptom is blistering. In another embodiment, the disease, disorder, or symptom is flu-like malaise. In another embodiment, the disease, disorder, or symptom is keratitis. In another embodiment, the disease, disorder, or symptom is herpetic whitlow. In another embodiment, the disease, disorder, or symptom is Bell's palsy.
  • the disease, disorder, or symptom is herpetic erythema multiforme.
  • the disease, disorder, or symptom is a lower back symptom (e.g. numbness, tingling of the buttocks or the area around the anus, urinary retention, constipation, and impotence).
  • the disease, disorder, or symptom is a localized eczema herpeticum.
  • the disease, disorder, or symptom is a disseminated eczema herpeticum.
  • the disease, disorder, or symptom is a herpes gladiatorum.
  • the disease, disorder, or symptom is a herpetic sycosis.
  • the disease, disorder, or symptom is an esophageal symptom (e.g. difficulty swallowing or burning, squeezing throat pain while swallowing, weight loss, pain in or behind the upper chest while swallowing).
  • the disease, disorder, or symptom is any other disease, disorder, or symptom that is known in the art. Each disease, disorder, and symptom represents a separate embodiment of the present invention.
  • compositions and methods of the instant invention treat, suppress, inhibit, or reduce the incidence of the infection itself, while in another embodiment, the compositions and methods of the instant invention treat, suppress, inhibit, or reduce the incidence of primary symptoms of the infection, while in another embodiment, the compositions and methods of the instant invention treat, suppress, inhibit, or reduce the incidence of secondary symptoms of the infection. It is to be understood that the compositions and methods of the instant invention may affect any combination of the infection, the primary symptoms caused by the infection, and secondary symptoms related to the infection.
  • the HSV infection that is treated or ameliorated by methods and compositions of the present invention is, in another embodiment, a genital HSV infection.
  • the HSV infection is an oral HSV infection.
  • the HSV infection is an ocular HSV infection.
  • the HSV infection is a dermatologic HSV infection.
  • the present invention provides a method of reducing the incidence of a disseminated HSV infection in a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of reducing the incidence of a neonatal HSV infection in an offspring of a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of reducing a transmission of an HSV infection from a subject to an offspring thereof, the method comprising the step of administering to said subject a composition of the present invention.
  • the offspring is an infant.
  • the transmission that is reduced or inhibited is transmission during birth.
  • transmission during breastfeeding is reduced or inhibited.
  • the transmission that is reduced or inhibited is any other type of parent-to-offspring transmission known in the art.
  • the present invention provides a method of reducing a severity of a neonatal HSV infection in an offspring of a subject, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of treating, suppressing, inhibiting, or reducing the incidence of an HSV infection in a subject infected with HIV, the method comprising the step of administering to said subject a composition comprising: (a) a modified mRNA encoding HSV gC protein or fragment thereof; (b) a modified mRNA encoding HSV gE protein or fragment thereof; and (c) an adjuvant.
  • the present invention provides a method of treating, suppressing, inhibiting, or reducing the incidence of an HSV infection in a subject infected with HIV, the method comprising the step of administering to said subject a composition comprising: (a) a modified mRNA encoding HSV gC protein or fragment thereof, wherein said fragment comprises either a C3b-binding domain thereof, a properdin interfering domain thereof, a C5 interfering domain thereof, or a fragment of said C3b- binding domain, properdin interfering domain, or C5 -interfering domain; (b) a modified mRNA encoding HSV gE protein or fragment thereof, wherein said fragment comprises AA 24-409 or a fragment thereof; and (c) an adjuvant.
  • a composition comprising: (a) a modified mRNA encoding HSV gC protein or fragment thereof, wherein said fragment comprises either a C3b-binding domain thereof, a properdin interfering domain thereof, a C5 interfering
  • the present invention provides a method of treating an HSV infection in a subject infected with HIV, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of suppressing an HSV infection in a subject infected with HIV, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of inhibiting an HSV infection in a subject infected with HIV, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of reducing the incidence of an HSV infection in a subject infected with HIV, the method comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of preventing an HIV infection, the method comprising the step of administering to said subject an HSV composition of the present invention.
  • HSV infection increases the risk of HIV infection, and protection against HSV infection decreases the risk of HIV infection.
  • the present invention provides a method of decreasing the risk of an HIV infection, the method comprising the step of administering to said subject a composition of the present invention.
  • the composition for use in the methods of the present invention elicits an immune response against HSV. In another embodiment, the composition for use in the methods of the present invention elicits an immune response against HSV-1. In another embodiment, the composition for use in the methods of the present invention elicits an immune response against HSV-2.
  • the composition comprises modified mRNAs encoding gD and gC proteins. In another embodiment, the composition comprises modified mRNAs encoding gE and gD proteins. In another embodiment, the composition comprises modified mRNAs encoding gC and gE proteins. In another embodiment, the composition comprises modified mRNAs encoding gE, gD, and gC proteins.
  • the composition comprises modified mRNAs encoding gE, gD, or gC protein.
  • the proteins encoded by the modified mRNAs are HSV-1 proteins.
  • the proteins encoded by the modified mRNAs are HSV-2 proteins.
  • the proteins encoded by the modified mRNAs comprise both HSV-1 and HSV-2 proteins.
  • a subject according to any of the embodiments described herein may be a subject infected with, or in another embodiment, susceptible to infection with HSV.
  • a subject may be infected with, or in another embodiment, susceptible to infection with at least one other pathogen.
  • a subject may be immunocompromised.
  • the subject is infected by HSV, while in another embodiment, the subject is at risk for infection by HSV, which in one embodiment, is a subject who is a neonate, in another embodiment, immunocompromised, in another embodiment, elderly, and in another embodiment, an immunocompromised neonate or an immunocompromised elderly subject.
  • compositions of the present invention and their related uses may suppress, inhibit, prevent or treat an HIV infection in a subject.
  • the compositions of the present invention and their related uses may treat secondary complications of HIV infection, which in one embodiment, are opportunistic infections, neoplasms, neurologic abnormalities, or progressive immunologic deterioration.
  • the methods comprise treating acquired immunodeficiency syndrome (AIDS).
  • the methods comprise treating a decline in the number of CD4 + T lymphocytes.
  • the present invention provides a method of reducing HIV-1 transmission to an offspring, the method comprising the step of administering to a subject a composition of the present invention.
  • HSV-2 infection increases HIV-1 viral shedding in genital secretions (Nagot N et al., Reduction of HIV-1 RNA levels with therapy to suppress herpes simplex virus. N Engl J Med. 2007 Feb 22; 356(8):790-9).
  • methods of the present invention of inhibiting HSV-2 infection are also efficacious for reducing HIV-1 transmission to an offspring.
  • the mutant HSV strain is an HSV-1 strain.
  • the mutant HSV strain is an HSV-2 strain.
  • the present invention provides a method of reducing HIV-1 transmission to a sexual partner, the method comprising the step of administering to a subject a composition of the present invention.
  • HSV-2 infection increases HIV-1 viral shedding in genital secretions.
  • methods of the present invention of inhibiting HSV-2 infection are also efficacious for reducing HIV- 1 transmission to a sexual partner.
  • the mutant HSV strain is an HSV- 1 strain.
  • the mutant HSV strain is an HSV-2 strain.
  • the present invention provides a method of reducing susceptibility to HIV- 1 , the method comprising the step of administering to a subject a composition of the present invention.
  • HSV-2 infection increases HIV-1 replication (Ouedraogo A et ah, Impact of suppressive herpes therapy on genital HIV- 1 RNA among women taking antiretroviral therapy: a randomized controlled trial. AIDS. 2006 Nov 28;20( 18):2305-13).
  • methods of the present invention of inhibiting HSV-2 infection are also efficacious for reducing susceptibility to HIV-1.
  • the mutant HSV strain is an HSV- 1 strain.
  • the mutant HSV strain is an HSV-2 strain.
  • the present invention provides a method of inhibiting a primary HSV infection in an HIV-infected subject, comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of treating or reducing the incidence of an HSV infection in an HIV-infected subject, comprising the step of administering to said subject a composition of the present invention.
  • the present invention provides a method of inhibiting a flare, recurrence, or HSV labialis following a primary HSV infection in an HIV-infected subject, the method comprising the step of administering to said subject a composition of the present invention.
  • administration of a composition of the present invention an anti-HSV immune response.
  • the present invention provides a method for inducing an immune response in a subject, the method comprising the step of administering to said subject a nucleoside modified mRNA composition of the present invention.
  • the immune response comprises a CD4 immune response.
  • the immune response comprises a CD8 immune response.
  • the immune response comprises a T follicular helper cell immune response.
  • the immune response comprises a germinal center B cell immune response.
  • the immune response comprises an IgG antibody response to gC2, gD2, gE2 or a combination thereof.
  • the present invention provides a method of treating a Herpes Simplex Virus (HSV) infection in a subject, the method comprising the step of intramuscularly administering to said subject a nucleoside modified mRNA composition of the present invention.
  • the invention provides a method of suppressing, inhibiting, or reducing the incidence of a Herpes Simplex Virus (HSV) infection in a subject, the method comprising the step of intramuscularly administering to said subject a nucleoside modified mRNA composition of the present invention.
  • compositions of the present invention can be, in another embodiment, administered to a subject by any method known to a person skilled in the art, such as parenterally, paracancerally, transmucosally, transdermally, intramuscularly, intravenously, intra-dermally, subcutaneously, intra-peritonealy, intra- ventricularly, intra-cranially, intra- vaginally, intra-nasally, intra-tumorally, or topically.
  • administering in another embodiment, refers to directly introducing into a subject by injection or other means a composition of the present invention.
  • administering refers to contacting a cell of the subject's immune system with a composition or modified mRNA encoding HSV protein or mixture thereof.
  • compositions are administered orally, and are thus formulated in a form suitable for oral administration, i.e. as a solid or a liquid preparation.
  • suitable solid oral formulations include tablets, capsules, pills, granules, pellets and the like.
  • Suitable liquid oral formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
  • the active ingredient is formulated in a capsule.
  • the compositions of the present invention comprise, in addition to the active compound and the inert carrier or diluent, a hard gelating capsule.
  • the pharmaceutical compositions are administered by intravenous, intra- arterial, or intramuscular injection of a liquid preparation.
  • suitable liquid formulations include solutions, suspensions, dispersions, emulsions, oils and the like.
  • the pharmaceutical compositions are administered intravenously and are thus formulated in a form suitable for intravenous administration.
  • the pharmaceutical compositions are administered intra-arterially and are thus formulated in a form suitable for intra-arterial administration.
  • the pharmaceutical compositions are administered intramuscularly and are thus formulated in a form suitable for intramuscular administration.
  • the pharmaceutical compositions are administered topically to body surfaces and are thus formulated in a form suitable for topical administration.
