WO2019023410A1 - ANTI-TIM-1 ANTIBODIES AND USES THEREOF - Google Patents

ANTI-TIM-1 ANTIBODIES AND USES THEREOF Download PDF

Info

Publication number
WO2019023410A1
WO2019023410A1 PCT/US2018/043800 US2018043800W WO2019023410A1 WO 2019023410 A1 WO2019023410 A1 WO 2019023410A1 US 2018043800 W US2018043800 W US 2018043800W WO 2019023410 A1 WO2019023410 A1 WO 2019023410A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
chain variable
variable region
polypeptide sequence
antigen
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/043800
Other languages
English (en)
French (fr)
Inventor
Minghan Wang
Hui Zou
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Phanes Therapeutics Inc
Original Assignee
Phanes Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Phanes Therapeutics Inc filed Critical Phanes Therapeutics Inc
Priority to CN201880050603.9A priority Critical patent/CN111050797B/zh
Priority to EP18837224.7A priority patent/EP3658185A4/en
Priority to JP2020527848A priority patent/JP2021500916A/ja
Priority to US16/633,262 priority patent/US11214615B2/en
Priority to EP22151361.7A priority patent/EP4039274A1/en
Priority to CA3070295A priority patent/CA3070295A1/en
Priority to AU2018306321A priority patent/AU2018306321A1/en
Priority to EA202090401A priority patent/EA202090401A1/ru
Priority to KR1020207004818A priority patent/KR20200032156A/ko
Publication of WO2019023410A1 publication Critical patent/WO2019023410A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • A61K39/001102Receptors, cell surface antigens or cell surface determinants
    • A61K39/001111Immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70503Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3

