WO2019002155A1 - Molluscicidal compositions - Google Patents
Molluscicidal compositions Download PDFInfo
- Publication number
- WO2019002155A1 WO2019002155A1 PCT/EP2018/066848 EP2018066848W WO2019002155A1 WO 2019002155 A1 WO2019002155 A1 WO 2019002155A1 EP 2018066848 W EP2018066848 W EP 2018066848W WO 2019002155 A1 WO2019002155 A1 WO 2019002155A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- composition according
- composition
- mouuscicidal
- fusp
- asn
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N25/00—Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of application, e.g. seed treatment or sequential application; Substances for reducing the noxious effect of the active ingredients to organisms other than pests
- A01N25/08—Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of application, e.g. seed treatment or sequential application; Substances for reducing the noxious effect of the active ingredients to organisms other than pests containing solids as carriers or diluents
- A01N25/10—Macromolecular compounds
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N25/00—Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of application, e.g. seed treatment or sequential application; Substances for reducing the noxious effect of the active ingredients to organisms other than pests
- A01N25/002—Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of application, e.g. seed treatment or sequential application; Substances for reducing the noxious effect of the active ingredients to organisms other than pests containing a foodstuff as carrier or diluent, i.e. baits
- A01N25/008—Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of application, e.g. seed treatment or sequential application; Substances for reducing the noxious effect of the active ingredients to organisms other than pests containing a foodstuff as carrier or diluent, i.e. baits molluscicidal
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N25/00—Biocides, pest repellants or attractants, or plant growth regulators, characterised by their forms, or by their non-active ingredients or by their methods of application, e.g. seed treatment or sequential application; Substances for reducing the noxious effect of the active ingredients to organisms other than pests
- A01N25/34—Shaped forms, e.g. sheets, not provided for in any other sub-group of this main group
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N37/00—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids
- A01N37/36—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids containing at least one carboxylic group or a thio analogue, or a derivative thereof, and a singly bound oxygen or sulfur atom attached to the same carbon skeleton, this oxygen or sulfur atom not being a member of a carboxylic group or of a thio analogue, or of a derivative thereof, e.g. hydroxy-carboxylic acids
- A01N37/38—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids containing at least one carboxylic group or a thio analogue, or a derivative thereof, and a singly bound oxygen or sulfur atom attached to the same carbon skeleton, this oxygen or sulfur atom not being a member of a carboxylic group or of a thio analogue, or of a derivative thereof, e.g. hydroxy-carboxylic acids having at least one oxygen or sulfur atom attached to an aromatic ring system
- A01N37/40—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids containing at least one carboxylic group or a thio analogue, or a derivative thereof, and a singly bound oxygen or sulfur atom attached to the same carbon skeleton, this oxygen or sulfur atom not being a member of a carboxylic group or of a thio analogue, or of a derivative thereof, e.g. hydroxy-carboxylic acids having at least one oxygen or sulfur atom attached to an aromatic ring system having at least one carboxylic group or a thio analogue, or a derivative thereof, and one oxygen or sulfur atom attached to the same aromatic ring system
Definitions
- the invention discloses moUuscicidal compositions for controlling snails and slugs, in particular aquatic snails and slugs in fish ponds, paddy fields and similar, by slowly releasing the molluscicide.
- Aquatic snails and slugs i.e. snails and slugs which live in the water, are important pests in particular in ponds for the culture of (phytophagous) fish or else in flooded crops (for example paddy fields) . They cause yield losses by depriving the fish of some of their food, or by damaging or destroying the crop plants. Since population densities of a few thousand snails and slugs per m 2 are not unheard of under practical conditions, it is easy to imagine that they cause considerably damage.
- WO 2012/131302 Al discloses fusion proteins based on peptide toxins as pesticides, in particular a fusion protein comprising: (i) a omega-ACTX-Hvla protein toxin, or a fragment or variant thereof, linked to (ii) a protein capable of mediating translocation of the fusion protein from the invertebrate gut, preferably snowdrop lectin Galanthus nivalis agglutinin GNA.
- compositions of instant invention in comparison the state of the art moUuscicidal composition show a constant slow release of the active ingredient.
- compositions are able to
- FePP Ferric pyrophosphate, iron(III) pyrophosphate, Fe 4 (P 2 07)3
- Subject of the invention is a molluscicidal composition
- a molluscicidal composition comprising as components
- the active ingredient is selected from the group consisting of metaldehyde, iron(III) phosphate, iron(III) pyrophosphate, saponin, niclosamide, niclosamide ethanolamine salt, methiocarb, a fusion protein FUSP, and mixtures thereof;
- the disintegrant is selected from the group consisting of acrylamide based polymer, methyl cellulose, waxes based on polyethylene glycol or polypropylene glycol as alcohol component, sodium salt of polymerized alkyl naphthalene sulfonic acid, and mixtures thereof;
- FSUP comprises: (i) an omega-ACTX-Hvla protein toxin, or a fragment or variant thereof, linked to (ii) a protein capable of mediating translocation of FUSP from an invertebrate gut.