  • suitable topical formulations include gels, ointments, creams, lotions, drops and the like.
  • the compositions or their physiologically tolerated derivatives are prepared and applied as solutions, suspensions, or emulsions in a physiologically acceptable diluent with or without a pharmaceutical carrier.
  • the composition is administered as a suppository, for example a rectal suppository or a urethral suppository.
  • the pharmaceutical composition is administered by subcutaneous implantation of a pellet.
  • the pellet provides for controlled release of agent over a period of time.
  • compositions are administered intramuscularly, subcutaneously or intradermally.
  • Effective dosage of the modified mRNA refers, in another embodiment, to an amount sufficient to exert a therapeutic effect. In another embodiment, the term refers to an amount sufficient to elicit expression of a detectable amount of the encoded protein. Each possibility represents a separate embodiment of the present invention.
  • Methods for measuring the dose of a modified mRNA encoding an HSV glycoprotein are well known in the art, and include, for example, dose-escalating trials. Each method represents a separate embodiment of the present invention.
  • any of the HSV compositions of and for use in the methods of this invention will comprise a modified mRNA encoding HSV protein or combination of modified mRNAs encoding HSV proteins of the present invention, in any form or embodiment as described herein.
  • any of the compositions of and for use in the methods will consist of a modified mRNA encoding HSV protein or combination of modified mRNA encodings HSV proteins of the present invention, in any form or embodiment as described herein.
  • the compositions of this invention will consist essentially of a modified mRNA encoding an HSV protein or combination of modified mRNAs encoding HSV proteins of the present invention, in any form or embodiment as described herein.
  • the term “comprise” refers to the inclusion of modified mRNA encoding other HSV proteins, as well as inclusion of modified mRNA encoding other proteins that may be known in the art.
  • the term “consisting essentially of” refers to a composition, which has the modified mRNA encoding a specific HSV protein or fragment thereof. However, other components may be included that are not involved directly in the utility of the modified mRNA(s) encoding HSV protein(s).
  • the term “consisting” refers to a composition having a modified mRNA encoding particular HSV protein or fragment or combination of modified mRNAs encoding HSV proteins or fragments of the present invention, in any form or embodiment as described herein.
  • the present invention provides a composition for treating HSV-1 or a symptom or manifestation thereof, the composition comprising a modified mRNA of the present invention.
  • the present invention provides a composition for treating HSV-2 or a symptom or manifestation thereof, the composition comprising a modified mRNA of the present invention.
  • compositions, and methods of the present invention may be used in non-HSV herpesvirus as well, which in one embodiment, proteins gD, gE, or gC proteins that are, in one embodiment, 70% homologous, in another embodiment, 80% homologous, in another embodiment, 85% homologous, in another embodiment, 90% homologous, in another embodiment, 95% homologous, in another embodiment, 98% homologous, and in another embodiment, 100% homologous to the gD, gE, or gC proteins of HSV-1, or in another embodiment, of HSV-2.
  • such compositions may be useful in suppressing, inhibiting, preventing, or treating, cancers, or in another embodiment, tumors.
  • non-HSV herpesvirus comprise Varicella Zoster Virus (VZV), Epstein-Barr virus (EBV), EBNA, cytomegalovirus (CMV), and human herpesvirus-6 (HHV-6).
  • VZV Varicella Zoster Virus
  • EBV Epstein-Barr virus
  • CMV cytomegalovirus
  • HHV-6 human herpesvirus-6
  • the dosage is a daily dose. In another embodiment, the dosage is a weekly dose. In another embodiment, the dosage is a monthly dose. In another embodiment, the dosage is an annual dose. In another embodiment, the dose is one is a series of a defined number of doses. In another embodiment, the dose is a one-time dose.
  • any of the booster doses described hereinabove is administered following a priming dose comprising one or modified more mRNAs encoding HSV-1 proteins or immunogenic fragments thereof.
  • any of the booster doses described hereinabove is administered following a priming vaccination comprising one or more modified more mRNAs encoding HSV-2 proteins or immunogenic fragments thereof.
  • a subject is immunized with a single administration of the composition. In another embodiment, a subject is immunized with a single dose. In another embodiment, a subject is immunized with two doses. In another embodiment, a subject is immunized with three doses. In another embodiment, a subject is immunized with four doses. In another embodiment, a subject is immunized with five doses.
  • modified mRNAs encoding gC, gD, and gE are provided in a ratio of 1 : 1 : 1. In another embodiment, modified mRNAs encoding gC, gD, and gE are provided in a ratio of 5:2:5. In another embodiment, modified mRNAs encoding gC and gD are provided in a ratio of 1 : 1. In another embodiment, modified mRNAs encoding gC and gE are provided in a ratio of 1 : 1. In another embodiment, modified mRNAs encoding gD and gE are provided in a ratio of 1 : 1.
  • modified mRNAs encoding gC, gD, gE, or a combination thereof, or combined with other HSV glycoproteins are administered in a single composition at the same site and by the same route, while in another embodiment, modified mRNAs encoding gC, gD, and gE are administered in separate compositions at separate sites but by the same route of administration, or in another embodiment, modified mRNAs encoding gC, gD, and gE are administered in separate compositions at separate sites and by different routes of administration, or in another embodiment, modified mRNAs encoding gC, gD, and gE are administered in separate compositions at the same site and by different routes of administration (e.g. injection and topical).
  • modified mRNAs encoding gC, gD, and gE are administered in separate compositions at the same site and by different routes of administration (e.g. injection and topical).
  • the methods of the present invention include a one-time or single administration of compositions comprising one or more nucleoside modified mRNAs of the present invention.
  • the methods of the present invention include administration of compositions comprising one or more nucleoside modified mRNAs in a prime and boost approach.
  • the methods of the present invention further comprise the step of administering to said subject one or more additional administrations of said nucleoside modified mRNA composition subsequent to the first administration.
  • the methods of the present invention comprise administering a composition comprising one or more nucleoside modified mRNAs encoding one or more HSV glycoproteins as a first administration and a composition comprising one or more HSV glycoproteins as a second or subsequent administration.
  • the HSV glycoproteins encoded by the mRNA in the first (or prime) administration are the same glycoproteins in the second or subsequent (or boost) administration.
  • a composition comprising one or more HSV glycoproteins is administered as a first administration
  • a composition comprising one or more nucleoside modified mRNAs encoding one or more HSV glycoproteins is administered as a second or subsequent administration.
  • modified mRNAs encoding gC, gD, and gE are administered simultaneously followed by a booster dose of modified mRNA encoding gD without modified mRNAs encoding gC or gE.
  • modified mRNAs encoding gC, gD, and gE are administered simultaneously followed by a booster dose of modified mRNA encoding gC without modified mRNAs encoding gD or gE.
  • modified mRNAs encoding gC, gD, and gE are administered simultaneously followed by a booster dose of modified mRNA encoding gE without modified mRNAs encoding gD or gC.
  • modified mRNAs encoding gC, gD, and gE are administered simultaneously followed by a booster dose of modified mRNAs encoding gC and gD without modified mRNAs encoding gE.
  • modified mRNAs encoding gC, gD, and gE are administered simultaneously followed by a booster dose of modified mRNAs encoding gC and gE without modified mRNAs encoding gD.
  • modified mRNAs encoding gC, gD, and gE are administered simultaneously followed by a booster dose of modified mRNAs encoding gD and gE without modified mRNAs encoding gE.
  • the booster administration is performed at the same site and by the same mode of administration as the priming administration. In another embodiment, the booster administration is performed at a different site from the priming administration but by the same mode of administration as the priming administration. In one embodiment the booster administration is performed at the same site but by different mode of administration than priming administration. In another embodiment, the booster administration is performed at a different site and by different mode of administration than priming administration.
  • the modified mRNA induces a detectably lower innate immune response than the same quantity of unmodified RNA having the same sequence.
  • the effectiveness of the compositions and methods of the present invention are dependent on the presence of complement, while in another embodiment, the compositions and methods of the present invention are not dependent on the presence of complement. In one embodiment, the effectiveness of some of the compositions for use in the methods of the present invention are dependent on the presence of complement, while others are not. In one embodiment, the anti-gC antibody is dependent on complement for its effectiveness against HSV.
  • complement is an important contributor to innate and acquired immunity.
  • complement activation facilitates virus neutralization by particle phagocytosis and lysis, functions as a chemoattractant for neutrophils and macrophages, and enhances B and T cell responses.
  • HSV-1 gC binds complement C3b and blocks C5 and properdin interaction with C3b, which inhibit complement activation and complement-mediated virus neutralization.
  • a gC-1 domain that interacts with complement is located within amino acids 33 to 133 and blocks C5 and properdin binding to C3b, and in one embodiment, a gC-1 domain that interacts with complement extends from amino acids 124 to 366 and directly binds C3b.
  • an HSV-1 gC mutant virus deleted in the C3b binding domain is more susceptible to complement-mediated virus neutralization in vitro and less virulent than wild-type (WT) virus in the mouse flank model. Therefore, in one embodiment, the interaction between gC-1 and C3b enhances HSV-1 virulence, and in one embodiment, blocking the gC- 1 domain is effective in preventing or treating HS V- 1 infection.
  • the compositions and methods of the present invention are for use in human subjects, while in another embodiment, they are for use in animal subjects.
  • the subject is mammalian.
  • the subject is any organism susceptible to infection by HSV.
  • the subject is murine, bovine, ovine, canine, feline, equine, porcine, etc.
  • the compositions and methods of the present invention are effective in male subjects.
  • the compositions and methods of the present invention are effective in female subjects.
  • the compositions and methods of the present invention are effective in seronegative subjects.
  • the compositions and methods of the present invention are effective in seropositive subjects.
  • a method of present invention further comprises mixing the modified mRNA with a transfection reagent prior to the step of contacting. In another embodiment, a method of present invention further comprises administering the modified mRNA together with the transfection reagent. In another embodiment, the transfection reagent is a cationic lipid reagent.
  • the transfection reagent is a lipid-based transfection reagent.
  • the transfection reagent is a protein-based transfection reagent.
  • the transfection reagent is a polyethyleneimine based transfection reagent.
  • the transfection reagent is calcium phosphate.
  • the transfection reagent is Lipofectin® or Lipofectamine®.
  • the transfection reagent is any other transfection reagent known in the art.
  • the transfection reagent forms a liposome.
  • Liposomes in another embodiment, increase intracellular stability, increase uptake efficiency and improve biological activity.
  • liposomes are hollow spherical vesicles composed of lipids arranged in a similar fashion as those lipids which make up the cell membrane. They have, in another embodiment, an internal aqueous space for entrapping water soluble compounds and range in size from 0.05 to several microns in diameter.
  • liposomes can deliver RNA to cells in a biologically active form (see Langer, Science 249: 1527- 1533 ( 1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 ( 1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid).
  • Each type of transfection reagent represents a separate embodiment of the present invention.
  • a modified mRNA of the present invention is encapsulated in a nanoparticle.