Definitions

  • This invention relates to monoclonal anti-TIM-3 antibodies, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies.
  • Methods of making the antibodies, and methods of using the antibodies to treat diseases including cancer, inflammatory diseases, autoimmune diseases, infectious diseases, metabolic diseases (e.g., obesity, insulin resistance, and diabetes), and/or associated complications are also provided.
  • T-cell immunoglobulin and mucin-domain containing molecule 3 is a receptor expressed on myeloid cells, including dendritic cells (DCs), macrophages and NK cells, and a subset of lymphoid cells, such as T cells.
  • the documented ligands for TIM-3 include galectin-9 (Gal-9), phosphatidyl serine (PtdSer), and high mobility group protein B l (HMGB 1).
  • the ligations of Gal-9 and PtdSer are mediated by the variable immunoglobulin domain (IgV) of TIM-3. The glycosylation of IgV is required for Gal-9 binding but not for PtdSer binding.
  • TFM-3 By interacting with these ligands, TFM-3 modulates both innate and adaptive immunities.
  • HMGB 1 also plays an important role in chronic inflammation of the adipose tissue in obesity, suggesting that TIM-3 function could be involved in inflammation-related metabolic changes.
  • TIM-3 On the surface of myeloid cells, high expression of TIM-3 inhibits the production of cytokines from macrophages and DCs. The inhibition can be reversed by stimulus from T cells and similarly by blocking monoclonal antibodies.
  • the cancer protective and promoting M2 macrophages are associated with high level of TIM- 3 expression, whereas the cancer fighting Ml macrophages are associated with low level of TIM-3 expression. It remains to be demonstrated whether blocking TIM-3 by a monoclonal antibody can convert M2 to cancer engulfing Ml macrophages.
  • TIM-3 modulates adaptive immunity by interacting with the ligand Gal-9.
  • TIM-3 is expressed on CD4+ helper (Thl and Thl7), regulatory (T reg ) and CD8 + cytotoxic 1 (Tel) T cells.
  • Chronic ligation of TIM-3 to Gal-9 induces apoptosis of Thl cells, downregulating immune response and duration.
  • the surface expression, or possibly the function, of TIM-3 depends on the binding to CEACAM1 in both cis and trans.
  • TIM-3 is usually found on CD8 + T cells expressing immune-repressing PD-1. It has been proposed that TIM-3 and PD-1 are co-suppressors leading to dysfunctional intratumoral T cells. This makes a TIM-3 antagonist antibody a potentially great therapeutic alone and in combination with a PD-l/PDL-1 and/or other immuno-oncology therapy.
  • TIM-3 is also highly expressed on the leukemic stem cells (LSCs) in acute myeloid leukemia (AML).
  • LSCs leukemic stem cells
  • TIM-3 and Gal-9 form an autocrine stimulatory loop to drive self-renewal pathways of cancerous LSCs and leukemic progression.
  • TIM-3 is not present on the surface of hematopoietic stem cells (HSCs), providing an opportunity to treat AML and other myeloid leukemia disorders using a blocking/depleting/cytotoxic therapeutic TIM-3 antibody.
  • TIM-3 modulates the activities of both innate and adaptive immune cells.
  • a TIM-3 blocking monoclonal antibody has the potential to unleash the immune system via unique mechanisms to eliminate cancer cells.
  • the invention relates to isolated monoclonal antibodies or antigen-binding fragments thereof that bind TIM-3.
  • HCDR1 heavy chain complementarity determining region 1
  • HCDR2 heavy chain complementarity determining region 1
  • LCDRl light chain complementarity determining region 1
  • SEQ ID NO: 169 is represented by the amino acid sequence ARDXiX 2 DY, wherein Xi is an amino acid selected from the group consisting of A, T, and L, and wherein X 2 is an amino acid selected from M and E.
  • SEQ ID NO: 170 is represented by the amino acid sequence SQX 1 X 2 HVPX 3 T, wherein Xi is an amino acid selected from the group consisting of N, T, and S, X 2 is an amino acid selected from T and I, and X3 is an amino acid selected from W and Y.
  • the isolated monoclonal antibody or antigen-binding fragment comprise a heavy chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, or 41 or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, or 42.
  • the isolated monoclonal antibody or antigen-binding fragment comprise:
  • the isolated monoclonal antibody or antigen-binding fragment thereof is chimeric.
  • the isolated monoclonal antibody or antigen-binding fragment thereof is human or humanized.
  • the humanized monoclonal antibody or antigen-binding fragment thereof comprises:
  • the isolated monoclonal antibody or antigen-binding fragment thereof is capable of blocking binding of TEVI-3 to phosphatidylserine (PtdSer), TIM-3 to galectin-9 (Gal-9), TIM-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1), and/or TIM-3 to high mobility group protein B l (HMGB1).
  • PtdSer phosphatidylserine
  • TIM-3 to galectin-9 Gal-9
  • CEACAM1 carcinoembryonic antigen cell adhesion molecule 1
  • HMGB1 high mobility group protein B l
  • isolated nucleic acids encoding the monoclonal antibodies or antigen-binding fragments thereof of the invention disclosed herein.
  • vectors comprising the isolated nucleic acids encoding the monoclonal antibodies or antigen-binding fragments thereof of the invention.
  • host cells comprising the vectors comprising the isolated nucleic acids encoding the monoclonal antibodies or antigen-binding fragments thereof of the invention.
  • composition comprising an isolated monoclonal antibody or antigen-binding fragment thereof of the invention and a pharmaceutically acceptable carrier.
  • TIM-3 to phosphatidylserine (PtdSer), TIM-3 to galectin-9 (Gal-9), TEVI-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1), and/or TIM-3 to high mobility group protein B l (HMGB 1) in a subject in need thereof, comprising administering to the subject the pharmaceutical compositions of the invention.
  • PtdSer phosphatidylserine
  • Galectin-9 Galectin-9
  • CEACAM1 carcinoembryonic antigen cell adhesion molecule 1
  • HMGB 1 high mobility group protein B l
  • the cancer can be any liquid or solid cancer, for example, it can be selected from, but not limited to, a lung cancer, a gastric cancer, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin' s lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid tumors
  • NHL non-Hodgkin' s lymphoma
  • ALL acute lymphocytic leukemia
  • CLL chronic
  • Also provided are methods of producing a pharmaceutical composition comprising the monoclonal antibody or antigen-binding fragment thereof of the invention, comprising combining the monoclonal antibody or antigen-binding fragment with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
  • kits for determining a level of TIM-3 in a subject comprise (a) obtaining a sample from the subject; (b) contacting the sample with an antibody or antigen-binding fragment thereof of the invention; and (c) determining the level of TIM-3 in the subject.
  • the sample is a tissue or blood sample.
  • the tissue sample can, for example, be a cancer tissue sample.
  • the blood sample can, for example, comprise cancer cells.
  • FIG. 1 shows the inhibition of human TIM-3 binding to PtdSer by anti-TIM-3 monoclonal antibodies (mAbs).
  • ELISA plates were coated with PtdSer or PtdChol, washed and incubated with a pre-equilibrated mixture of purified antibodies at various concentrations and TIM3(ECD)-huFc. The plates were washed and then the signal was detected by incubation with HRP -coupled anti-huFc secondary antibody and then a HRP substrate.
  • TIM-3 binding to PtdSer was used as 100% signal and TIM-3 binding to PtdChol as zero (background) to calculate percent of inhibition by a given mAb.
  • FIG. 1 shows the inhibition of human TIM-3 binding to PtdSer by anti-TIM-3 monoclonal antibodies (mAbs).
  • FIG. 1A shows a graph of the inhibition of human TIM-3 binding to PtdSer by anti-TIM-3 antibodies 20-LlO-A, 16-K5-A, 15-L23-A, and 2-K2-A.
  • FIG. IB shows a graph of the inhibition of human TIM-3 binding to PtdSer by anti-TIM-3 antibodies 12-G18-A, 5- Cl l-A, and 19-A14-A.
  • FIG. 1C shows a graph of the inhibition of human TIM-3 binding to PtdSer by anti-TIM-3 antibodies 10-M21-A, 18-Nl-A, and 16-L3-A.
  • FIG. ID shows a graph of the inhibition of human TIM-3 binding to PtdSer by anti-TFM-3 antibodies 12- Ml 1-A, 5-K4-A, and 16-J5-A.
  • FIG. IE shows a graph of the inhibition of human TFM-3 binding to PtdSer by anti-TIM-3 antibodies 7-P15-A, 8-F3-A, 10-O15-A, and 18-022-A.
  • FIG. IF shows a graph of the inhibition of human TIM-3 binding to PtdSer by anti-TIM- 3 antibodies 6-113 -A, 6-H6-A, and 7-N2-A.
  • FIG. 2 shows FACS binding analysis of anti-TIM-3 mAbs.
  • AlexaFluor488 was used for detection.
  • FIGS. 3 A and 3B show the result of binding of chimeric and humanized versions of mAb 16-K5-A to recombinant human TIM-3 (ECD)-6His immobilized on a plate in an ELISA assay.
  • any numerical values such as a concentration or a concentration range described herein, are to be understood as being modified in all instances by the term "about.”
  • a numerical value typically includes ⁇ 10% of the recited value.
  • a concentration of 1 mg/mL includes 0.9 mg/mL to 1.1 mg/mL.
  • a concentration range of 1% to 10% (w/v) includes 0.9% (w/v) to 1 1% (w/v).
  • the use of a numerical range expressly includes all possible subranges, all individual numerical values within that range, including integers within such ranges and fractions of the values unless the context clearly indicates otherwise.
  • the terms "comprises,” “comprising,” “includes,” “including,” “has,” “having,” “contains” or “containing,” or any other variation thereof, will be understood to imply the inclusion of a stated integer or group of integers but not the exclusion of any other integer or group of integers and are intended to be non-exclusive or open-ended.
  • a composition, a mixture, a process, a method, an article, or an apparatus that comprises a list of elements is not necessarily limited to only those elements but can include other elements not expressly listed or inherent to such composition, mixture, process, method, article, or apparatus.
  • “or” refers to an inclusive or and not to an exclusive or. For example, a condition A or B is satisfied by any one of the following: A is true (or present) and B is false (or not present), A is false (or not present) and B is true (or present), and both A and B are true (or present).
  • the conjunctive term "and/or" between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by "and/or," a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term "and/or” as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term "and/or.”
  • subject means any animal, preferably a mammal, most preferably a human.
  • mammal encompasses any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc., more preferably a human.
  • the words “right,” “left,” “lower,” and “upper” designate directions in the drawings to which reference is made.
  • nucleic acids or polypeptide sequences e.g., anti-TIM-3 antibodies, TF -3 polypeptides, and polynucleotides that encode them
  • sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same, when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.
  • sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
  • test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
  • sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
  • Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85 :2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by visual inspection (see generally, Current Protocols in Molecular Biology, F.M. Ausubel et al., eds., Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 Supplement) (Ausubel)).
  • BLAST and BLAST 2.0 algorithms are described in Altschul et al. (1990) J. Mol. Biol. 215 : 403-410 and Altschul et al. (1997) Nucleic Acids Res. 25 : 3389-3402, respectively.
  • Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information.
  • This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al, supra).
  • HSPs high scoring sequence pairs
  • T is referred to as the neighborhood word score threshold (Altschul et al, supra).
  • These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them.
  • the word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased.
  • Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always ⁇ 0).
  • M forward score for a pair of matching residues; always > 0
  • N penalty score for mismatching residues; always ⁇ 0.
  • a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
  • the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
  • W wordlength
  • E expectation
  • the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89: 10915 (1989)).
  • the BLAST algorithm In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90: 5873-5787 (1993)).
  • One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
  • a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
  • a further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below.
  • a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative
  • nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions.
  • the invention generally relates to isolated anti-TIM-3 antibodies, nucleic acids and expression vectors encoding the antibodies, recombinant cells containing the vectors, and compositions comprising the antibodies. Methods of making the antibodies, and methods of using the antibodies to treat diseases including cancer, inflammatory diseases, autoimmune diseases, metabolic diseases, and/or infectious diseases are also provided.
  • the antibodies of the invention possess one or more desirable functional properties, including but not limited to high-affinity binding to TIM-3, high specificity to TIM-3, the ability to block the binding of TIM-3 to phosphatidyl serine (PtdSer), the ability to block the binding of TIM-3 to galectin-9, the ability to block the binding of TIM-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAMl), the ability to block the binding of TIM-3 to high mobility group protein B l (HMGB 1), the ability to stimulate the production of cytokines such as, but not limited to, IL-2 and IFN- ⁇ , and the ability to inhibit tumor growth in animal models and subjects when administered alone or in combination with other anti-cancer therapies
  • the invention relates to isolated monoclonal antibodies or antigen-binding fragments thereof that bind TIM-3.
  • antibody is used in a broad sense and includes immunoglobulin or antibody molecules including human, humanized, composite and chimeric antibodies and antibody fragments that are monoclonal or polyclonal. In general, antibodies are proteins or peptide chains that exhibit binding specificity to a specific antigen. Antibody structures are well known. Immunoglobulins can be assigned to five major classes (i.e., IgA, IgD, IgE, IgG and IgM), depending on the heavy chain constant domain amino acid sequence.
  • the antibodies of the invention can be of any of the five major classes or corresponding sub-classes.
  • the antibodies of the invention are IgGl, IgG2, IgG3 or IgG4.
  • Antibody light chains of vertebrate species can be assigned to one of two clearly distinct types, namely kappa and lambda, based on the amino acid sequences of their constant domains. Accordingly, the antibodies of the invention can contain a kappa or lambda light chain constant domain.
  • the antibodies of the invention include heavy and/or light chain constant regions from rat or human antibodies.
  • antibodies contain an antigen-binding region that is made up of a light chain variable region and a heavy chain variable region, each of which contains three domains (i.e., complementarity determining regions 1-3; CDR1, CDR2, and CDR3).
  • the light chain variable region domains are alternatively referred to as LCDR1, LCDR2, and LCRD3, and the heavy chain variable region domains are alternatively referred to as HCDR1, HCRD2, and HCDR3.
  • an "isolated antibody” refers to an antibody which is substantially free of other antibodies having different antigenic specificities (e.g., an isolated antibody that specifically binds to TIM-3 is substantially free of antibodies that do not bind to TIM-3). In addition, an isolated antibody is substantially free of other cellular material and/or chemicals.
  • the term "monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
  • the monoclonal antibodies of the invention can be made by the hybridoma method, phage display technology, single lymphocyte gene cloning technology, or by recombinant DNA methods.
  • the monoclonal antibodies can be produced by a hybridoma which includes a B cell obtained from a transgenic nonhuman animal, such as a transgenic mouse or rat, having a genome comprising a human heavy chain transgene and a light chain transgene.