- Molluscicidal composition in the sense of the invention means a composition that harms
- MoUusks in the sense of the invention are preferably snails and slugs.
- the active ingredient is a molluscicide, that is a substance active against mollusks, preferably against snails and slugs.
- Methiocarb is 3,5-Dimethyl-4-(methylthio)phenyl methylcarbamate with CAS 2032-65-7.
- omega-ACTX-Hvla protein toxin is known in the art. It is a toxin isolated from the
- omega-ACTX-Hvla The amino acid sequence of omega-ACTX-Hvla is SEQ ID NO: 1 : SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVK CD SEQ ID NO: l
- a modified form of omega-ACTX-Hvla has a K34 alteration, using the amino acid numbering of SEQ ID NO: l; preferably, the amino acid K34 of omega-ACTX-Hvla is substituted.
- substituted it is meant that the Lysine amino acid residue at the position 34 is replaced with another amino acid; preferably the 34 Lys is substituted for Glutamine (this is called herein K34Q substitution according to the numbering of SEQ ID NO: 1).
- the amino acid sequence of the K34Q modified omega-ACTX-Hvla is SEQ ID NO:2: SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVQRCD SEQ ID NO:2
- amino acid K34 of omega-ACTX-Hvla protein toxin is modified.
- the omega-ACTX-Hvla protein toxin has a K34Q substitution.
- omega-ACTX-Hvla protein toxin comprises the amino acid sequence of SEQ ID NO: 1
- the peptide toxin to be used in FUSP has the amino acid sequence of SEQ ID NO: 1
- “Fragment or variant” of omega-ACTX-Hvla includes that FUSP can comprise an amino acid sequence of omega-ACTX-Hvla that can vary from the sequence provided in SEQ ID NO: 1 or SEQ ID NO:2 with the proviso that the fragment or variant substantially retain the biological activity of the omega-ACTX-Hvla.
- “Variants” of a polypeptide include insertions, deletions and substitutions, either conservative or non-conservative. This also includes where the peptide sequence omits several amino acids; preferably less than 5, 4, or 3 amino acids are deleted from the sequence provided in SEQ ID NO: l or SEQ ID NO:2. In particular variants of the polypeptide are included where such changes do not substantially alter the omega-ACTX-Hvla toxin activity. A skilled person knows that the sequence of SEQ ID NO: 1 or SEQ ID NO:2 can be altered without the loss of biological activity.
- substitutions is intended combinations such as Gly, Ala; Val, He, Leu; Asp, Glu; Asn, Gin; Ser, Thr; Lys, Arg; and Phe, Tyr.
- the variant has an amino acid sequence which has at least 75%, yet still more preferably at least 80%, in further preference at least 85%, in still further preference at least 90% and most preferably at least 95% or 97% identity with the amino acid sequence of the omega-ACTX-Hvla toxin provided herein.
- the percent sequence identity between two polypeptides may be determined using suitable computer programs, for example the GAP program of the University of Wisconsin
- omega-ACTX-Hvla peptide toxin there are also naturally occurring homologues to the omega-ACTX-Hvla peptide toxin which can also be used. Such homologues are considered to be "variants" as defined above. Hadroncyhe versuta also produces the toxins omega-hexatoxin-Hvle, omega- hexatoxin-Hvlc, omega- hexatoxin-Hv Id, and omega-hexatoxin-Hvlb which each have a very high level of sequence identity (only a few amino acid substitutions or deletions).
- the Sydney funnel- web spider (Atrax robustus) produces the peptide toxin omega-hexatoxin-Arld which has an identical amino acid sequence to omega-ACTX-Hvla, and omega- hexatoxin-Arlh and omegahexatoxin-Arlf which have a very high level of sequence identity (only a few amino acid substitutions or deletions).
- infensa (omega-hexatoxin-Hilb lO, 8, 5, 2, 1 series; omega- hexatoxin-Hild; omega- hexatoxin-Hile; omega-hexatoxin-Hilf) and the Kenyan funnel- web spider,
- Hadronyche venenata (omega-hexatoxin-Hvnlb_6, _ 4, _3, _2, _1 series)
- ID NO:2 and hence can be used in FUSP, and are embodiments of the invention.
- the GenBank database is also very helpful (www.arachnoserver.org) as it includes information regarding a large number of spider toxins, arranged by toxin type and species. From the information provided in the databases above and by using the well- known BLAST search, the skilled person can readily identify additional peptide toxins that can be used.