  • Methods for nanoparticle packaging are well known in the art, and are described, for example, in Bose S, et al (Role of Nucleolin in Human Parainfluenza Virus Type 3 Infection of Human Lung Epithelial Cells. J. Virol. 78: 8146. 2004); Dong Y et al. Poly(d,l-lactide-co- glycolide)/montmorillonite nanoparticles for oral delivery of anticancer drugs. Biomaterials 26:6068. 2005); Lobenberg R.
  • Nanoparticle packaging involves condensing and encapsulating RNA into particles that are smaller than the pore of the nuclear membrane, using chemicals including poly-L-lysine and polyethylene glycol.
  • RNA is packaged into one of four nanoparticle formulations (PEI, PLL, PAE, and CK 3 oPEGiok).
  • nanoparticles used in the compositions and methods of the present invention comprise lipid nanoparticles as described in Cullis, P., & Hope, M. (n.d.). Lipid Nanoparticle Systems for Enabling Gene Therapies. Molecular therapy., 25(7), which is incorporated by reference herein in its entirety.
  • delivery of nucleoside-modified RNA comprises any suitable delivery method, including exemplary RNA transfection methods described elsewhere herein.
  • delivery of a nucleoside-modified RNA to a subject comprises mixing the nucleoside-modified RNA with a transfection reagent prior to the step of contacting.
  • a method of present invention further comprises administering nucleoside-modified RNA together with the transfection reagent.
  • the transfection reagent is a cationic lipid reagent.
  • the transfection reagent is a lipid-based transfection reagent.
  • the transfection reagent is a protein-based transfection reagent.
  • the transfection reagent is a polyethyleneimine based transfection reagent.
  • the transfection reagent is calcium phosphate.
  • the transfection reagent is Lipofectin®, Lipofectamine®, or TransIT®.
  • the transfection reagent is any other transfection reagent known in the art.
  • the transfection reagent forms a liposome.
  • Liposomes in another embodiment, increase intracellular stability, increase uptake efficiency and improve biological activity.
  • liposomes are hollow spherical vesicles composed of lipids arranged in a similar fashion as those lipids which make up the cell membrane. They have, in another embodiment, an internal aqueous space for entrapping water- soluble compounds and range in size from 0.05 to several microns in diameter.
  • liposomes can deliver RNA to cells in a biologically active form.
  • the composition comprises a lipid nanoparticle (LNP) and one or more nucleic acid molecules described herein.
  • the composition comprises an LNP and one or more nucleoside-modified RNA molecules encoding one or more antigens, adjuvants, or a combination thereof.
  • lipid nanoparticle refers to a particle having at least one dimension on the order of nanometers (e.g., 1-1,000 nm) which includes one or more lipids, for example a lipid of Formula (I), (II) or (III), as described in WO2016176330A1, which is incorporated by reference herein in its entirety.
  • lipid nanoparticles are included in a formulation comprising a nucleoside-modified RNA as described herein.
  • such lipid nanoparticles comprise a cationic lipid and one or more excipient selected from neutral lipids, charged lipids, steroids and polymer conjugated lipids (e.g., a pegylated lipid such as a pegylated lipid of structure (IV), such as compound IVa).
  • the nucleoside-modified RNA is encapsulated in the lipid portion of the lipid nanoparticle or an aqueous space enveloped by some or all of the lipid portion of the lipid nanoparticle, thereby protecting it from enzymatic degradation or other undesirable effects induced by the mechanisms of the host organism or cells e.g. an adverse immune response.
  • the lipid nanoparticles have a mean diameter of from about 30 nm to about 150 nm, from about 40 nm to about 150 nm, from about 50 nm to about 150 nm, from about 60 nm to about 130 nm, from about 70 nm to about 110 nm, from about 70 nm to about 100 nm, from about 80 nm to about 100 nm, from about 90 nm to about 100 nm, from about 70 to about 90 nm, from about 80 nm to about 90 nm, from about 70 nm to about 80 nm, or about 30 nm, 35 nm, 40 nm, 45 nm, 50 nm, 55 nm, 60 nm, 65 nm, 70 nm, 75 nm, 80 nm, 85 nm, 90 nm, 95 nm, 100 nm, 105 nm, 110 nm, 115 n
  • the LNP may comprise any lipid capable of forming a particle to which the one or more nucleic acid molecules are attached, or in which the one or more nucleic acid molecules are encapsulated.
  • lipid refers to a group of organic compounds that are derivatives of fatty acids (e.g., esters) and are generally characterized by being insoluble in water but soluble in many organic solvents. Lipids are usually divided in at least three classes: (1) "simple lipids" which include fats and oils as well as waxes; (2) “compound lipids” which include phospholipids and glyco lipids; and (3) "derived lipids” such as steroids.
  • the LNP comprises one or more cationic lipids, and one or more stabilizing lipids.
  • Stabilizing lipids include neutral lipids and pegylated lipids.
  • the LNP comprises a cationic lipid.
  • cationic lipid refers to a lipid that is cationic or becomes cationic (protonated) as the pH is lowered below the pK of the ionizable group of the lipid, but is progressively more neutral at higher pH values. At pH values below the pK, the lipid is then able to associate with negatively charged nucleic acids.
  • the cationic lipid comprises a zwitterionic lipid that assumes a positive charge on pH decrease.
  • the cationic lipid comprises any of a number of lipid species which carry a net positive charge at a selective pH, such as physiological pH.
  • lipids include, but are not limited to, N,N-dioleyl-N,N-dimethylammonium chloride (DODAC); N-(2,3- dioleyloxy)propyl)-N,N,N-trimethylammonium chloride (DOTMA); N,N-distearyl-N,N- dimethylammonium bromide (DDAB); N-(2,3- dioleoyloxy)propyl)-N,N,N-trimethylammonium chloride (DOTAP); 3-(N— ( ⁇ ', ⁇ '- dimethylaminoethane)-carbamoyl)cholesterol (DC-Choi), N- (l-(2,3-dioleoyloxy)propyl)- N-2-(sperminecarboxamido)ethyl
  • DODAC N,N-
  • cationic lipids are available which can be used in the present invention. These include, for example, LIPOFECTIN® (commercially available cationic liposomes comprising DOTMA and l,2-dioleoyl-sn-3- phosphoethanolamine (DOPE), from GIBCO/BRL, Grand Island, N.Y.); LIPOFECTAMINE® (commercially available cationic liposomes comprising N-(l-(2,3- dioleyloxy)propyl)-N-(2- (sperminecarboxamido)ethyl)-N,N-dimethylammonium trifluoroacetate (DOSPA) and (DOPE), from GIBCO/BRL); and TRANSFECTAM® (commercially available cationic lipids comprising dioctadecylamidoglycyl carboxyspermine (DOGS) in ethanol from Promega Corp., Madison, Wis.). The following lipids are cationic lipids comprising dioc
  • DODAP DODMA
  • DMDMA l,2-dilinoleyloxy-N,N-dimethylaminopropane
  • DLenDMA 1 ,2-dilinolenyloxy-N,N-dimethylaminopropane
  • the cationic lipid is an amino lipid.
  • Suitable amino lipids useful in the invention include those described in WO 2012/016184, incorporated herein by reference in its entirety.
  • Representative amino lipids include, but are not limited to, l,2-dilinoleyoxy-3- (dimethylamino)acetoxypropane (DLin-DAC), l,2-dilinoleyoxy-3- morpholinopropane (DLin- MA), l,2-dilinoleoyl-3-dimethylaminopropane (DLinDAP), l,2-dilinoleylthio-3- dimethylaminopropane (DLin-S-DMA), l-linoleoyl-2-linoleyloxy-3- dimethylaminopropane (DLin-2-DMAP), l,2-dilinoleyloxy-3-trimethylaminopropane chloride salt (DLin-TMA.Cl), 1,2-dilino
  • the cationic lipid is present in the LNP in an amount from about 30 to about 95 mole percent. In one embodiment, the cationic lipid is present in the LNP in an amount from about 30 to about 70 mole percent. In one embodiment, the cationic lipid is present in the LNP in an amount from about 40 to about 60 mole percent. In one embodiment, the cationic lipid is present in the LNP in an amount of about 50 mole percent. In one embodiment, the LNPcomprises only cationic lipids. In certain embodiments, the L P comprises one or more additional lipids which stabilize the formation of particles during their formation.
  • Suitable stabilizing lipids include neutral lipids and anionic lipids.
  • neutral lipid refers to any one of a number of lipid species that exist in either an uncharged or neutral zwitterionic form at physiological pH.
  • Representative neutral lipids include diacylphosphatidylcho lines, diacylphosphatidylethanolamines, ceramides, sphingomyelins, dihydro sphingomyelins, cephalins, and cerebrosides.
  • Exemplary neutral lipids include, for example, distearoylphosphatidylcholine (DSPC), dioleoylphosphatidylcholine (DOPC), dipalmitoylphosphatidylcholine (DPPC), dioleoylphosphatidylglycerol (DOPG), dipalmitoylphosphatidylglycerol (DPPG), dioleoyl- phosphatidylethanolamine (DOPE), palmitoyloleoylphosphatidylcholine (POPC), palmitoyloleoyl-phosphatidylethanolamine (POPE) and dioleoyl-phosphatidylethanolamine 4-(N- maleimidomethyl)-cyclohexane-l- carboxylate (DOPE-mal), dipalmitoyl phosphatidyl ethanolamine (DPPE), dimyristoylphosphoethanolamine (DMPE), distearoyl- phosphatidylethanolamine
  • the neutral lipid is 1,2-distearoyl-sn- glycero-3- phosphocholine (DSPC).
  • the LNPs comprise a neutral lipid selected from DSPC, DPPC, DMPC, DOPC, POPC, DOPE and SM.
  • the molar ratio of the cationic lipid (e.g., lipid of Formula (I)) to the neutral lipid ranges from about 2 : 1 to about 8: 1.
  • the LNPs further comprise a steroid or steroid analogue.
  • the steroid or steroid analogue is cholesterol.
  • the molar ratio of the cationic lipid (e.g., lipid of Formula (I)) to cholesterol ranges from about 2: 1 to 1: 1.
  • anionic lipid refers to any lipid that is negatively charged at physiological pH. These lipids include phosphatidylglycerol, cardiolipin, diacylphosphatidylserine, diacylphosphatidic acid, N- dodecanoylphosphatidylethanolamines, N- succinylphosphatidylethanolamines, N- glutarylphosphatidylethanolamines, lysylphosphatidylglycerols, palmitoyloleyolphosphatidylglycerol (POPG), and other anionic modifying groups joined to neutral lipids.
  • phosphatidylglycerol cardiolipin
  • diacylphosphatidylserine diacylphosphatidic acid
  • N- dodecanoylphosphatidylethanolamines N- succinylphosphatidylethanolamines
  • N- glutarylphosphatidylethanolamines N- glutarylphosphatidylethanolamines
  • the LNP comprises glycolipids (e.g., monosialoganglioside GMi). In certain embodiments, the LNP comprises a sterol, such as cholesterol.
  • the LNPs comprise a polymer conjugated lipid.
  • polymer conjugated lipid refers to a molecule comprising both a lipid portion and a polymer portion.
  • An example of a polymer conjugated lipid is a pegylated lipid.
  • pegylated lipid refers to a molecule comprising both a lipid portion and a polyethylene glycol portion. Pegylated lipids are known in the art and include l-(monomethoxy-polyethyleneglycol)-2,3- dimyristoylglycerol (PEG-s- DMG) and the like.
  • the LNP comprises an additional, stabilizing - lipid which is a polyethylene glycol-lipid (pegylated lipid).
  • Suitable polyethylene glycol- lipids include PEG- modified phosphatidylethanolamine, PEG-modified phosphatidic acid, PEG-modified ceramides (e.g., PEG-CerC14 or PEG-CerC20), PEG-modified dialkylamines, PEG-modified diacylglycerols, PEG-modified dialkylglycerols.
  • Representative polyethylene glycol-lipids include PEG-c-DOMG, PEG-c-DMA, and PEG-s-DMG.
  • the polyethylene glycol-lipid is N-[(methoxy poly(ethylene glycol)20oo)carbamyl]-l,2-dimyristyloxlpropyl-3-amine (PEG-c-DMA).
  • the polyethylene glycol-lipid is PEG-c-DOMG).
  • the LNPs comprise a pegylated diacylglycerol (PEG-DAG) such as l-(monomethoxy-polyethyleneglycol)-2,3- dimyristoylglycerol (PEG-DMG), a pegylated phosphatidylethanoloamine (PEG-PE), a PEG succinate diacylglycerol (PEG-S-DAG) such as 4-0-(2',3'-di(tetradecanoyloxy)propyl-l-0-(co- methoxy(polyethoxy)ethyl)butanedioate (PEG-S-DMG), a pegylated ceramide (PEG- cer), or a PEG dialkoxypropylcarbamate such as Q-methoxy(polyethoxy)ethyl-N-(2,3- di(tetradecanoxy)propyl)carbamate or 2,3-di
  • the additional lipid is present in the LNP in an amount from about 1 to about 10 mole percent. In one embodiment, the additional lipid is present in the LNP in an amount from about 1 to about 5 mole percent. In one embodiment, the additional lipid is present in the LNP in about 1 mole percent or about 1.5 mole percent.
  • the LNP comprises one or more targeting moieties which are capable of targeting the LNP to a cell or cell population.
  • the targeting moiety is a ligand which directs the LNP to a receptor found on a cell surface.
  • the LNP comprises one or more internalization domains.
  • the LNP comprises one or more domains which bind to a cell to induce the internalization of the LNP.
  • the one or more internalization domains bind to a receptor found on a cell surface to induce receptor-mediated uptake of the LNP.
  • the LNP is capable of binding a biomolecule in vivo, where the LNP-bound biomolecule can then be recognized by a cell-surface receptor to induce internalization.
  • the LNP binds systemic ApoE, which leads to the uptake of the LNP and associated cargo.
  • methods of the present invention comprise administering a modified mRNAs encoding HSV glycoprotein and a pharmaceutically acceptable carrier or diluent.