  • the term "antigen-binding fragment” refers to an antibody fragment such as, for example, a diabody, a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv 1 ), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), a single domain antibody (sdab) an scFv dimer (bivalent diabody), a multispecific antibody formed from a portion of an antibody comprising one or more CDRs, a camelized single domain antibody, a nanobody, a domain antibody, a bivalent domain antibody, or any other antibody fragment that binds to an antigen but does not comprise a complete antibody structure.
  • an antibody fragment such as, for example, a diabody, a Fab,
  • an antigen-binding fragment is capable of binding to the same antigen to which the parent antibody or a parent antibody fragment binds.
  • the antigen-binding fragment comprises a light chain variable region, a light chain constant region, and an Fd segment of the heavy chain.
  • the antigen-binding fragment comprises Fab and F(ab').
  • single-chain antibody refers to a conventional single- chain antibody in the field, which comprises a heavy chain variable region and a light chain variable region connected by a short peptide of about 15 to about 20 amino acids.
  • single domain antibody refers to a conventional single domain antibody in the field, which comprises a heavy chain variable region and a heavy chain constant region or which comprises only a heavy chain variable region.
  • human antibody refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide.
  • humanized antibody refers to a non-human antibody that is modified to increase the sequence homology to that of a human antibody, such that the antigen-binding properties of the antibody are retained, but its antigenicity in the human body is reduced.
  • chimeric antibody refers to an antibody wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
  • the variable region of both the light and heavy chains often corresponds to the variable region of an antibody derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) having the desired specificity, affinity, and capability, while the constant regions correspond to the sequences of an antibody derived from another species of mammal (e.g., human) to avoid eliciting an immune response in that species.
  • multispecific antibody refers to an antibody that comprises a plurality of immunoglobulin variable domain sequences, wherein a first immunoglobulin variable domain sequence of the plurality has binding specificity for a first epitope and a second immunoglobulin variable domain sequence of the plurality has binding specificity for a second epitope.
  • the first and second epitopes are on the same antigen, e.g the same protein (or subunit of a multimeric protein).
  • the first and second epitopes overlap or substantially overlap.
  • the first and second epitopes do not overlap or do not substantially overlap.
  • the first and second epitopes are on different antigens, e.g.
  • a multispecific antibody comprises a third, fourth, or fifth immunoglobulin variable domain.
  • a multispecific antibody is a bispecific antibody molecule, a trispecific antibody, or a tetraspecific antibody molecule.
  • bispecifc antibody refers to a multispecific antibody that binds no more than two epitopes or two antigens.
  • a bispecific antibody is
  • first and second epitopes are on the same antigen, e.g., the same protein (or subunit of a multimeric protein). In an embodiment, the first and second epitopes overlap or substantially overlap. In an embodiment the first and second epitopes are on different antigens, e.g., the different proteins (or different subunits of a multimeric protein).
  • a bispecific antibody comprises a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a first epitope and a heavy chain variable domain sequence and a light chain variable domain sequence which have binding specificity for a second epitope.
  • a bispecific antibody comprises a half antibody, or fragment thereof, having binding specificity for a first epitope and a half antibody, or fragment thereof, having binding specificity for a second epitope.
  • a bispecific antibody comprises a scFv, or fragment thereof, having binding specificity for a first epitope, and a scFv, or fragment thereof, having binding specificity for a second epitope.
  • the first epitope is located on TDVI-3 and the second epitope is located on PD-1, PD-L1, LAG-3, CTLA-4, EGFR, HER-2, CD19, CD20, CD33, DLL-3, CD73, apelin, CD3, CD47, ⁇ -1, CLDN18.2, FOLR1 and/or other tumor associated immune suppressors or surface antigens.
  • TIM-3 refers to the T-cell immunoglobulin and mucin-domain containing molecule 3 protein, a receptor expressed on myeloid cells, including dendritic cells (DCs), macrophages and natural killer (NK) cells, and a subset of lymphoid cells, such as T cells.
  • DCs dendritic cells
  • NK natural killer cells
  • TIM-3 is capable of binding to phosphatidylserine (PtdSer), which is the principal signal for the phagocytosis of apoptotic bodies or cells.
  • PtdSer phosphatidylserine
  • TIM-3 regulates distinct functions in macrophages
  • TDVI-3 can regulate the production and release of cytokines in monocytes and macrophages (reviewed in Ocana-Guzman et al., Id).
  • human TIM-3 refers to a TIM-3 originated from a human.
  • An exemplary amino acid sequence of a human TIM-3 is represented in GenBank Accession No. Q8TDQ0.3 or GenBank Accession No.
  • NP_116171.3 (SEQ ID NO: 177).
  • an antibody that "specifically binds to TIM-3” refers to an antibody that binds to a TIM-3, preferably a human TDVI-3, with a KD of 1 x 10 "7 M or less, preferably 1 ⁇ 10 ⁇ 8 M or less, more preferably 5 ⁇ 10 ⁇ 9 M or less, 1 ⁇ 10 ⁇ 9 M or less, 5 l0 "10 M or less, or l lO "10 M or less.
  • KD refers to the dissociation constant, which is obtained from the ratio of Kd to Ka (i.e., Kd/Ka) and is expressed as a molar concentration (M).
  • KD values for antibodies can be determined using methods in the art in view of the present disclosure.
  • the KD of an antibody can be determined by using surface plasmon resonance, such as by using a biosensor system, e.g., a Biacore® system, or by using bio-layer interferometry technology, such as an Octet RED96 system.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDRl), a HCDR2, a HCDR3, a light chain complementarity determining region 1 (LCDR1), a LCDR2, and a LCDR3, having the polypeptide sequences of:
  • SEQ ID NO: 169 is represented by the amino acid sequence ARDXiX 2 DY, wherein Xi is an amino acid selected from the group consisting of A, T, and L, and wherein X2 is an amino acid selected from M and E.
  • SEQ ID NO: 170 is represented by the amino acid sequence SQXiX 2 HVPX 3 T, wherein Xi is an amino acid selected from the group consisting of N, T, and S, X 2 is an amino acid selected from T and I, and X3 is an amino acid selected from W and Y.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to one of SEQ ID Os: l, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, or 41, or a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to one of SEQ ID NOs:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, or 42.
  • the isolated monoclonal antibody or antigen- binding fragment thereof of the invention comprises a heavy chain variable region having the polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 1, 3, 5, 7, 9, 1 1, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, or 41, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, or 42, respectively.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, comprising: a. a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 1;
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDRl, HCDR2, HCDR3, LCDRl, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:43, 44, 45, 106, 107, and 108, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 1, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:2.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 1; and a light chain variable region having the polypeptide sequence of SEQ ID NO:2.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:46, 47, 48, 109, 110, and 1 11, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:3, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:4.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:3; and a light chain variable region having the polypeptide sequence of SEQ ID NO:4.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1,
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 5, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:6.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 5; and a light chain variable region having the polypeptide sequence of SEQ ID NO:6.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:52, 53, 54, 1 15, 116, and 1 17, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:7, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:8.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:7; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 8.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:55, 56, 57, 1 18, 119, and 120, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:9, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 10.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:9; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 10.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:58, 59, 60, 121, 122, and 123, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 11, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 12.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 11; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 12.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:61, 62, 63, 124, 125, and 126, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 13, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 14.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 13; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 14.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:64, 65, 66, 127, 128, and 129, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 15, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 16.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 15; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 16.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:67, 68, 69, 130, 131, and 132, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 17, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 18
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 17; and a light chain variable region having the polypeptide sequence of SEQ ID NO: 18.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:70, 71, 72, 133, 134, and 135, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO: 19, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:20.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO: 19; and a light chain variable region having the polypeptide sequence of SEQ ID NO:20.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1,
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:21, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:22.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:21; and a light chain variable region having the polypeptide sequence of SEQ ID NO:22.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:76, 77, 78, 139, 140, and 141, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:23, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:24.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:23; and a light chain variable region having the polypeptide sequence of SEQ ID NO:24.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:79, 80, 81, 142, 143, and 144, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:25, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:26.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:25; and a light chain variable region having the polypeptide sequence of SEQ ID NO:26.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:82, 83, 84, 145, 146, and 147, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:27, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:28.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:27; and a light chain variable region having the polypeptide sequence of SEQ ID NO:28.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:85, 86, 87, 148, 149, and 150, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:29, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:30.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:29; and a light chain variable region having the polypeptide sequence of SEQ ID NO:30.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:88, 89, 90, 151, 152, and 153, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:31, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:32.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:31; and a light chain variable region having the polypeptide sequence of SEQ ID NO:32.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs:91, 92, 93, 154, 155, and 156, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:33, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:34.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:33; and a light chain variable region having the polypeptide sequence of SEQ ID NO:34.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1,
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:35, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:36.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:35; and a light chain variable region having the polypeptide sequence of SEQ ID NO:36.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1,
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:37, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:38.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:37; and a light chain variable region having the polypeptide sequence of SEQ ID NO:38.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs: 100, 101, 102, 163, 164, and 165, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:39, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:40.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID N0 39; and a light chain variable region having the polypeptide sequence of SEQ ID NO:40.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof, comprising HCDR1, HCDR2, HCDR3, LCDR1, LCDR2 and LCDR3, having the polypeptide sequences of SEQ ID NOs: 103, 104, 105, 166, 167, and 168, respectively.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:41, and a light chain variable region having a polypeptide sequence at least 85%, preferably 90%, more preferably 95% identical to SEQ ID NO:42.
  • the isolated monoclonal antibody or antigen-binding fragment thereof comprises a heavy chain variable region having the polypeptide sequence of SEQ ID NO:41 ; and a light chain variable region having the polypeptide sequence of SEQ ID NO:42.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the antibody or antigen-binding fragment thereof is chimeric.
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the antibody or antigen-binding fragment thereof is human or humanized.
  • the invention relates to an isolated humanized monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the isolated humanized antibody or antigen-binding fragment thereof comprises:
  • the invention relates to an isolated monoclonal antibody or antigen-binding fragment thereof of the invention, wherein the antibody or antigen-binding fragment thereof is capable of blocking binding of TIM-3 to phosphatidylserine (PtdSer), TIM-3 to galectin-9 (Gal-9), TEVI-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1), and/or TIM-3 to high mobility group protein B l (HMGB 1)
  • PtdSer phosphatidylserine
  • Gal-9 galectin-9
  • CEACAM1 carcinoembryonic antigen cell adhesion molecule 1
  • HMGB 1 high mobility group protein B l
  • the invention in another general aspect, relates to an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention.
  • the coding sequence of a protein can be changed (e.g., replaced, deleted, inserted, etc.) without changing the amino acid sequence of the protein. Accordingly, it will be understood by those skilled in the art that nucleic acid sequences encoding monoclonal antibodies or antigen-binding fragments thereof of the invention can be altered without changing the amino acid sequences of the proteins.
  • the invention in another general aspect, relates to a vector comprising an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention.
  • Any vector known to those skilled in the art in view of the present disclosure can be used, such as a plasmid, a cosmid, a phage vector or a viral vector.