- the first and second portions (i) and (ii) of FUSP are linked together by genetic or biochemical means and so, in the first instance, by at least one linking amino acid residue or peptide or, in the second instance, by a covalent or non-covalent bond or bonds or other linking moiety.
- a peptide is used to link said members together the number of amino acid residues in the peptide is variable, and is determined by the distance between the relevant ends of each member necessary to allow FUSP to be in a biologically active conformation.
- the portions of FUSP may be reversibly linked by means adapted to dissociate and release the toxic agent in situ in an invertebrate gut or circulatory system, for example on being metabolised by an invertebrate animal or may be irreversibly linked, depending on the form of the toxic agent.
- the second portion of FUSP aids passage of the toxic member through the invertebrate gut, this allowing the protein to move to a site of toxicity in the invertebrate animal.
- the second portion can be considered as a translocating moiety that is capable of acting as a carrier to translocate the first portion across the gut wall of an invertebrate animal.
- FUSP can be used as a pesticide by delivering a toxin to a site of toxicity in an
- the protein capable of mediating translocation of FUSP from the invertebrate gut preferably mediates the translocation of FUSP from the invertebrate gut to the circulatory system of an invertebrate animal, preferably of insects, molluscs and nematodes, more preferably of moluscs.
- Suitable proteins capable of mediating translocation of FUSP from the invertebrate gut include plant lectins.
- any lectin that binds to invertebrate gut can be used.
- the protein capable of mediating translocation of FUSP from the invertebrate gut is a plant lectin selected from any one or more of the following: snowdrop lectin Galanthus nivalis agglutinin (GNA), garlic lectin Allium sativum, pea lectin Pisum sativum (P-lec), peanut lectin Arachis hypogaea, french bean lectin (PHA, Phytohaemoglutinin), or fragments, variants or derivatives thereof.
- GUA snowdrop lectin Galanthus nivalis agglutinin
- P-lec pea lectin Pisum sativum
- PHA peanut lectin Arachis hypogaea
- french bean lectin PHA, Phytohaemoglutinin
- “Fragment or variant” of the plant lectin includes that the amino acid sequence of the
- particular lectin protein can differ from that known in the art and that naturally occurring, with the proviso that the fragment or variant substantially retain the biological activity of the lectin, i.e. be capable of mediating translocation of FUSP from the invertebrate gut.
- the lectin is GNA.
- amino acid sequence of GNA is SEQ ID NO:3:
- the GNA comprises the amino acid sequence of SEQ ID NO:3.
- FUSP further comprises an affinity tag to aid purification. The use of short amino acid tag sequences to aid the affinity purification of recombinant
- proteins is well known in the art. Indeed, many commercially available protein expression constructs include nucleic acid sequences encoding such tags. The protein of interest is inserted into the expression construct in such a manner that the affinity tag is linked to said protein.
- affinity tags include chitin binding protein (CBP), maltose binding protein (MBP), glutathione-S-transferase (GST), and the His-tag.
- a polyhistidine-tag is an amino acid motif in proteins that consists of at least five histidine (His) residues, often at the N- or C-terminus of the protein. It is also known as hexa histidine-tag, 6xHis-tag, and by the trademarked name His-tag®. They are a well known affinity tag and methods of introducing His-tags to recombinant proteins are known in art, as are routine methods of purifying proteins with His-tags.
- the affinity tag is a His tag.
- the second portion which is preferably GNA, is located at the N-terminus of the omega-ACTX-Hvla protein toxin.
- a FUSP has the arrangement: NH 2 - (GNA: omega- ACTX-Hvla)-COOH, such as the peptide with SEQ ID NO: 4:
- the peptide of SEQ ID NO:4 has a six amino acid HIS tag placed at the C-terminus.
- the HIS tag can be used to aid recovery of FUSP when prepared as part of a recombinant protein expression system.
- the presence of the HIS tag is optional and therefore a variant of SEQ ID NO:4 can include that peptide sequence without the HIS tag.
- FUSP is NH 2 -(GNA: MODIFIED omega- ACTX-Hvla)-COOH with SEQ ID NO:5:
- the HIS tag placed at the N-terminus. Similar to SEQ ID NO:4, the HIS tag is optional and therefore a variant of SEQ ID NO: 5 can include that peptide sequence without the HIS tag.
- SEQ ID NO:5 includes the modified amino acid sequence of omega-ACTX-Hvla, i.e. having a K34Q substitution as discussed above and as provided in SEQ ID NO:2.
- omega-ACTX-Hvla at the N-terminus relative to GNA in FUSP can have a greater pesticide effect, hence this arrangement is a preferred embodiment of the invention.