  • pharmaceutically acceptable carriers for liquid formulations may be aqueous or non-aqueous solutions, suspensions, emulsions or oils. Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, and injectable organic esters such as ethyl oleate.
  • Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
  • oils are those of petroleum, animal, vegetable, or synthetic origin, for example, peanut oil, soybean oil, mineral oil, olive oil, sunflower oil, and fish-liver oil.
  • the pharmaceutical compositions provided herein are controlled- release compositions, i.e. compositions in which the compound is released over a period of time after administration.
  • Controlled- or sustained-release compositions include formulation in lipophilic depots (e.g. fatty acids, waxes, oils).
  • the composition is an immediate -release composition, i.e. a composition in which the entire compound is released immediately after administration.
  • the present invention provides a kit comprising a reagent utilized in performing a method of the present invention.
  • the present invention provides a kit comprising a composition, tool, or instrument of the present invention.
  • Modified mRNA expressing HSV-2 glycoproteins C, D and E (gC2/gD2/gE2) ectodomains.
  • Modified mRNA (encoding gC2 (SEQ ID NO: 10), encoding gD2 (SEQ ID NO: 4), and encoding gE2 (SEQ ID NO: 16)) was prepared based on the DNA coding sequences that encode HSV-2 glycoprotein C (gC2) amino acids 27-426 from HSV-2 strain 333 (SEQ ID NO: 11), glycoprotein D (gD2) amino acids 26-331 from HSV-2 strain 333 (SEQ ID NO: 5), and glycoprotein E (gE2) amino acids 24-405 from HSV-2 strain 2.12 (SEQ ID NO: 17).
  • the modified mRNA was incorporated into liposomal nanoparticles (LNP) by Acuitas Therapeutics to prepare the following immunogens: (a) Poly C mRNA in LNP; (b) gC2 modified mRNA in LNP; (c) gD2 modified mRNA in LNP; (d) gE2 modified mRNA in LNP; (e) gC2 & gD2 & gE2 modified mRNA in LNP.
  • LNP liposomal nanoparticles
  • Controls Poly C group: Poly C mRNA/LNP divided into 4 aliquots and administered at 4 separate sites.
  • gD2 alone ⁇ Q ig gD2 mRNA/LNP divided into 4 aliquots and administered at 4 separate sites.
  • Trivalent-I group 10ug gC2 mRNA/LNP, 10ug gD2 mRNA/LNP, 10 ⁇ g gE2 mRNA/LNP each divided into 2 aliquots and each given at 2 sites.
  • Trivalent-C group 10ug gC2 mRNA & 10ug gD2 mRNA & 10 ⁇ g gE2 mRNA combined into LNP and divided into 4 aliquots and given at 4 sites.
  • mice Twenty-eight days after the second immunization, mice were treated subcutaneously with 2mg Depo-Provera and 5 days later infected intravaginally with 5xl0 3 PFU HSV-2 strain MS (-400 LD50). On days 2 and 4 post-challenge, vaginal swabs were obtained for virus cultures. On day 4 post-challenge, some mice in each vaccine group were sacrificed and dorsal root ganglia (DRG) excised for HSV-2 DNA qPCR. The remaining animals were evaluated for weight loss and hind limb weakness for 10 days while survival and genital disease were monitored for 28 days.
  • DDG dorsal root ganglia
  • EXAMPLE 2 CHARACTERIZATION OF TRANSLATIONAL PRODUCTS PRODUCED BY gC2, gP2, AND gE2 MODIFIED MRNA
  • modified mRNA to express proteins of the expected molecular weight when transfected into mammalian cells was verified. O. ⁇ g of gC2-, gD2-, or gE2-modified mRNA was transfected into 293T cells using TransIT-mRNA (Mirus Bio LLC) for the transfection. Eighteen hours later, cells were harvested and extracts prepared for Western blots. The mRNAs were designed to express the ectodo mains of gC2, gD2 and gE2 (labeled mRNA-ecto).
  • EXAMPLE 3 ELISA ANTIBODY RESPONSES IN SUBJECTS IMMUNIZED WITH gD2 OR TRIVALENT MODIFIED MRNA VACCINES
  • ELISA endpoint titers were evaluated on sera taken 28 days after the first and second immunizations. Immunization groups were as follows: Poly C (10 ⁇ g Poly C mRNA/LNP divided into 4 aliquots and administered at 4 separate sites) (control); gD2 (10 ⁇ g gD2 mRNA/LNP divided into 4 aliquots and administered at 4 separate sites); Trivalent-I (10 ⁇ g gC2 mRNA/LNP, 10 ⁇ g gD2 mRNA/LNP, l( ⁇ g gE2 mRNA/LNP each divided into 2 aliquots and each given at 2 sites); and Trivalent-C (10ug gC2 mRNA & 10ug gD2 mRNA & 10 ⁇ g gE2 mRNA combined into LNP and divided into 4 aliquots and given at 4 sites).
  • the second immunization significantly boosted the ELISA titers compared to the first.
  • the differences between the titers in the second vs the first immunizations were significant, p ⁇ 0.05 (t-tests, comparing the antibody titers after the first and second immunization).
  • Serum was obtained 28 days after the second immunization, and neutralizing antibody titers were determined using serial 2-fold dilutions of serum, starting at a 1:25 dilution and 10% human serum as a source of complement.
  • the human serum was obtained from an individual seronegative for HSV-1 and HSV-2.
  • the modified mRNA groups were each significantly different from the poly C controls (p ⁇ 0.001 ; Figure 4). While each of the mRNA groups was not significantly different from one another, the trivalent vaccine given as a combined immunogen (Trivalent-C) performed the best of the three mRNA groups ( Figure 4).
  • CD4 + T cells The modified mRNA-expressed gC2, gD2, and gE2 subunit antigens each stimulated polyfunctional CD4 + T cell responses ( Figures 5A-5B). Splenocytes harvested from immunized subjects and then stimulated with subunit antigen glycoproteins increased polyfunctional CD4 + T cell responses ( Figure 5A). Splenocytes harvested from immunized subjects and then stimulated with 15 amino acid overlapping peptides increased polyfunctional CD4 + T cell responses and IFNy responses ( Figure 5B).
  • CD8 + T cells Only gE peptide pool 2 stimulated a significant IFNy CD8 + T cell response ( Figure 6B).
  • EXAMPLE 7 SURVIVAL. WEIGHT LOSS AND NEUROLOGICAL SIGNS AFTER MODIFIED MRNA IMMUNIZATION AND INTRA VAGINAL CHALLENGE
  • Figure 7B demonstrates that administration of the modified mRNA vaccine twice at 28 day intervals and challenged intravaginally with HSV-2 does not result in neurological signs or weight loss. Control subjects that were not administered the vaccine and were and challenged intravaginally with HSV-2 showed weight loss and neurological signs.
  • mice immunized with the modified mRNA survived and showed no evidence of weight loss, neurological disease or genital lesions after intravaginal challenge with -400 LD50 of HSV-2.
  • day 2 and day 4 vaginal titers after challenge were negative in mice immunized with the trivalent mRNA whether given at separate sites or as a combined immunization. No significant differences were detected comparing either trivalent group with gD2 alone, although both trivalent groups outperformed the gD2 alone group, as 3 of 10 mice in the gD2 group had virus isolated from vaginal swabs.
  • DRG Dorsal root ganglia
  • Modified mRNA vaccines expressing gD2 alone or gC2, gD2 and gE2 provided outstanding protection against HSV-2 genital challenge.
  • the expression of the three proteins slightly outperformed gD2 based on day 2 and day 4 titers after challenge and the lower number of animals with HSV-2 DNA detected in DRG on day 4.
  • BALB/c female mice were left un-immunized as naive control animals or immunized intradermally twice at 28 day intervals with poly C mRNA-LNP or trivalent modified mRNA- LNP.
  • the poly C mRNA controls received 10 ⁇ g Poly C mRNA-LNP divided into 4 aliquots and administered at 4 separate sites.
  • the trivalent modified mRNA group received 10 ⁇ g gC2 mRNA- LNP, ⁇ gD2 mRNA-LNP, and ⁇ gE2 mRNA-LNP each divided into 2 aliquots and each given at 2 sites.
  • Tfollicular helper (Tfh) cells Two weeks after the second immunization, spleens were harvested from 5 animals per group and flow cytometry performed to detect T follicular helper (Tfh) cells (Figure 11A; *p ⁇ 0.05) and germinal center B cell responses (Figure 11B; *p ⁇ 0.05).
  • mice were immunized intradermally twice at 28 day intervals with 10 ⁇ g of ploy C mRNA-LNP, 10ug gD2 mRNA-LNP or ⁇ g each of gC2, gD2, gE trivalent modified mRNA- LNP.
  • the trivalent rnRNA was combined and administered as l( ⁇ g gC2 mRNA & l( ⁇ g gD2 mRNA & l( ⁇ g gE2 mRNA combined into LNP and divided into 4 aliquots and given at 4 sites.
  • 60 ⁇ 1 of media was introduced in the vaginal cavity and retrieved.
  • EXAMPLE 13 ANTIBODIES TO gC2 PRODUCED BY TRIVALENT MRNA IMMUNIZATION OF MICE BLOCK IMMUNE EVASION DOMAINS ON gC2
  • BALB/c mice were left unimmunized as a source of non-immune IgG, or immunized intradermally with poly C mRNA-LNP or trivalent mRNA-LNP.
  • the poly C mRNA controls received 10 ⁇ g poly C mRNA-LNP divided into 4 aliquots and administered at 4 separate sites.
  • the gD2 mRNA group received 10 ⁇ g gD2 mRNA-LNP administered as described for the poly C mRNA-LNP.
  • the trivalent modified mRNA group received ⁇ gC2 mRNA-LNP, ⁇ gD2 mRNA-LNP, and 10 ⁇ g gE2 mRNA-LNP combined into one LNP and divided into 4 aliquots and given at 4 sites. There were 10 mice in each group. Sera from the 10 mice were pooled and IgG was purified. The IgG was evaluated at 12 ⁇ g/200 ⁇ l for its ability to block complement component C3b binding to gC2. This blocking assay is used to assess whether antibodies produced by immunization block the immune evasion properties of gC2.
  • Non-immune murine IgG, IgG from the poly C mRNA group, and IgG from the gD2 mRNA group each failed to block gC2 binding to C3b.
  • IgG from trivalent mRNA-immunized animals totally blocked the interaction between gC2 and C3b ( Figure 13, ****p ⁇ 0.0001).
  • mice were treated with medroxyprogesterone and five days later infected intravaginally with 5xl0 4 PFU HSV-2 strain MS (2,000 LD50).
  • mice were infected with HSV-2 at a dose that was 10-fold higher than used in earlier experiments described herein ( Figures 7-10). Protection of the mice remained outstanding even at this higher titer challenge. We achieved sterilizing immunity in all five mice as determined by no deaths, no genital disease, negative vaginal virus titers on days 2 and 4 postinfection and no HSV-2 DNA in the lumbosacral DRG on day 28 (Table 1).
  • mice were immunized intramuscularly with poly C mRNA-LNP as a control (15/group) or with trivalent mRNA containing 10 ⁇ g each of gC2, gD2 and gE2 mRNA-LNP (20/group). All poly C control animals died by day 12, while all animals in the trivalent mRNA group survived ( Figure 14A). No weight loss occurred in the trivalent mRNA group, while the poly C control animals lost >15% of body weight ( Figure 14B). The poly C group developed extensive genital disease, while the trivalent mRNA animals had no genital disease ( Figure 14C).
  • DRG were harvested from nine poly C animals at the time of euthanasia between days 7 and 12 post-infection or at the end of the experiment on day 28 in the trivalent mRNA group. All animals in the poly C group had HSV-2 DNA detected in DRG, while none were positive for HSV-2 DNA in trivalent mRNA group ( Figure 14D). Day 2 ( Figure 14E) and Day 4 ( Figure 14F) vaginal viral cultures were positive in all 15 animals in the poly C group, while cultures were negative in all 20 animals in the trivalent mRNA group. Differences between poly C and trivalent groups are significant, p ⁇ 0.001 for each figure ( Figures 14A-14F).
  • Trivalent modified mRNA-LNP provides outstanding protection in mice when administered intramuscularly.
  • EXAMPLE 16 SUMMARY COMPARISON OF IMMUNIZATION WITH TRIVALENT mRNA-LNP AND TRIVALENT SUBUNIT ANTIGEN CPG/ALUM IN
  • mice that were immunized either intradermally or intramuscularly with trivalent mRNA containing 10 ⁇ g each of gC2, gD2 and gE2 mRNA-LNP (total 64 mice studied).
  • mice were immunized twice at 28-day intervals with trivalent mRNA-LNP and three times at 14-day intervals with subunit antigens, as we have done in prior experiments.
  • the mRNA and subunit antigen experiments were performed at the same time.
  • Table 2 demonstrate significant superiority of the trivalent mRNA-LNP vaccine over the trivalent subunit antigen vaccine in many immune response parameters, and most importantly in vaccine efficacy.
  • the trivalent mRNA-LNP vaccine achieved sterilizing immunity in 63/64 (98%) of mice compared to 15/20 (75%) in the subunit antigen group.
  • EXAMPLE 17 EVALUATION OF THE TRIVALENT MRNA-LNP VACCINE IN
  • the poly C animals had genital lesions on a mean of 3.7 days during the recurrent phase of infection from days 15-60, with 2/3 animals developing recurrent genital lesions (Figure 15C).
  • the trivalent immunized guinea pigs and the naive (uninfected) animals had no recurrent genital lesions ( Figure 15C).
  • Trivalent modified mRNA-LNP provided outstanding protection against acute and recurrent genital lesions in guinea pigs.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biotechnology (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Reproductive Health (AREA)
  • Communicable Diseases (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Mycology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Plant Pathology (AREA)
  • Gynecology & Obstetrics (AREA)
  • Urology & Nephrology (AREA)
  • Physics & Mathematics (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/IB2018/056210 2017-08-17 2018-08-17 MODIFIED MHRNA VACCINES ENCODING HERPES SIMPLEX VIRUS GLYCOPROTEINS AND USES THEREOF Ceased WO2019035066A1 (en)