  • the vector is a recombinant expression vector such as a plasmid.
  • the vector can include any element to establish a conventional function of an expression vector, for example, a promoter, ribosome binding element, terminator, enhancer, selection marker, and origin of replication.
  • the promoter can be a constitutive, inducible or repressible promoter.
  • a number of expression vectors capable of delivering nucleic acids to a cell are known in the art and can be used herein for production of an antibody or antigen-binding fragment thereof in the cell.
  • Conventional cloning techniques or artificial gene synthesis can be used to generate a recombinant expression vector according to embodiments of the invention.
  • the invention in another general aspect, relates to a host cell comprising an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention.
  • a host cell comprising an isolated nucleic acid encoding a monoclonal antibody or antigen-binding fragment thereof of the invention.
  • Any host cell known to those skilled in the art in view of the present disclosure can be used for recombinant expression of antibodies or antigen- binding fragments thereof of the invention.
  • the host cells are E. coli TGI or BL21 cells (for expression of, e.g., an scFv or Fab antibody), CHO-DG44 or CHO-K1 cells or FIEK293 cells (for expression of, e.g., a full-length IgG antibody).
  • the recombinant expression vector is transformed into host cells by conventional methods such as chemical transfection, heat shock, or electroporation, where it is stably integrated into the host cell genome such that the recombinant nucleic acid is effectively expressed.
  • the invention in another general aspect, relates to a method of producing a monoclonal antibody or antigen-binding fragment thereof of the invention, comprising culturing a cell comprising a nucleic acid encoding the monoclonal antibody or antigen- binding fragment thereof under conditions to produce a monoclonal antibody or antigen- binding fragment thereof of the invention, and recovering the antibody or antigen-binding fragment thereof from the cell or cell culture (e.g., from the supernatant).
  • Expressed antibodies or antigen-binding fragments thereof can be harvested from the cells and purified according to conventional techniques known in the art and as described herein.
  • the invention in another general aspect, relates to a pharmaceutical composition, comprising an isolated monoclonal antibody or antigen-binding fragment thereof of the invention and a pharmaceutically acceptable carrier.
  • a pharmaceutical composition comprising an isolated monoclonal antibody or antigen-binding fragment thereof of the invention and a pharmaceutically acceptable carrier.
  • composition means a product comprising an antibody of the invention together with a pharmaceutically acceptable carrier. Antibodies of the invention and compositions comprising them are also useful in the manufacture of a medicament for therapeutic applications mentioned herein.
  • carrier refers to any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, oil, lipid, lipid containing vesicle, microsphere, liposomal encapsulation, or other material well known in the art for use in pharmaceutical formulations. It will be understood that the characteristics of the carrier, excipient or diluent will depend on the route of administration for a particular application.
  • pharmaceutically acceptable carrier refers to a non-toxic material that does not interfere with the effectiveness of a composition according to the invention or the biological activity of a composition according to the invention. According to particular embodiments, in view of the present disclosure, any pharmaceutically acceptable carrier suitable for use in an antibody pharmaceutical composition can be used in the invention.
  • compositions of the invention are known in the art, e.g., Remington: The Science and Practice of Pharmacy (e.g. 21st edition (2005), and any later editions).
  • additional ingredients include: buffers, diluents, solvents, tonicity regulating agents, preservatives, stabilizers, and chelating agents.
  • One or more pharmaceutically acceptable carriers can be used in formulating the pharmaceutical compositions of the invention.
  • the pharmaceutical composition is a liquid formulation.
  • a preferred example of a liquid formulation is an aqueous
  • the liquid formulation can comprise a solution, a suspension, an emulsion, a microemulsion, a gel, and the like.
  • An aqueous formulation typically comprises at least 50% w/w water, or at least 60%, 70%, 75%, 80%, 85%, 90%, or at least 95% w/w of water.
  • the pharmaceutical composition can be formulated as an injectable which can be injected, for example, via an injection device (e.g., a syringe or an infusion pump).
  • the injection can be delivered subcutaneously, intramuscularly, intraperitoneally, intravitreally, or intravenously, for example.
  • the pharmaceutical composition is a solid formulation, e.g., a freeze-dried or spray-dried composition, which can be used as is, or whereto the physician or the patient adds solvents, and/or diluents prior to use.
  • Solid dosage forms can include tablets, such as compressed tablets, and/or coated tablets, and capsules (e.g., hard or soft gelatin capsules).
  • the pharmaceutical composition can also be in the form of sachets, dragees, powders, granules, lozenges, or powders for reconstitution, for example.
  • the dosage forms can be immediate release, in which case they can comprise a water-soluble or dispersible carrier, or they can be delayed release, sustained release, or modified release, in which case they can comprise water-insoluble polymers that regulate the rate of dissolution of the dosage form in the gastrointestinal tract or under the skin.
  • the pharmaceutical composition can be delivered intranasally, intrabuccally, or sublingually.
  • the pH in an aqueous formulation can be between pH 3 and pH 10.
  • the pH of the formulation is from about 7.0 to about 9.5. In another embodiment of the invention, the pH of the formulation is from about 3.0 to about 7.0.
  • the pharmaceutical composition comprises a buffer.
  • buffers include: arginine, aspartic acid, bicine, citrate, disodium hydrogen phosphate, fumaric acid, glycine, glycylglycine, histidine, lysine, maleic acid, malic acid, sodium acetate, sodium carbonate, sodium dihydrogen phosphate, sodium phosphate, succinate, tartaric acid, tricine, and
  • the buffer can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml.
  • Pharmaceutical compositions comprising each one of these specific buffers constitute alternative embodiments of the invention.
  • the pharmaceutical composition comprises a preservative.
  • preservatives include: benzethonium chloride, benzoic acid, benzyl alcohol, bronopol, butyl 4-hydroxybenzoate, chlorobutanol, chlorocresol, chlorohexidine, chlorphenesin, o-cresol, m-cresol, p-cresol, ethyl 4- hydroxybenzoate, imidurea, methyl 4-hydroxybenzoate, phenol, 2-phenoxyethanol, 2- phenylethanol, propyl 4-hydroxybenzoate, sodium dehydroacetate, thiomerosal, and mixtures thereof.
  • the preservative can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml.
  • Pharmaceutical compositions comprising each one of these specific preservatives constitute alternative embodiments of the invention.
  • the pharmaceutical composition comprises an isotonic agent.
  • an isotonic agent such as sodium chloride
  • an amino acid such as glycine, histidine, arginine, lysine, isoleucine, aspartic acid, tryptophan, and threonine
  • an alditol such as glycerol, 1 ,2- propanediol propyleneglycol), 1,3-propanediol, and 1 ,3-butanediol
  • polyethyleneglycol e.g. PEG400
  • Another example of an isotonic agent includes a sugar.
  • Non-limiting examples of sugars can be mono-, di-, or polysaccharides, or water- soluble glucans, including for example fructose, glucose, mannose, sorbose, xylose, maltose, lactose, sucrose, trehalose, dextran, pullulan, dextrin, cyclodextrin, alpha and beta- HPCD, soluble starch, hydroxyethyl starch, and sodium carboxymethylcellulose.
  • Another example of an isotonic agent is a sugar alcohol, wherein the term "sugar alcohol” is defined as a C(4-8) hydrocarbon having at least one -OH group.
  • Non-limiting examples of sugar alcohols include mannitol, sorbitol, inositol, galactitol, dulcitol, xylitol, and arabitol.
  • the isotonic agent can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml.
  • Pharmaceutical compositions comprising each one of these specific isotonic agents constitute alternative embodiments of the invention.
  • the pharmaceutical composition comprises a chelating agent.
  • chelating agents include citric acid, aspartic acid, salts of ethylenediaminetetraacetic acid (EDTA), and mixtures thereof.
  • the chelating agent can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml.
  • Pharmaceutical compositions comprising each one of these specific chelating agents constitute alternative embodiments of the invention.
  • the pharmaceutical composition comprises a stabilizer.
  • stabilizers include one or more aggregation inhibitors, one or more oxidation inhibitors, one or more surfactants, and/or one or more protease inhibitors.
  • the pharmaceutical composition comprises a stabilizer, wherein said stabilizer is carboxy-/hydroxycellulose and derivates thereof (such as HPC, HPC-SL, HPC-L and HPMC), cyclodextrins, 2-methylthioethanol, polyethylene glycol (such as PEG 3350), polyvinyl alcohol (PVA), polyvinyl pyrrolidone, salts (such as sodium chloride), sulphur-containing substances such as monothioglycerol), or thioglycolic acid.
  • the stabilizer can be present individually or in the aggregate, in a concentration from about 0.01 mg/ml to about 50 mg/ml, for example from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific stabilizers constitute alternative embodiments of the invention.
  • the pharmaceutical composition comprises one or more surfactants, preferably a surfactant, at least one surfactant, or two different surfactants.
  • surfactant refers to any molecules or ions that are comprised of a water-soluble (hydrophilic) part, and a fat-soluble (lipophilic) part.
  • the surfactant can, for example, be selected from the group consisting of anionic surfactants, cationic surfactants, nonionic surfactants, and/or zwitterionic surfactants.
  • the surfactant can be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml. Pharmaceutical compositions comprising each one of these specific surfactants constitute alternative embodiments of the invention.
  • the pharmaceutical composition comprises one or more protease inhibitors, such as, e.g., EDTA, and/or benzamidine hydrochloric acid (HC1).
  • the protease inhibitor can be present individually or in the aggregate, in a concentration from about 0.1 mg/ml to about 20 mg/ml.
  • Pharmaceutical compositions comprising each one of these specific protease inhibitors constitute alternative embodiments of the invention.
  • the invention in another general aspect, relates to a method of producing a pharmaceutical composition comprising a monoclonal antibody or antigen-binding fragment thereof of the invention, comprising combining a monoclonal antibody or antigen-binding fragment thereof with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
  • the invention relates to a method of blocking the binding of TIM-3 to phosphatidylserine (PtdSer), a method of blocking the binding of TIM-3 to galectin-9, a method of blocking the binding of TIM-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1), or a method of blocking the binding of TIM-3 to high mobility group protein Bl (HMGB1), the method comprising
  • the functional activity of antibodies and antigen-binding fragments thereof that bind TIM-3 can be characterized by methods known in the art and as described herein.
  • Methods for characterizing antibodies and antigen-binding fragments thereof that bind TIM-3 include, but are not limited to, affinity and specificity assays including Biacore, ELISA, and OctetRed analysis; receptor ligand binding assays to detect blocking of the binding of TIM-3 to PtdSer, galectin-9, CEACAM1, and/or HMGB 1 ; the functional effect of inhibition of PtdSer- TIM-3 interaction by an anti-TIM-3 mAb can be detected in a cell-based phagocytosis assay where TPM-3 expressing macrophages are incubated with cells undergoing apoptosis (and thereby expressing PtdSer) and the mAb's blocking of the PtdSer-TIM-3 interaction leads to increased phagocytosis.
  • the functional effect of inhibition of Gal-9-TIM-3 interaction by an anti-TIM-3 mAb can be detected in a cell-based assay where IFN- ⁇ secretion and cell killing are induced as a result of the mAb' s blocking of the binding of Gal-9 on AML cells to TIM-3 on NK cells.
  • the functional effect of inhibition of HMGB 1 -TIM-3 interaction by an anti-TIM-3 mAb can be detected in a cell-based assay where TIM-3 expressing cells are incubated with B- DNA and the mAb' s blocking of the HMGB 1-TIM-3 interaction leads to increased INF- ⁇ ⁇ production.
  • an anti-TIM-3 mAb can also be assessed in a Mixed Lymphocyte Reaction (MLR) assay where dendritic cells and CD4+ cells from different donors are mixed in the presence of the mAb and stimulation of cytokine secretion is measured.
  • MLR Mixed Lymphocyte Reaction
  • the invention relates to a method of treating a cancer in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
  • the cancer can, for example, be selected from but not limited to, a lung cancer, a gastric cancer, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin' s lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid
  • NHL non-Ho
  • the invention in another general aspect, relates to a method of treating an inflammatory disease in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
  • the invention in another general aspect, relates to a method of treating an autoimmune disease in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
  • the invention in another general aspect, relates to a method of treating a metabolic disease in a subject in need thereof, comprising administering to the subject a pharmaceutical composition of the invention.
  • the pharmaceutical composition comprises a therapeutically effective amount of the anti-TIM-3 antibody or antigen- binding fragment thereof.
  • therapeutically effective amount refers to an amount of an active ingredient or component that elicits the desired biological or medicinal response in a subject.
  • a therapeutically effective amount can be determined empirically and in a routine manner, in relation to the stated purpose.
  • a therapeutically effective amount means an amount of the anti-TIM-3 antibody or antigen-binding fragment thereof that modulates an immune response in a subject in need thereof. Also as used herein with reference to anti-TIM-3 antibodies or antigen-binding fragments thereof, a therapeutically effective amount means an amount of the anti-TIM-3 antibody or antigen-binding fragment thereof that results in treatment of a disease, disorder, or condition; prevents or slows the progression of the disease, disorder, or condition; or reduces or completely alleviates symptoms associated with the disease, disorder, or condition.
  • the disease, disorder or condition to be treated is cancer, preferably a cancer selected from the group consisting of a lung cancer, a gastric cancer, a colon cancer, a hepatocellular carcinoma, a renal cell carcinoma, a bladder urothelial carcinoma, a metastatic melanoma, a breast cancer, an ovarian cancer, a cervical cancer, a head and neck cancer, a pancreatic cancer, a glioma, a glioblastoma, and other solid tumors, and a non-Hodgkin's lymphoma (NHL), an acute lymphocytic leukemia (ALL), a chronic lymphocytic leukemia (CLL), a chronic myelogenous leukemia (CML), a multiple myeloma (MM), an acute myeloid leukemia (AML), and other liquid tumors.
  • the disease, disorder or condition to be treated is an infectious disease, an inflammatory fibroblasts, a chronic lymphocytic le
  • a therapeutically effective amount refers to the amount of therapy which is sufficient to achieve one, two, three, four, or more of the following effects: (i) reduce or ameliorate the severity of the disease, disorder or condition to be treated or a symptom associated therewith; (ii) reduce the duration of the disease, disorder or condition to be treated, or a symptom associated therewith; (iii) prevent the progression of the disease, disorder or condition to be treated, or a symptom associated therewith; (iv) cause regression of the disease, disorder or condition to be treated, or a symptom associated therewith; (v) prevent the development or onset of the disease, disorder or condition to be treated, or a symptom associated therewith; (vi) prevent the recurrence of the disease, disorder or condition to be treated, or a symptom associated therewith; (vii) reduce hospitalization of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith; (viii) reduce