- a preferred embodiment of the invention is wherein the GNA peptide is located at the C-terminus of the omega- ACTX-Hvl a protein toxin, such as the FUSP arrangements: NH 2 -(omega-ACTX-Hvla: GNA)-COOH with SEQ ID NO:6:
- the HIS tag placed at the C-terminus. Similar to SEQ ID NO:4, the HIS tag is optional.
- SEQ ID NO:8 includes the modified amino acid sequence of omega-ACTX-Hvla, i.e. having a K34Q substitution as discussed above and as provided in SEQ ID NO:2.
- FUSP with in SEQ 10 NO:9 is a particularly preferred embodiment of the invention SEQ ID NOs 1 to 9 have been copied from WO 2012/131302 Al, in case of a typo or discrepancy the version of the sequences as published in WO 2012/131302 Al prevails.
- FUSP comprises the amino acid sequence of any of SEQ ID NOs 4, 5, 6, 7, 8 or 9.
- omega-ACTX-Hvla protein toxin is linked to the N-terminus of the protein capable of mediating translocation of FUSP from the invertebrate gut.
- FUSP comprises the amino acid sequence of any of SEQ ID NOs 6, 7, 8 or 9.
- FUSP may be presented as a substantially purified form or preparation.
- purified is meant that FUSP has been at least partially separated from other components in the presence of which it has been formed, for example other components of a recombinant cell. Methods of purification are known to the skilled person.
- the form or preparation of FUSP may be substantially pure. By “substantially pure” it is
- any form or preparation of FUSP is included that includes at least 30% of the protein content by weight as FUSP , preferably at least 50%, more preferably at least 70%, still more preferably at least 90% and most preferably at least 95% of the protein content is FUSP, based on the total weight of the form or preparation of FUSP.
- FUSP includes compositions comprising the said FUSP and a contaminant wherein the contaminant comprises less than 70% of the composition by weight, preferably less than 50% of the composition, more preferably less than 30% of the composition, still more preferably less than 10% of the composition and most preferably less than 5% of the composition by weight.
- the invention also includes the substantially pure FUSP when combined with other
- the active ingredient is metaldehyde.
- the composition has the form of a homogeneous mixture of its components.
- the acrylamide based polymer in the sense of the invention, is selected from the group consisting of polyacrylamide, copolymer of acrylic acid and acrylamide, and mixtures thereof.
- Polyacrylamide can be a non- ionic, a cationic or a anionic polyacrylamide, preferably it is a non-ionic or a cationic polyacrylamide; more preferably it is a non-ionic polyacrylamide.
- the wax based on polyethylene glycol or polypropylene glycol as alcohol is preferable, the wax based on polyethylene glycol or polypropylene glycol as alcohol
- carboxylic acid is preferably a C9-26 fatty acid
- the wax based on polyethylene glycol or polypropylene glycol as alcohol component are polyethylene glycol mono stearate or polyethylene glycol mono oleate.
- the disintegrant is acrylamide based polymer, sodium salt of polymerized alkyl naphthalene sulfonic acid, or a mixture thereof.
- composition can comprise a bulking agent
- the bulking agent is selected from the group consisting of phyllosihcate, calcium carbonate, silica, starch, limestone, and mixtures thereof.
- Phyllosilicates can be clays and clay minerals. Examples are kaolin, bentonite and their
- kaolinite and montmorillonite components kaolinite and montmorillonite.
- One type of kaolin is commercially available under the name "bolus alba”.
- the preferred phyllo silicate is kaoline.
- Starch can be used as such or as pregelatinised starch, preferably as pregelatinised starch.
- the bulking agent is selected from the group consisting of phyllosihcate, calcium carbonate, limestone, and mixtures thereof.
- the composition comprises the active ingredient, the disintegrant and the bulking agent; also in combination with the embodiments of these three components.
- the disintegrant acrylamide based polymer sodium salt of polymerized alkyl naphthalene sulfonic acid or a mixture of acrylamide based polymer and sodium salt of polymerized alkyl naphthalene sulfonic acid, and the bulking agent phyllosilicate, calcium carbonate, limestone, or mixtures thereof;
- the composition comprises the active ingredient metaldehyde, the
- disintegrant acrylamide based polymer and the bulking agent phyllosilicate, calcium carbonate or mixtures thereof;
- the composition comprises the active ingredient metaldehyde, the
- disintegrant acrylamide based polymer disintegrant acrylamide based polymer, and the bulking agent phyllosilicate.
- composition can comprise a wetting agent
- the wetting agent is water or polyvinyl alcohol, preferably the wetting agent is water.