Priority Applications (14)

Application Number Priority Date Filing Date Title
EP23169155.1A EP4242223A3 (en) 2017-08-17 2018-08-17 Modified mrna vaccines encoding herpes simplex virus glycoproteins and uses thereof
EP18846061.2A EP3668520A4 (en) 2017-08-17 2018-08-17 Modified mrna vaccines encoding herpes simplex virus glycoproteins and uses thereof
CN201880068068.XA CN111246854A (zh) 2017-08-17 2018-08-17 编码单纯疱疹病毒糖蛋白的修饰mrna疫苗及其用途
CN202410526392.9A CN118370812A (zh) 2017-08-17 2018-08-17 编码单纯疱疹病毒糖蛋白的修饰mrna疫苗及其用途
AU2018316811A AU2018316811B2 (en) 2017-08-17 2018-08-17 Modified mRNA vaccines encoding herpes simplex virus glycoproteins and uses thereof
CA3073161A CA3073161A1 (en) 2017-08-17 2018-08-17 Modified mrna vaccines encoding herpes simplex virus glycoproteins and uses thereof
JP2020509054A JP7386535B2 (ja) 2017-08-17 2018-08-17 単純ヘルペスウイルス糖タンパク質をコードする修飾mRNAワクチン及びその使用
US16/640,008 US11141478B2 (en) 2017-08-17 2018-08-17 Modified mRNA vaccines encoding herpes simplex virus glycoproteins and uses thereof
US17/349,929 US11793872B2 (en) 2017-08-17 2021-06-17 Modified MRNA vaccines encoding herpes simplex virus glycoproteins and uses thereof
US18/365,166 US20240016922A1 (en) 2017-08-17 2023-08-03 Rna vaccines encoding herpes simplex virus glycoproteins and uses thereof
JP2023138084A JP7674760B2 (ja) 2017-08-17 2023-08-28 単純ヘルペスウイルス糖タンパク質をコードする修飾mRNAワクチン及びその使用
US18/470,325 US20240024463A1 (en) 2017-08-17 2023-09-19 Modified mrna vaccines encoding herpes simplex virus glycoproteins and uses thereof
AU2023248194A AU2023248194A1 (en) 2017-08-17 2023-10-13 Modified MRNA vaccines encoding herpes simplex virus glycoproteins and uses thereof
JP2025069088A JP2025108645A (ja) 2017-08-17 2025-04-18 単純ヘルペスウイルス糖タンパク質をコードする修飾mRNAワクチン及びその使用