  • hospitalization length of a subject having the disease, disorder or condition to be treated, or a symptom associated therewith (ix) increase the survival of a subject with the disease, disorder or condition to be treated, or a symptom associated therewith; (xi) inhibit or reduce the disease, disorder or condition to be treated, or a symptom associated therewith in a subject; and/or (xii) enhance or improve the prophylactic or therapeutic effect(s) of another therapy.
  • the therapeutically effective amount or dosage can vary according to various factors, such as the disease, disorder or condition to be treated, the means of
  • compositions described herein are formulated to be suitable for the intended route of administration to a subject.
  • the compositions described herein can be formulated to be suitable for intravenous, subcutaneous, or intramuscular administration.
  • the terms “treat,” “treating,” and “treatment” are all intended to refer to an amelioration or reversal of at least one measurable physical parameter related to a cancer, an infectious disease, disorder or condition, an immune disease, disorder or condition, an autoimmune disease, disorder or condition, an inflammatory disease, disorder or condition, and/or a metabolic disease, disorder or condition, which is not necessarily discernible in the subject, but can be discernible in the subject.
  • the terms “treat,” “treating,” and “treatment,” can also refer to causing regression, preventing the progression, or at least slowing down the progression of the disease, disorder, or condition.
  • “treat,” “treating,” and “treatment” refer to an alleviation, prevention of the development or onset, or reduction in the duration of one or more symptoms associated with the disease, disorder, or condition, such as a tumor or more preferably a cancer.
  • “treat,” “treating,” and “treatment” refer to prevention of the recurrence of the disease, disorder, or condition.
  • “treat,” “treating,” and “treatment” refer to an increase in the survival of a subject having the disease, disorder, or condition.
  • “treat,” “treating,” and “treatment” refer to elimination of the disease, disorder, or condition in the subject.
  • a composition used in the treatment of a cancer an infectious disease, disorder or condition, an immune disease, disorder or condition, an autoimmune disease, disorder or condition, a metabolic disease, disorder or condition, and/or an inflammatory disease, disorder or condition can be used in combination with another treatment.
  • the composition can be used in combination with another treatment including, but not limited to, a chemotherapy, an anti-CD20 mAb, an anti-CTLA-4 antibody, an anti-LAG-3 mAb, an anti-EGFR mAb, an anti-HER-2 mAb, an anti-CD 19 mAb, an anti-CD33 mAb, an anti-CD73 mAb, an anti- CD47 mAb, an anti-DLL-3 mAb, an anti-apelin mAb, an anti-TIP-1 mAb, an anti-
  • CLDN18.2 mAb an anti-FOLRl mAb, an anti-PD-Ll antibody, an anti-PD-1 antibody, a PD-l/PD-Ll therapy, other immuno-oncology drugs, an anti angiogenic agent, a radiation therapy, an antibody-drug conjugate (ADC), a targeted therapy, or other anticancer drugs.
  • ADC antibody-drug conjugate
  • the term "in combination,” in the context of the administration of two or more therapies to a subject, refers to the use of more than one therapy.
  • the use of the term “in combination” does not restrict the order in which therapies are administered to a subject.
  • a first therapy e.g., a composition described herein
  • a first therapy can be administered prior to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks before), concomitantly with, or subsequent to (e.g., 5 minutes, 15 minutes, 30 minutes, 45 minutes, 1 hour, 2 hours, 4 hours, 6 hours, 12 hours, 16 hours, 24 hours, 48 hours, 72 hours, 96 hours, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 8 weeks, or 12 weeks after) the administration of a second therapy to a subject.
  • the invention in another general aspect, relates to a method of determining a level of TIM-3 in a subject, comprising (a) obtaining a sample from the subject; (b) contacting the sample with an antibody or antigen-binding fragment thereof of the invention; and (c) determining the level of TIM-3 in the subject.
  • the sample is a tissue or blood sample.
  • the tissue sample can, for example, be a cancer tissue sample.
  • the blood sample can, for example, comprise cancer cells.
  • sample refers to a biological sample isolated from a subject and can include, but is not limited to, whole blood, serum, plasma, blood cells, endothelial cells, tissue biopsies (e.g., a cancer tissue, a hepatic tissue, etc.), lymphatic fluid, ascites fluid, interstitial fluid, bone marrow, cerebrospinal fluid, saliva, mucous, sputum, sweat, urine, or any other secretion, excretion, or other bodily fluids.
  • tissue biopsies e.g., a cancer tissue, a hepatic tissue, etc.
  • lymphatic fluid ascites fluid
  • interstitial fluid e.g., interstitial fluid
  • bone marrow e.g., a hepatic tissue, etc.
  • cerebrospinal fluid e.g., ascites fluid
  • saliva mucous
  • sputum e.g., saliva
  • sweat e.g., a hepatic tissue
  • the level of TIM-3 in the subject can be determined utilizing assays selected from, but not limited to, a Western blot assay, an ELISA assay, a FACS assay, and/or an immunohistochemistry (IHC).
  • Relative protein levels can be determined by utilizing Western blot analysis, FACS assay, and immunohistochemistry (HTC), and absolute protein levels can be determined by utilizing an ELISA assay.
  • HTC immunohistochemistry
  • the levels of TIM-3 can be determined between at least two samples, e.g., between samples from the same subject at different time points, between samples from different tissues in the same subject, and/or between samples from different subjects.
  • the absolute level of TIM-3 in the sample can be determined by creating a standard for the ELISA assay prior to testing the sample.
  • analytical techniques to utilize to determine the level of TIM-3 in a sample from the subject utilizing the antibodies or antigen-binding fragments thereof of the invention.
  • a disease can be selected from, but not limited to, a cancer, preferably a cancer selected from the group consisting of lung cancer, gastric cancer, colon cancer, hepatocellular carcinoma, renal cell carcinoma, bladder urothelial carcinoma, metastatic melanoma, breast cancer, ovarian cancer, cervical cancer, head and neck cancer, pancreatic cancer, glioma, glioblastoma, and other solid tumors, and non-Hodgkin's lymphoma (NHL), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), multiple myeloma (MM), acute myeloid leukemia (AML), and other liquid tumors, an inflammatory disease, an infectious lymphoma (NHL), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), multiple myeloma (MM), acute my
  • the invention provides also the following non-limiting embodiments.
  • Embodiment 1 is an isolated monoclonal antibody or antigen-binding fragment thereof comprising a heavy chain complementarity determining region 1 (HCDR1), HCDR2, HCDR3, a light chain complementarity determining region 1 (LCDRl), LCDR2, and LCDR3, having the polypeptide sequences of
  • the antibody or antigen-binding fragment thereof specifically binds TIM-3, preferably human TIM-3.
  • Embodiment 2 is the isolated monoclonal antibody or antigen-binding fragment of embodiment 1, comprising a heavy chain variable region having a
  • polypeptide sequence at least 95% identical to SEQ ID NO: l, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, or 41 or a light chain variable region having a polypeptide sequence at least 95% identical to SEQ ID NO:2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, or 42.
  • Embodiment 3 is the isolated monoclonal antibody or antigen-binding fragment of embodiment 1 or 2, comprising
  • Embodiment 4 is the isolated monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 3, wherein the antibody or antigen4oinding fragment thereof is chimeric.
  • Embodiment 5 is the isolated monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 4, wherein the antibody or antigen-binding fragment thereof is human or humanized.
  • Embodiment 6 is the isolated monoclonal antibody or antigen-binding fragment of embodiment 5, wherein the antibody or antigen-binding fragment thereof comprises:
  • Embodiment 7 is the isolated monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 6, wherein the antibody or antigen-binding fragment thereof is capable of blocking binding of TIM-3 to phosphatidylserine (PtdSer), TIM-3 to galectin-9 (Gal-9), TIM-3 to carcinoembryonic antigen cell adhesion molecule 1 (CEACAM1), and/or TIM-3 to high mobility group protein B l (HMGB1).
  • PtdSer phosphatidylserine
  • Gal-9 galectin-9
  • CEACAM1 carcinoembryonic antigen cell adhesion molecule 1
  • HMGB1 high mobility group protein B l
  • Embodiment 8 is an isolated nucleic acid encoding the monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 7.
  • Embodiment 9 is a vector comprising the isolated nucleic acid of embodiment
  • Embodiment 10 is a host cell comprising the vector of embodiment 9.
  • Embodiment 11 is a pharmaceutical composition, comprising the isolated monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 7 and a pharmaceutically acceptable carrier.
  • Embodiment 12 is a method of blocking binding of TIM- 3 to phosphatidylserine (PtdSer) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 1 1.
  • PtdSer phosphatidylserine
  • Embodiment 13 is a method of blocking binding of TIM- 3 to galectin-9 (Gal-9) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
  • Embodiment 14 is a method of blocking binding of TIM- 3 to
  • CEACAM1 carcinoembryonic antigen cell adhesion molecule 1
  • Embodiment 15 is a method of blocking binding of TIM- 3 to high mobility group protein B l (HMGB 1) in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 1 1.
  • HMGB 1 high mobility group protein B l
  • Embodimentl6 is a method of treating cancer in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 11.
  • Embodiment 17 is a method of treating an infectious disease in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 1 1.
  • Embodiment 18 is a method of treating an inflammatory disease in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 1 1.
  • Embodiment 19 is a method of treating an autoimmune disease in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 1 1.
  • Embodiment 20 is a method of treating a metabolic disease in a subject in need thereof, comprising administering to the subject the pharmaceutical composition of embodiment 1 1.
  • Embodiment 21 is a method of producing the monoclonal antibody or antigen- binding fragment of any of embodiments 1 to 7, comprising culturing a cell comprising a nucleic acid encoding the monoclonal antibody or antigen-binding fragment under conditions to produce the monoclonal antibody or antigen-binding fragment, and recovering the antibody or antigen-binding fragment from the cell or culture.
  • Embodiment 22 is a method of producing a pharmaceutical composition comprising the monoclonal antibody or antigen-binding fragment of any of embodiments 1 to 7, comprising combining the monoclonal antibody or antigen-binding fragment with a pharmaceutically acceptable carrier to obtain the pharmaceutical composition.
  • Embodiment 23 is a method of determining a level of TIM-3 in a subject, comprising (a) obtaining a sample from the subject; (b) contacting the sample with an antibody or antigen-binding fragment thereof of the invention; and (c) determining the level of TIM-3 in the subj ect.
  • Embodiment 24 is the method of embodiment 23, wherein the sample is a tissue sample.
  • Embodiment 25 is the method of embodiment 24, wherein the tissue sample is a cancer tissue sample.
  • Embodiment 26 is the method of embodiment 23, wherein the sample is a blood sample.
  • mice were immunized with Fc-tagged human and cynomolgus TIM-3 extracellular domain (ECD) proteins and adjuvant.
  • Plasma titer was determined by enzyme linked immunosorbent assay (ELISA). After euthanization, spleens and lymph nodes were collected to produce hybridomas. Hybridomas were grown in 384-well tissue culture plates and supematants from individual wells were screened by ELISA to identify positive binders for human and cynomolgus TIM-3 ECD proteins.
  • Positive supematants were also screened for blocking of phosphatidylserine binding to TIM-3 recombinant protein and binding to native TTM-3 protein by FACS analysis on TIM-3-expressing HEK293 cells. Positive clones were isolated and sequenced.
  • VH heavy c lain variable region
  • VSNRFSGVPDRFSGSGSGTDFTL ISRVEAEDLGVYFCSQNTHVPWTFGGGTKLE IK SEQ ID NO:4
  • GVPTRFNGSGSGTSYSLTISSMEAEDAATYYCHQRSSYRTFGGGT LEIK SEQ ID NO:36
  • VL light chain variable region
  • HC heavy chain
  • CDR complementarity determining region
  • the HC CDRs for the anti-TIM-3 mAbs were determined utilizing the IMGT method (Lefranc, M.-P. et al., Nucleic Acids Res. 1999; 27:209-212).
  • Table 4 CDR regions 1-3 of the light chain for anti-TIM-3 mAbs
  • LC light chain
  • CDR complementarity determining region
  • the LC CDRs for the anti-TIM-3 mAbs were determined utilizing the IMGT method (Lefranc, M.-P. et al., Nucleic Acids Res. 1999; 27:209-212).
  • Example 2 TIM-3 and PtdSer binding assay using ELISA
  • Plates were washed and then incubated with a pre- equilibrated mixture of purified antibodies (0, 0.03, 0.08, 0.25, 0.74, 2.22, 6.67, or 20 g/mL mAb) and TIM3(ECD)-huFc, a fusion protein containing the extracellular domain (ECD) of human TIM-3 and human Fc (huFc), in blocking buffer supplemented with CaCl 2 .
  • the plates were washed and then incubated with HRP-coupled anti-huFc secondary antibody. Plates were washed, incubated with an HRP substrate, and read using a POLARstar Omega Microplate (BMG LABTECH). The assay was performed in triplicate.
  • the signal of TIM-3 binding to PtdSer was defined as 100% signal and the signal of ⁇ -3 binding to PtChol as zero (background) to set the assay window.
  • Results of the inhibition of human TIM-3 binding to PtdSer by anti-TIM-3 monoclonal antibodies (mAbs) as demonstrated by the ELISA assays are shown in FIGS. 1 A-1F.
  • a human TIM-3 -expressing plasmid was made and transiently transfected into ⁇ 293 ⁇ cells. After approximately 48 hours, cells were transferred to a 384-well V- bottom plate. Cells were washed with ice-cold FACS buffer (PBS supplemented with 1% BSA) and incubated with purified mAbs with gentle agitation at 4°C for 45 minutes. The cells were washed with FACS buffer and incubated with an anti-mouse secondary Ab AlexaFluor488. The cells were washed and analyzed by FACS. Results of the FACS binding analysis of the anti-TIM-3 mAbs are provided in FIG. 2.
  • Binding experiments were performed on OCTET Red96 at 25°C. Antibodies were loaded onto Anti-Mouse Fc (AMC) biosensors. Loaded sensors were dipped into serial dilutions of antigen. Kinetic constants were calculated using a monovalent (1 : 1) model. The assay buffer was PBS supplemented with 0.1% BSA, 500 mM NaCl, 0.02% Tween-20, pH 7.2. The dissociation constant for antibody-antigen binding was determined for the anti-TIM-3 monoclonal antibodies and is shown below in Table 5. Table 5 : KD values for anti-TIM-3 mAbs
  • Example 5 Humanization of anti-TIM-3 mAb
  • the mouse anti-TIM-3 mAb 16-K5-A was humanized to reduce the potential of immunogenicity when used in human patients.
  • the sequences of the variable regions of the heavy and light chains (VH and VL) were compared with the human antibody sequences in the Protein Data Bank (PDB) database and homology models were built by applying SWISS-modeling.
  • the CDRs in both the heavy and light chains of the mouse mAbs were grafted into human frameworks that have the highest possibility of maintaining the proper structure likely required for antigen binding. Backmutations from human residues to mouse residue were designed when necessary.
  • the sequences of the humanized VH and VL regions are shown in Table 6.
  • H1L1, H2L1, H5L5 and H7L5 refer to the humanized mAbs constructed using a specific VH (e.g., HI) and a specific VL (e.g., LI) combination (to produce H1L1).
  • a specific VH e.g., HI
  • a specific VL e.g., LI
  • Example 6 ELISA binding analysis for chimeric and humanized anti- TIM-3 mAbs