- the composition comprises the active ingredient, the disintegrant, the bulking agent and the wetting agent; also in combination with the embodiments of these four components.
- the disintegrant acrylamide based polymer sodium salt of polymerized alkyl naphthalene sulfonic acid or a mixture of acrylamide based polymer and sodium salt of polymerized alkyl naphthalene sulfonic acid, the bulking agent phyllosilicate, calcium carbonate, limestone, or mixtures thereof, and the wetting agent.
- the composition comprises the active ingredient metaldehyde, the disintegrant acrylamide based polymer, the bulking agent phyllosilicate or calcium carbonate, and the wetting agent water.
- the composition comprises the active ingredient
- the disintegrant sodium salt of polymerized alkyl naphthalene sulfonic acid the bulking agent phyllosilicate, limestone, or mixtures thereof, and the wetting agent polyvinyl alcohol.
- composition can comprise an additive
- the additive is selected from the group consisting of sodium propionate, magnesium stearate, nicotinamide, sodium bicarbonate, and mixtures thereof.
- the additive is selected from the group consisting of sodium propionate, magnesium stearate, sodium bicarbonate, and mixtures thereof.
- composition comprises the active ingredient
- the disintegrant acrylamide based polymer and the bulking agent phyllosilicate, calcium carbonate or mixtures thereof, and the additive sodium propionate, magnesium stearate or mixtures thereof;
- the composition comprises the active ingredient metaldehyde, the
- disintegrant acrylamide based polymer disintegrant acrylamide based polymer, the bulking agent phyllosilicate, and the additive sodium propionate.
- composition comprises the active ingredient
- the composition comprises the active ingredient metaldehyde, the
- compositions can comprise known anti mold
- the C 1-10 alkyl isothiazolinon is a C 1-10 alkyl 4-isothiazolin-3-on, more preferably it is selected from the group consisting of methylisothiazolinon, butylisothiazolinon, and octylisothiazolinon.
- the additive sodium propionate shows also anti mold activity.
- the composition comprises
- the active ingredient in an amount of from 7 to 60 wt%, the wt% being based on the total weight of the composition. More preferably, the composition, when it comprises metaldehyde, comprises metaldehyde in an amount of from 7 to 55 wt%, the wt% being based on the total weight of the composition.
- Embodiments of the possible ranges of the amount of metaldehyde are: 7.5 to 52.5 wt%, 7.5 to 32.5 wt% and 7.5 to 25 wt% of metaldehyde, the wt% being based on the total weight of the composition.
- the composition when it comprises iron(III) phosphate, comprises iron(III) phosphate in an amount of from 5 to 15 wt%, the wt% being based on the total weight of the composition.
- the composition when it comprises metaldehyde and iron(III) phosphate, comprises metaldehyde in an amount of from 10 to 25 wt% and iron(III) phosphate in an amount of from 5 to 15 wt%, the wt% being based on the total weight of the composition.
- the composition when it comprises niclosamide, comprises niclosamide in an amount of from 15 to 30 wt%, the wt% being based on the total weight of the composition. More preferably, the composition, when it comprises niclosamide ethanolamine salt,
- niclosamide ethanolamine salt in an amount of from 15 to 30 wt%, the wt% being based on the total weight of the composition.
- composition when it comprises iron(III) pyrophosphate, comprises
- iron(III) pyrophosphate in an amount of from 10 to 30 wt%, the wt% being based on the total weight of the composition.
- the composition when it comprises saponin, comprises saponin in an amount of from 17.5 to 52.5 wt%, the wt% being based on the total weight of the composition.
- the composition when it comprises FUSP, comprises FUSP in an amount of from 20 to 30 wt%, the wt% being based on the total weight of the composition.
- the composition comprises the disintegrant in an amount of from 5 to 80 wt%, the wt% being based on the total weight of the composition.
- composition when a bulking agent is present in the composition, then the composition
- the bulking agent comprises the bulking agent in an amount of from 1 to 70 wt%, the wt% being based on the total weight of the composition.
- composition when an additive agent is present in the composition, then the composition
- the additive comprises the additive in an amount of from 1 to 15 wt%, the wt% being based on the total weight of the composition.
- the composition when a wetting agent is present in the composition, then the composition
- the composition comprises the wetting agent in an amount of from 20 to 75 wt% in case the wetting agent is water, or in an amount of from 0.5 to 3 wt% in case the wetting agent is polyvinyl alcohol, the wt% being based on the total weight of the composition.
- the composition comprises
- the active ingredient in an amount of from 7.5 to 52.5 wt%
- the disintegrant in an amount of from 0.5 to 20 wt%
- the bulking agent in an amount of from 7.5 to 70 wt%
- the wetting agent in an amount of from 0.5 to 70 wt%;
- the wt% being based on the total weight of the composition.