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762546648P 2017-08-17 2017-08-17
US62/546,648 2017-08-17
US201862701019P 2018-07-20 2018-07-20
US62/701,019 2018-07-20

Related Child Applications (3)

Application Number Title Priority Date Filing Date
US16/640,008 A-371-Of-International US11141478B2 (en) 2017-08-17 2018-08-17 Modified mRNA vaccines encoding herpes simplex virus glycoproteins and uses thereof
US17/349,929 Continuation US11793872B2 (en) 2017-08-17 2021-06-17 Modified MRNA vaccines encoding herpes simplex virus glycoproteins and uses thereof
US17/349,929 Continuation-In-Part US11793872B2 (en) 2017-08-17 2021-06-17 Modified MRNA vaccines encoding herpes simplex virus glycoproteins and uses thereof

Publications (1)

Publication Number Publication Date
WO2019035066A1 true WO2019035066A1 (en) 2019-02-21

Family

ID=65362983

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2018/056210 Ceased WO2019035066A1 (en) 2017-08-17 2018-08-17 MODIFIED MHRNA VACCINES ENCODING HERPES SIMPLEX VIRUS GLYCOPROTEINS AND USES THEREOF

Country Status (7)

Country Link
US (3) US11141478B2 (enExample)
EP (2) EP4242223A3 (enExample)
JP (3) JP7386535B2 (enExample)
CN (2) CN111246854A (enExample)
AU (2) AU2018316811B2 (enExample)
CA (1) CA3073161A1 (enExample)
WO (1) WO2019035066A1 (enExample)