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Urology & Nephrology (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • Biotechnology (AREA)
  • Pathology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2018/043800 2017-07-28 2018-07-26 ANTI-TIM-1 ANTIBODIES AND USES THEREOF Ceased WO2019023410A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
CN201880050603.9A CN111050797B (zh) 2017-07-28 2018-07-26 抗tim-3抗体及其用途
EP18837224.7A EP3658185A4 (en) 2017-07-28 2018-07-26 ANTI-TIM-3 ANTIBODIES AND USES THEREOF
JP2020527848A JP2021500916A (ja) 2017-07-28 2018-07-26 抗tim−3抗体及びその使用
US16/633,262 US11214615B2 (en) 2017-07-28 2018-07-26 Anti-TIM-3 antibodies and uses thereof
EP22151361.7A EP4039274A1 (en) 2017-07-28 2018-07-26 Anti-tim-3 antibodies and uses thereof
CA3070295A CA3070295A1 (en) 2017-07-28 2018-07-26 Anti-tim-3 antibodies and uses thereof
AU2018306321A AU2018306321A1 (en) 2017-07-28 2018-07-26 Anti-TIM-3 antibodies and uses thereof
EA202090401A EA202090401A1 (ru) 2017-07-28 2018-07-26 Анти-tim-3 антитела и их применение
KR1020207004818A KR20200032156A (ko) 2017-07-28 2018-07-26 항-tim-3 항체 및 이의 용도