- composition comprises
- the active ingredient in an amount of from 7.5 to 32.5 wt%
- the disintegrant in case that the disintegrant is acrylamide based polymer, in an amount of from 5 to 20 wt%, or
- the disintegrant in case that the disintegrant is sodium salt of polymerized alkyl naphthalene sulfonic acid, in an amount of from 0.5 to 2 wt%,
- the bulking agent in case that the disintegrant is acrylamide based polymer, in an amount of from 7.5 to 30 wt%, or the bulking agent, in case that the disintegrant is sodium salt of polymerized alkyl naphthalene sulfonic acid, in an amount of from 25 to 70 wt%,
- the wetting agent in case that the wetting is water, in an amount of from 20 to 75 wt%, or the wetting agent, in case that the wetting is s polyvinyl alcohol, in an amount of from 0.5 to 3 wt%;
- the wt% being based on the total weight of the composition
- composition comprises
- the active ingredient in an amount of from 7.5 to 32.5 wt%
- the disintegrant as acrylamide based polymer in an amount of from 5 to 20 wt%
- the bulking agent in an amount of from 7.5 to 30 wt%
- the wetting agent as water, in an amount of from 20 to 75 wt%;
- the composition comprises
- the active ingredient in an amount of from 7.5 to 32.5 wt%
- the disintegrant as sodium salt of polymerized alkyl naphthalene sulfonic acid in an amount of from 0.5 to 2 wt%
- the bulking agent in an amount of from 25 to 70 wt%
- the wetting agent as polyvinyl alcohol in an amount of from 0.5 to 3 wt%;
- the wt% being based on the total weight of the composition.
- composition comprises
- the active ingredient in an amount of from 10 to 30 wt%
- the disintegrant as acrylamide based polymer in an amount of from 7 to 17 wt%
- the bulking agent in an amount of from 10 to 30 wt%
- the wetting agent as water, in an amount of from 25 to 55 wt%;
- the composition comprises
- the active ingredient in an amount of from 10 to 30 wt%
- the disintegrant as acrylamide based polymer in an amount of from 7 to 17 wt%
- the bulking agent in an amount of from 10 to 30 wt%
- the wetting agent as water, in an amount of from 25 to 55 wt%; the additive, preferably as sodium propionate, in an amount of from 5 to 10 wt%; the wt% being based on the total weight of the composition.
- the composition contains
- the active ingredient in an amount of from 7.5 to 32.5 wt%
- the disintegrant as acrylamide based polymer in an amount of from 5 to 20 wt%
- the bulking agent in an amount of from 7.5 to 30 wt%
- the wetting agent as water, in an amount of from 20 to 75 wt%;
- the wt% being based on the total weight of the composition, and the amount of the
- composition contains
- the active ingredient in an amount of from 7.5 to 32.5 wt%
- the disintegrant as sodium salt of polymerized alkyl naphthalene sulfonic acid in an amount of from 0.5 to 2 wt%
- the bulking agent in an amount of from 25 to 70 wt%
- the wetting agent as polyvinyl alcohol in an amount of from 0.5 to 3 wt%;
- the wt% being based on the total weight of the composition, and the amount of the
- the composition contains
- the active ingredient in an amount of from 10 to 30 wt%
- the disintegrant as acrylamide based polymer in an amount of from 7 to 17 wt%
- the bulking agent in an amount of from 10 to 30 wt%
- the wetting agent as water, in an amount of from 25 to 55 wt%;
- the additive preferably as sodium propionate, in an amount of from 5 to 10 wt%;
- the wt% being based on the total weight of the composition, and the amount of the
- compositions Kal, Ka2, Cal, WIA, WIB, GIA, GIB, GIC and GID in Table 4 can contain FePP or a combination of Meta and FePP instead of the active ingredient stated in Table 4.
- a method for preparation of the molluscicidal compositions comprises a premixing of the components to provide a premixture and comprises a shaping of a premixture of the components, with the molluscicidal compositions as defined herein, also with all its embodiment.
- the shaping is preferably done by pressing or cutting or first pressing and then cutting a
- the wetting agent can be mixed with the other components in the premixing providing the premixture, or a first premixture is prepared by mixing the components except for the wetting agent, and then the wetting agent is mixed with the first premixture to provide a second premixture containing the wetting agent, this second premixture then is pressed or cut into shape. If the composition is damp or moist after the shaping then the composition is dried after shaping. This can be especially the case when a wetting agent is part of the composition. The final
- compositions are dry.
- the mixing is done in such a way that any premixture and any composition
- any known mixer can be used that is capable of mixing dry substances or that is capable of mixing pastes or doughs, this especially when a wetting agent is part of the composition.