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20200054737A1 (en) * 2017-04-26 2020-02-20 Modema TX, Inc. Herpes simplex virus vaccine
WO2022002783A1 (en) * 2020-06-29 2022-01-06 Glaxosmithkline Biologicals Sa Adjuvants
WO2022074358A1 (en) 2020-10-08 2022-04-14 Virokine Therapeutics Limited Vaccine compositions
WO2022165313A1 (en) 2021-02-01 2022-08-04 Regenxbio Inc. Gene therapy for neuronal ceroid lipofuscinoses
WO2022189634A1 (en) * 2021-03-11 2022-09-15 Redbiotec Ag Vaccine compositions and methods for treating hsv
US20230114808A1 (en) * 2019-03-12 2023-04-13 BioNTech SE Therapeutic rna for prostate cancer
EP4242223A2 (en) 2017-08-17 2023-09-13 The Trustees of The University of Pennsylvania Modified mrna vaccines encoding herpes simplex virus glycoproteins and uses thereof
WO2024163918A1 (en) 2023-02-02 2024-08-08 University Of Houston System Mrna vaccine for herpes simplex virus
WO2024249967A1 (en) * 2023-06-02 2024-12-05 The Trustees Of The University Of Pennsylvania Rna vaccines encoding herpes simplex virus glycoproteins and uses thereof
WO2025030134A1 (en) 2023-08-03 2025-02-06 The Trustees Of The University Of Pennsylvania Rna compositions encoding herpes simplex virus glycoprotein e and/or glycoprotein i antigens and uses thereof
WO2025030103A1 (en) 2023-08-03 2025-02-06 The Trustees Of The University Of Pennsylvania Rna compositions encoding herpes simplex virus glycoprotein b antigens and uses thereof
WO2025030165A1 (en) * 2023-08-03 2025-02-06 BioNTech SE Pharmaceutical compositions for delivery of herpes simplex virus antigens and related methods
WO2025030097A3 (en) * 2023-08-03 2025-03-06 BioNTech SE Pharmaceutical compositions for delivery of herpes simplex virus antigens and related methods

Families Citing this family (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN111568856B (zh) * 2020-06-24 2021-07-06 珠海舒桐医疗科技有限公司 一种阴道凝胶制剂及其制备方法
US12419948B2 (en) 2020-08-31 2025-09-23 The Broad Institute, Inc. Immunogenic compositions and use thereof
EP4032547A1 (en) * 2021-01-20 2022-07-27 GlaxoSmithKline Biologicals S.A. Hsv1 fce derived fragements for the treatment of hsv
EP4032546A1 (en) * 2021-01-20 2022-07-27 GlaxoSmithKline Biologicals S.A. Therapeutic viral vaccine
CN118217388A (zh) * 2022-12-19 2024-06-21 南京奥罗生物科技有限公司 单纯疱疹病毒疫苗及其应用
TW202434263A (zh) * 2023-01-27 2024-09-01 德商拜恩技術股份公司 用於遞送單純疱疹病毒醣蛋白c、醣蛋白d、及醣蛋白e抗原之醫藥組成物及相關方法
WO2025072383A1 (en) 2023-09-25 2025-04-03 The Broad Institute, Inc. Viral open reading frames, uses thereof, and methods of detecting the same
WO2025097055A2 (en) 2023-11-02 2025-05-08 The Broad Institute, Inc. Compositions and methods of use of t cells in immunotherapy
WO2025109008A1 (en) 2023-11-20 2025-05-30 Redbiotec Ag Novel vaccine compositions and methods for treating hsv
WO2025129158A1 (en) 2023-12-15 2025-06-19 The Broad Institute, Inc. Engineered arc delivery vesicles and uses thereof
WO2025175124A1 (en) * 2024-02-15 2025-08-21 Albert Einstein College Of Medicine Recombinant herpes simplex virus glycoprotein b for treatment and prevention of herpes simplex virus infections
WO2025212831A1 (en) * 2024-04-03 2025-10-09 The Trustees Of The University Of Pennsylvania Methods of inducing an anti-hsv b-cell immune response

Citations (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995026204A1 (en) 1994-03-25 1995-10-05 Isis Pharmaceuticals, Inc. Immune stimulation by phosphorothioate oligonucleotide analogs
WO2012016184A2 (en) 2010-07-30 2012-02-02 Alnylam Pharmaceuticals, Inc. Methods and compositions for delivery of active agents
US8278036B2 (en) 2005-08-23 2012-10-02 The Trustees Of The University Of Pennsylvania RNA containing modified nucleosides and methods of use thereof
US20120276209A1 (en) 2009-11-04 2012-11-01 The University Of British Columbia Nucleic acid-containing lipid particles and related methods
US20120328658A1 (en) * 2006-07-20 2012-12-27 The University Of Washington Compositions and methods for vaccinating against hsv-2
US20130028925A1 (en) 2006-12-28 2013-01-31 Harvey Friedman Herpes simplex virus combined subunit vaccines and methods of use thereof
WO2016176330A1 (en) 2015-04-27 2016-11-03 The Trustees Of The University Of Pennsylvania Nucleoside-modified rna for inducing an adaptive immune response
WO2017070616A2 (en) * 2015-10-22 2017-04-27 Modernatx, Inc. Sexually transmitted disease vaccines

Family Cites Families (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9284355B2 (en) * 2006-12-28 2016-03-15 The Trustees Of The University Of Pennsylvania Herpes simplex virus combined subunit vaccines and methods of use thereof
AU2010249330B2 (en) * 2009-05-22 2015-11-05 Genocea Biosciences Inc. Vaccines against Herpes Simplex Virus type 2: compositions and methods for eliciting an immune response
US9192661B2 (en) * 2010-07-06 2015-11-24 Novartis Ag Delivery of self-replicating RNA using biodegradable polymer particles
US9770463B2 (en) * 2010-07-06 2017-09-26 Glaxosmithkline Biologicals Sa Delivery of RNA to different cell types
SI2850431T1 (en) * 2012-05-16 2018-08-31 Immune Design Corp. Vaccines for hsv-2
WO2015089340A1 (en) * 2013-12-11 2015-06-18 The Henry M. Jackson Foundation For The Advancement Of Military Medicine, Inc. Human herpesvirus trimeric glycoprotein b, protein complexes comprising trimeric gb and their use as vaccines
DK3142750T3 (da) * 2014-05-13 2020-09-14 Univ Pennsylvania Sammensætninger omfattende aav, som udtrykker dobbelt-antistofkonstrukter og anvendelser deraf
CA2962639A1 (en) * 2014-10-01 2016-04-07 Jingang Medicine (Australia) Pty Ltd Therapeutic compositions and methods for inducing an immune response to herpes simplex virus type 2 (hsv-2)
US10758694B2 (en) 2015-07-09 2020-09-01 Hoyt Medical LLC Systems and methods for treating an airway using a tapered adapter device
BR112018008090A2 (pt) 2015-10-22 2018-11-13 Modernatx Inc vacina de vírus do herpes simplex.
IL317855A (en) * 2016-10-26 2025-02-01 Acuitas Therapeutics Inc mRNA vaccines with lipid nanoparticles
US20200054737A1 (en) 2017-04-26 2020-02-20 Modema TX, Inc. Herpes simplex virus vaccine
AU2018316811B2 (en) 2017-08-17 2023-07-13 The Trustees Of The University Of Pennsylvania Modified mRNA vaccines encoding herpes simplex virus glycoproteins and uses thereof

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1995026204A1 (en) 1994-03-25 1995-10-05 Isis Pharmaceuticals, Inc. Immune stimulation by phosphorothioate oligonucleotide analogs
US5663153A (en) 1994-03-25 1997-09-02 Isis Pharmaceuticals, Inc. Immune stimulation by phosphorothioate oligonucleotide analogs
US5723335A (en) 1994-03-25 1998-03-03 Isis Pharmaceuticals, Inc. Immune stimulation by phosphorothioate oligonucleotide analogs
US8278036B2 (en) 2005-08-23 2012-10-02 The Trustees Of The University Of Pennsylvania RNA containing modified nucleosides and methods of use thereof
US20120328658A1 (en) * 2006-07-20 2012-12-27 The University Of Washington Compositions and methods for vaccinating against hsv-2
US20130028925A1 (en) 2006-12-28 2013-01-31 Harvey Friedman Herpes simplex virus combined subunit vaccines and methods of use thereof
US20120276209A1 (en) 2009-11-04 2012-11-01 The University Of British Columbia Nucleic acid-containing lipid particles and related methods
WO2012016184A2 (en) 2010-07-30 2012-02-02 Alnylam Pharmaceuticals, Inc. Methods and compositions for delivery of active agents
WO2016176330A1 (en) 2015-04-27 2016-11-03 The Trustees Of The University Of Pennsylvania Nucleoside-modified rna for inducing an adaptive immune response
WO2017070616A2 (en) * 2015-10-22 2017-04-27 Modernatx, Inc. Sexually transmitted disease vaccines

Non-Patent Citations (29)