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201762538277P 2017-07-28 2017-07-28
US62/538,277 2017-07-28

Publications (1)

Publication Number Publication Date
WO2019023410A1 true WO2019023410A1 (en) 2019-01-31

Family

ID=65040974

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/043800 Ceased WO2019023410A1 (en) 2017-07-28 2018-07-26 ANTI-TIM-1 ANTIBODIES AND USES THEREOF

Country Status (9)

Country Link
US (1) US11214615B2 (https=)
EP (2) EP4039274A1 (https=)
JP (1) JP2021500916A (https=)
KR (1) KR20200032156A (https=)
CN (1) CN111050797B (https=)
AU (1) AU2018306321A1 (https=)
CA (1) CA3070295A1 (https=)
EA (1) EA202090401A1 (https=)
WO (1) WO2019023410A1 (https=)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2021051352A1 (zh) * 2019-09-19 2021-03-25 上药生物治疗(香港)有限公司 一种分离的抗原结合蛋白及其用途
WO2021169948A1 (zh) * 2020-02-24 2021-09-02 苏州恒康生命科学有限公司 Tim3结合分子及其应用
WO2021222944A1 (en) * 2020-04-30 2021-11-04 Board Of Regents, The University Of Texas System Anti-cd79b antibodies and chimeric antigen receptors and methods of use thereof
WO2023105528A1 (en) * 2021-12-12 2023-06-15 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Antibodies specific to ceacam1
WO2025035133A1 (en) * 2023-08-10 2025-02-13 Board Of Regents, The University Of Texas System Bmp-7 antibody compositions & methods for treating cancer
US12454574B2 (en) 2018-10-30 2025-10-28 Board Of Regents, The University Of Texas System Anti-CD79B antibodies and chimeric antigen receptors and methods of use thereof