- Possible mixers are for example extruders.
- any device capable of pressing into shape a powder, a dough or a paste.
- the device used for mixing and shaping is a device that does both steps
- Examples suitable granulating or pelleting devices for both steps, the mixing and the shaping are the commercially discs and drums as supplied by various manufacturers, such as Eirich. Good results are achieved using the devices termed Eirich mixer/granulator. Using these, it is possible to make do with small amounts of wetting agent and thus to reduce the time and energy required for drying.
- Drying is preferably carried out at a low temperature to avoid decomposition of any
- components such as metaldehyde, which is heat-sensitive.
- the final compositions are provided after the shaping and optionally the drying in form of cubes, granules, pellets, tablets, and the like.
- the diameter or the longest dimension of the final compositions is preferably between 1 mm and 15 mm, more preferably 3 mm and 10 mm.
- molluscicidal composition for controlling aquatic snails and slugs, with the molluscicidal compositions as defined herein, also with all its embodiment.
- This control is done by application of the compositions to the water surface.
- molluscicidal compositions are applied to the water surface, with the molluscicidal compositions as defined herein, also with all its embodiment.
- the controlling of aquatic snails and slugs is in particular done in fish ponds or paddy fields.
- compositions act by releasing the active substance while being submerged under the water and lying on the ground. Therefore the components of the compositions are chosen in such a way that the final compositions after shaping show a density of greater than 1 in order to sink after the application to the water surface to the ground.
- the rate of application depends, inter alia, on the size of the pest population and is, as a rule, from 0.1 to 10 g /m 2 , preferably 0.1 to 1 g/m 2 (1 to 100 kg/ha, preferably, 1 to 10 kg/ha) based on the amount of active ingredient.
- FeP0 4 Iron (III) Fe 29% white powder Sigma- phosphate Aldrich dihydrate Co. LLC FeP0 4 x 2H 2 0
- FePP Fe 4 (P 2 0 7 ) 3 Iron content: Light Yellow to Sigma-
- Peg400 Pegosperse 400 Acid Value 10 polyethylene Lonza Ltd
- Peg50 Pegosperse 50 Acid Value 5; polyethylene Lonza Ltd
- HLB hydrophilic- active agents
- Niacinamide pH 6.0 to 7.5 technical
- VOC wt% 1.0
- compositions were prepared in the following manner:
- the active ingredient, bulking agent, disintegrant, and additive (as was the case and as indicated in table 2) were premixed in the respective quantities to yield a homogenous premixture.
- the resulting premixture was either directly pressed and/or cut in shape into shape, or optionally the premixture was mixed with a wetting agent to yield a homogenous mixture that was subsequently pressed and/or cut in shape.
- Mixing was done in a beaker and shaping was done either with a cake form or by pressing the mixture through a nozzle and then cutting into shape.
- Table 2 shows the details of the different compositions.
- Diffusion rate of the active ingredient in water for the different compositions was determined in a static test setup comprising of a water pool of a defined length and a defined water height. The tested compositions was put in place at the center of the pool. Samples were taken at predefined and fixed sample points in a distance of 25, 50, and 75 cm from the center of the pool. Values given in the tables are the average of 4 different samples taken at 2 different sample points, these two different sample points had the same radial distance to the right and to the left of the composition. The amount of sample that was present in each experiment was adjusted to the total content of active ingredient in the respective composition to have an equal amount of active ingredient present in each experiment.
- J-LON-5 contains ca. 95 wt% of corn flour and 5 wt% of Meta as active ingredient.
- J-LON-5 The commercial product J-LON-5, that was used as comparative example in these release experiments, was also compared to a composition J-LON-5-LAB, that contained the same components as the commercial product J-LON-5, but that was prepared in the same way as the tested compositions of the instant invention.
- J-LON-5 -LAB showed the same release behavior of Meta as J-LON-5.
- This homogeneous powder was charged continuously with a screw feeder into the extruder while separately from but simultaneously with the homogeneous powder charging water into the extruder at such a rate that the pressure in the extruder could be maintained between 48 and 69 bar.
- the temperature in the extruder was between 58 to 75 °C.
- the product was extruded through a nozzle with a diameter of 2 mm and was cut by rotating baldes into pellets of defined length of 3 to 4 mm.
- the pellets were dried under air atmosphere at ambient temperature.
- Trp Ala Ser Asn Thr Gly Gly Gin Asn Gly Asn Tyr Val Cys lie
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Dentistry (AREA)
- Plant Pathology (AREA)
- Engineering & Computer Science (AREA)
- Pest Control & Pesticides (AREA)
- Agronomy & Crop Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Environmental Sciences (AREA)
- Toxicology (AREA)
- Food Science & Technology (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
Abstract
The invention discloses molluscicidal compositions for controlling snails and slugs, in particular aquatic snails and slugs in fish ponds, paddy fields and similar, by slowly releasing the molluscicide.