* Cited by examiner, † Cited by third party
Title
"GenBank", Database accession no. YP _009137218.1
AKINC ET AL., MOL THER., vol. 18, no. 7, 2010, pages 1357 - 1364
BASHA ET AL., MOL THER, vol. 19, no. 12, 2011, pages 2186 - 2200
BELLIVEAU ET AL., MOL THER NUCLEIC ACIDS, vol. 1, 2012, pages e37
BONKOWSKY JL ET AL.: "Herpes simplex virus central nervous system relapse during treatment of infantile spasms with corticotropin", PEDIATRICS, vol. 117, no. 5, May 2006 (2006-05-01), pages e1045 - 8
BOSE S ET AL.: "Role of Nucleolin in Human Parainfluenza Virus Type 3 Infection of Human Lung Epithelial Cells", J. VIROL., vol. 78, 2004, pages 8146
DONG Y ET AL.: "Poly(d,l-lactide-co-glycolide)/montmorillonite nanoparticles for oral delivery of anticancer drugs", BIOMATERIALS, vol. 26, 2005, pages 6068, XP025280162, DOI: 10.1016/j.biomaterials.2005.03.021
FRUSCOLONI ET AL., PNAS, vol. 100, 2002, pages 1639
JAYARAMAN ET AL., ANGEW CHEM INT ED ENGL., vol. 51, no. 34, 2012, pages 8529 - 8533
KHAN OA ET AL.: "Herpes encephalitis presenting as mild aphasia: case report", BMC FAM PRACT., vol. 7, no. 22, 24 March 2006 (2006-03-24)
KIELYTKA, JW ET AL.: "Probing RNA Hairpins with Cobalt(III)hexammine and Electrospray Ionization Mass Spectrometry", JOURNAL OF THE AMERICAN SOCIETY OF MASS SPECTROMETRY, vol. 17, no. 10, 9 August 2006 (2006-08-09), pages 1376 - 1383, XP005670439 *
LANGER, SCIENCE, vol. 249, 1990, pages 1527 - 1533
LEE ET AL., INT J CANCER, vol. 131, no. 5, 2012, pages E781 - 90
LEUNG ET AL., J PHYS CHEM C NANOMATER INTERFACES, vol. 116, no. 34, 2012, pages 18440 - 18450
LOBENBERG R ET AL.: "Improved body distribution of 14C-labelled AZT bound to nanoparticles in rats determined by radioluminography", J DRUG TARGET, vol. 5, no. 171, 1998
MAIER ET AL., MOL THER, vol. 21, no. 8, 2013, pages 1570 - 1578
MUI ET AL., MOL THER NUCLEIC ACIDS, vol. 2, 2013, pages el39
NAGOT N ET AL.: "Reduction of HIV-1 RNA levels with therapy to suppress herpes simplex virus", N ENGL J MED., vol. 356, no. 8, 22 February 2007 (2007-02-22), pages 790 - 9, XP002509748, DOI: 10.1056/NEJMoa062607
NGOSUWAN JWANG N M ET AL.: "Roles of cytosolic Hsp70 and Hsp40 molecular chaperones in post-translational translocation of pre-secretory proteins into the endoplasmic reticulum", J BIOL CHEM, vol. 278, no. 9, 2003, pages 7034 - 42
OUEDRAOGO A ET AL.: "Impact of suppressive herpes therapy on genital HIV-1 RNA among women taking antiretroviral therapy: a randomized controlled trial", AIDS, vol. 20, no. 18, 28 November 2006 (2006-11-28), pages 2305 - 13
PARDI, N ET AL.: "Administration of nucleoside-modified mRNA encoding broadly neutralizing antibody protects humanized mice from HIV-1 challenge", NATURE COMMUNICATIONS, vol. 8, no. 14630, 2 March 2017 (2017-03-02), pages 2, XP055410616 *
SAKUMA S R ET AL.: "Mucoadhesion of polystyrene nanoparticles having surface hydrophilic polymeric chains in the gastrointestinal tract", INT J PHARM, vol. 177, no. 161, 1999
SEMPLE ET AL., NAT BIOTECHNOL., vol. 28, no. 2, 2010, pages 172 - 176
SHEDLOCKWEINER, J LEUKOCYTE BIOL, vol. 68, 2000
TARN ET AL., NANOMEDICINE, vol. 9, no. 5, 2013, pages 665 - 74
TREAT ET AL.: "Liposomes in the Therapy of Infectious Disease and Cance", LISS, 1989, pages 353 - 365
VIROVIC L ET AL.: "Novel delivery methods for treatment of viral hepatitis: an update", EXPERT OPIN DRUG DELIV, vol. 2, no. 707, 2005
WALL A APHILLIPS A M ET AL.: "Effective translation of the second cistron in two Drosophila dicistronic transcripts is determined by the absence of in-frame AUG codons in the first cistron", J BIOL CHEM, vol. 280, no. 30, 2005, pages 27670 - 8
ZIMMERMANN E ET AL.: "Electrolyte- and pH-stabilities of aqueous solid lipid nanoparticle (SLN) dispersions in artificial gastrointestinal media", EUR J PHARM BIOPHARM, vol. 52, no. 203, 2001

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20200054737A1 (en) * 2017-04-26 2020-02-20 Modema TX, Inc. Herpes simplex virus vaccine
EP4242223A2 (en) 2017-08-17 2023-09-13 The Trustees of The University of Pennsylvania Modified mrna vaccines encoding herpes simplex virus glycoproteins and uses thereof
US20230114808A1 (en) * 2019-03-12 2023-04-13 BioNTech SE Therapeutic rna for prostate cancer
WO2022002783A1 (en) * 2020-06-29 2022-01-06 Glaxosmithkline Biologicals Sa Adjuvants
WO2022074358A1 (en) 2020-10-08 2022-04-14 Virokine Therapeutics Limited Vaccine compositions
WO2022165313A1 (en) 2021-02-01 2022-08-04 Regenxbio Inc. Gene therapy for neuronal ceroid lipofuscinoses
WO2022189634A1 (en) * 2021-03-11 2022-09-15 Redbiotec Ag Vaccine compositions and methods for treating hsv
WO2024163918A1 (en) 2023-02-02 2024-08-08 University Of Houston System Mrna vaccine for herpes simplex virus
WO2024249967A1 (en) * 2023-06-02 2024-12-05 The Trustees Of The University Of Pennsylvania Rna vaccines encoding herpes simplex virus glycoproteins and uses thereof
WO2025030134A1 (en) 2023-08-03 2025-02-06 The Trustees Of The University Of Pennsylvania Rna compositions encoding herpes simplex virus glycoprotein e and/or glycoprotein i antigens and uses thereof
WO2025030103A1 (en) 2023-08-03 2025-02-06 The Trustees Of The University Of Pennsylvania Rna compositions encoding herpes simplex virus glycoprotein b antigens and uses thereof
WO2025030165A1 (en) * 2023-08-03 2025-02-06 BioNTech SE Pharmaceutical compositions for delivery of herpes simplex virus antigens and related methods
WO2025030097A3 (en) * 2023-08-03 2025-03-06 BioNTech SE Pharmaceutical compositions for delivery of herpes simplex virus antigens and related methods

Also Published As

Publication number Publication date
US11141478B2 (en) 2021-10-12
EP4242223A3 (en) 2024-03-13
EP4242223A2 (en) 2023-09-13
US20240024463A1 (en) 2024-01-25
JP2020531465A (ja) 2020-11-05
CN118370812A (zh) 2024-07-23
JP7386535B2 (ja) 2023-11-27
CA3073161A1 (en) 2019-02-21
US20210386853A1 (en) 2021-12-16
US11793872B2 (en) 2023-10-24
CN111246854A (zh) 2020-06-05
JP2023153423A (ja) 2023-10-17
AU2018316811B2 (en) 2023-07-13
AU2018316811A1 (en) 2020-03-12
US20200276300A1 (en) 2020-09-03
EP3668520A4 (en) 2021-05-12
JP7674760B2 (ja) 2025-05-12
JP2025108645A (ja) 2025-07-23
EP3668520A1 (en) 2020-06-24
AU2023248194A1 (en) 2023-11-02

Similar Documents

Publication Publication Date Title
US11793872B2 (en) Modified MRNA vaccines encoding herpes simplex virus glycoproteins and uses thereof
US11510977B2 (en) Nucleic acid vaccines for coronavirus
US11197927B2 (en) Human cytomegalovirus vaccine
JP2023116608A (ja) 水痘帯状疱疹ウイルス(vzv)のための核酸ワクチン
US20230248818A1 (en) Nucleoside-modified RNA for Inducing an Immune Response Against SARS-CoV-2
WO2023006062A1 (en) Nucleic acid vaccines for mutant coronavirus
US20240016922A1 (en) Rna vaccines encoding herpes simplex virus glycoproteins and uses thereof
AU2024316992A1 (en) Rna compositions encoding herpes simplex virus glycoprotein b antigens and uses thereof
WO2024249967A1 (en) Rna vaccines encoding herpes simplex virus glycoproteins and uses thereof
HK40100925A (en) Modified mrna vaccines encoding herpes simplex virus glycoproteins and uses thereof
AU2024318951A1 (en) Rna compositions encoding herpes simplex virus glycoprotein e and/or glycoprotein i antigens and uses thereof
WO2025212831A1 (en) Methods of inducing an anti-hsv b-cell immune response
WO2024163918A1 (en) Mrna vaccine for herpes simplex virus
WO2026030275A1 (en) Rna molecules
WO2025255393A1 (en) Herpes simplex virus antigen binding agents for mitigation of herpes simplex virus associated disease
EP4366770A1 (en) P7 containing nucleoside-modified mrna-lipid nanoparticle lineage vaccine for hepatitis c virus

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18846061

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3073161

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020509054

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018316811

Country of ref document: AU

Date of ref document: 20180817

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018846061

Country of ref document: EP

Effective date: 20200317