Families Citing this family (8)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA3160436A1 (en) * 2019-12-17 2021-06-24 Jack Chongyang LI Bispecific antibodies with alternatively matched interchain cysteines and uses thereof
WO2021138380A2 (en) * 2019-12-30 2021-07-08 University Of Louisville Research Foundation, Inc. Virus-like particle binding agents, related compositions, and related methods
CN113151186B (zh) * 2021-02-04 2022-02-18 上海交通大学 抗人cd271的单克隆抗体及用途
EP4326773A4 (en) * 2021-04-23 2025-09-24 Suzhou Neologics Bioscience Co Ltd ANTIBODIES TARGETING TIM-3 AND THEIR USES
CN116925216B (zh) * 2022-04-11 2024-09-24 东莞市朋志生物科技有限公司 抗血清淀粉样蛋白a抗体、检测血清淀粉样蛋白a的试剂和试剂盒
CN119264251B (zh) * 2024-12-09 2025-03-14 上海交通大学医学院附属仁济医院 一种cbln1单克隆抗体和应用
CN120590523B (zh) * 2025-06-20 2026-01-27 中国农业科学院上海兽医研究所(中国动物卫生与流行病学中心上海分中心) 一种犬瘟热病毒n蛋白单克隆抗体,快速检测胶体金试纸条及其制备方法
CN120623323B (zh) * 2025-06-23 2026-04-21 江苏东抗生物医药科技有限公司 一种靶向猴痘病毒的抗体及其应用

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006006693A1 (ja) * 2004-07-09 2006-01-19 Chugai Seiyaku Kabushiki Kaisha 抗グリピカン3抗体
CN103173412A (zh) * 2012-12-07 2013-06-26 天津三箭生物技术有限公司 小鼠抗人cd20单克隆抗体及分泌该单克隆抗体的杂交瘤细胞株
US20140302039A1 (en) * 2013-04-03 2014-10-09 Samsung Electronics Co., Ltd. Combination therapy using anti-c-met antibody and anti-ang-2 antibody

Family Cites Families (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7470428B2 (en) 2002-01-30 2008-12-30 The Brigham And Women's Hospital, Inc. Compositions and methods related to TIM-3, a Th1-specific cell surface molecule
US7811563B2 (en) * 2004-10-25 2010-10-12 Northwestern University Anti-addl antibodies and uses thereof
EP2212350B1 (en) 2007-10-26 2013-08-28 Governing Council of the University of Toronto Treating chronic viral infection by targetting TIM-3
JP5748653B2 (ja) 2009-04-10 2015-07-15 協和発酵キリン株式会社 抗tim−3抗体を用いた血液腫瘍治療法
AU2011262758B8 (en) 2010-06-11 2014-09-04 Kyowa Kirin Co., Ltd. Anti-tim-3 antibody
WO2011159877A2 (en) 2010-06-18 2011-12-22 The Brigham And Women's Hospital, Inc. Bi-specific antibodies against tim-3 and pd-1 for immunotherapy in chronic immune conditions
WO2013006490A2 (en) 2011-07-01 2013-01-10 Cellerant Therapeutics, Inc. Antibodies that specifically bind to tim3
CA2913052A1 (en) 2013-05-24 2014-11-27 Board Of Regents, The University Of Texas System Chimeric antigen receptor-targeting monoclonal antibodies
HUE045065T2 (hu) * 2014-01-31 2019-12-30 Novartis Ag TIM-3 antitest molekulák és felhasználásaik
GB201419094D0 (en) 2014-10-27 2014-12-10 Agency Science Tech & Res Anti-TIM-3-antibodies
KR20170075778A (ko) 2014-10-27 2017-07-03 에이전시 포 사이언스, 테크놀로지 앤드 리서치 항-tim-3 항체
SI3215532T1 (sl) 2014-11-06 2020-02-28 F. Hoffmann-La Roche Ag Protitelesa proti TIM3 in postopki uporabe
WO2016111947A2 (en) 2015-01-05 2016-07-14 Jounce Therapeutics, Inc. Antibodies that inhibit tim-3:lilrb2 interactions and uses thereof
EP3265486A4 (en) 2015-03-06 2018-11-14 Sorrento Therapeutics, Inc. Antibody therapeutics that bind tim3
FI3277321T3 (fi) 2015-04-01 2024-10-31 Anaptysbio Inc T-soluimmunoglobuliinia ja musiiniproteiini 3:a (tim-3) vastaan suunnattuja vasta-aineita
TW201713332A (zh) 2015-07-14 2017-04-16 協和醱酵麒麟有限公司 包含與抗體組合投予之ido抑制物之腫瘤治療劑
EP3878465A1 (en) 2015-07-29 2021-09-15 Novartis AG Combination therapies comprising antibody molecules to tim-3
EP3337826A1 (en) 2015-08-20 2018-06-27 Sutro Biopharma, Inc. Anti-tim-3 antibodies, compositions comprising anti-tim-3 antibodies and methods of making and using anti-tim-3 antibodies
WO2017055404A1 (en) 2015-10-02 2017-04-06 F. Hoffmann-La Roche Ag Bispecific antibodies specific for pd1 and tim3
WO2017055393A1 (en) 2015-10-02 2017-04-06 F. Hoffmann-La Roche Ag Anti-cd3xtim-3 bispecific t cell activating antigen binding molecules
PE20181326A1 (es) 2015-11-03 2018-08-20 Janssen Biotech Inc Anticuerpos que se unen especificamente a pd-1 y sus usos
EP3448874A4 (en) 2016-04-29 2020-04-22 Voyager Therapeutics, Inc. COMPOSITIONS FOR TREATING A DISEASE

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2006006693A1 (ja) * 2004-07-09 2006-01-19 Chugai Seiyaku Kabushiki Kaisha 抗グリピカン3抗体
CN103173412A (zh) * 2012-12-07 2013-06-26 天津三箭生物技术有限公司 小鼠抗人cd20单克隆抗体及分泌该单克隆抗体的杂交瘤细胞株
US20140302039A1 (en) * 2013-04-03 2014-10-09 Samsung Electronics Co., Ltd. Combination therapy using anti-c-met antibody and anti-ang-2 antibody

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
BD PHARMINGEN: "Mouse Anti-Human TIM-3 ( CD 366) Clone 7D3", TECHNICAL DATA SHEET, 2015, XP055568245, Retrieved from the Internet <URL:http://www.bdbiosciences.com/ds/pm/tds/565570.pdf> [retrieved on 20180904] *
DATABASE UniProtKB/TrEMBL [o] 10 May 2017 (2017-05-10), Database accession no. K7T9R4 *
See also references of EP3658185A4 *

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12454574B2 (en) 2018-10-30 2025-10-28 Board Of Regents, The University Of Texas System Anti-CD79B antibodies and chimeric antigen receptors and methods of use thereof
WO2021051352A1 (zh) * 2019-09-19 2021-03-25 上药生物治疗(香港)有限公司 一种分离的抗原结合蛋白及其用途
WO2021169948A1 (zh) * 2020-02-24 2021-09-02 苏州恒康生命科学有限公司 Tim3结合分子及其应用
WO2021222944A1 (en) * 2020-04-30 2021-11-04 Board Of Regents, The University Of Texas System Anti-cd79b antibodies and chimeric antigen receptors and methods of use thereof
WO2023105528A1 (en) * 2021-12-12 2023-06-15 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Antibodies specific to ceacam1
WO2025035133A1 (en) * 2023-08-10 2025-02-13 Board Of Regents, The University Of Texas System Bmp-7 antibody compositions & methods for treating cancer

Also Published As

Publication number Publication date
US11214615B2 (en) 2022-01-04
CN111050797A (zh) 2020-04-21
EP3658185A4 (en) 2021-07-14
CA3070295A1 (en) 2019-01-31
EP4039274A1 (en) 2022-08-10
EP3658185A1 (en) 2020-06-03
CN111050797B (zh) 2024-04-30
AU2018306321A1 (en) 2020-02-13
KR20200032156A (ko) 2020-03-25
JP2021500916A (ja) 2021-01-14
US20210032330A1 (en) 2021-02-04
EA202090401A1 (ru) 2020-05-18

Similar Documents

Publication Publication Date Title
US11214615B2 (en) Anti-TIM-3 antibodies and uses thereof
US11401329B2 (en) Anti-CD47 antibodies and uses thereof
US12325745B2 (en) Anti-DLL3 antibodies and uses thereof
IL276950B1 (en) Anti-cd73 antibodies and uses thereof
US11390679B2 (en) Anti-LAG-3 antibodies and uses thereof
US11873335B2 (en) Anti-folate receptor 1 antibodies and uses thereof
CA3089649A1 (en) Anti-tip-1 antibodies and uses thereof

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18837224

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3070295

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020527848

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018306321

Country of ref document: AU

Date of ref document: 20180726

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20207004818

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2018837224

Country of ref document: EP