Description
MOLLUSCICIDAL COMPOSITIONS
The invention discloses moUuscicidal compositions for controlling snails and slugs, in particular aquatic snails and slugs in fish ponds, paddy fields and similar, by slowly releasing the molluscicide.
BACKGROUND OF THE INVENTION
Aquatic snails and slugs, i.e. snails and slugs which live in the water, are important pests in particular in ponds for the culture of (phytophagous) fish or else in flooded crops (for example paddy fields) . They cause yield losses by depriving the fish of some of their food, or by damaging or destroying the crop plants. Since population densities of a few thousand snails and slugs per m2 are not unheard of under practical conditions, it is easy to imagine that they cause considerably damage. WO 2012/131302 Al discloses fusion proteins based on peptide toxins as pesticides, in particular a fusion protein comprising: (i) a omega-ACTX-Hvla protein toxin, or a fragment or variant thereof, linked to (ii) a protein capable of mediating translocation of the fusion protein from the invertebrate gut, preferably snowdrop lectin Galanthus nivalis agglutinin GNA.
The current state of the art moUuscicidal composition J-LON-5, which is available on the market, rapidly releases the total amount of incorporated active ingredient, which gives rise to fast decomposition by microbials and to washout of the active ingredient from the target area by currents and other environmental influences.
There was a need for compositions which make an active ingredient against snails and slugs in water available for as long time as possible.
The compositions of instant invention in comparison the state of the art moUuscicidal composition show a constant slow release of the active ingredient. Thus these new
compositions are able to
1. offer crop protection with a single application over the whole relevant growing period;
2. reduce the maximum concentration of active ingredient in the water and thereby minimize environmental impact and loss of active ingredient;
3. reduce the overall amount of active ingredient needed to be applied for crop protection.
The following abbreviations, names and meanings are used, if not stated otherwise:
Ex example
iron(III) phosphate FeP04
iron(III) pyrophosphate Fe4(P207)3
MW molecular weight
PAA Polyacrylamide
PVA Polyvinyl alcohol
% wt%, if not otherwise stated
>= / => equal or greater
<= / =< equal or less
The term ingredient and component is used interchangeably, if not otherwise stated. Especially in the tables the following meanings are used, if not otherwise stated:
CO compositions
ADD Additive
AI Active Ingredient
BA Bulking Agent
DI Disintegrant
FA920 FA 920 SH
FePP Ferric pyrophosphate, iron(III) pyrophosphate, Fe4(P207)3
FO4490 FO 4490 SH
LS Limestone
Meta Metaldehyde
MC Methyl cellulose;
MgSt Mg-stearate
NA Nicotinamide, Niacinamide
NaBI NaHC03
Nicl Niclosamide
NiclEt Niclosamide ethanolamine salt
SP Sodium propionate
WA Wetting Agent
W Water
SUMMARY OF THE INVENTION
Subject of the invention is a molluscicidal composition comprising as components
an active ingredient and
a disintegrant;
wherein
the active ingredient is selected from the group consisting of metaldehyde, iron(III) phosphate, iron(III) pyrophosphate, saponin, niclosamide, niclosamide ethanolamine salt, methiocarb, a fusion protein FUSP, and mixtures thereof; the disintegrant is selected from the group consisting of acrylamide based polymer, methyl cellulose, waxes based on polyethylene glycol or polypropylene glycol as alcohol component, sodium salt of polymerized alkyl naphthalene sulfonic acid, and mixtures thereof;
FSUP comprises: (i) an omega-ACTX-Hvla protein toxin, or a fragment or variant thereof, linked to (ii) a protein capable of mediating translocation of FUSP from an invertebrate gut.
DETAILED DESCRIPTION OF THE INVENTION
Molluscicidal composition in the sense of the invention means a composition that harms,
preferably kills mollusks. MoUusks in the sense of the invention are preferably snails and slugs.
The active ingredient is a molluscicide, that is a substance active against mollusks, preferably against snails and slugs.
Methiocarb is 3,5-Dimethyl-4-(methylthio)phenyl methylcarbamate with CAS 2032-65-7.
The omega-ACTX-Hvla protein toxin is known in the art. It is a toxin isolated from the
funnel- web spider Hadroncyhe versuta. The terms "omega-ACTX-Hvla protein toxin", "omega-ACTX-Hvla toxin", "omega-ACTX-Hvla protein" and "omega-ACTX-Hvla" are used interchangeably herein, if not otherwise stated.
The amino acid sequence of omega-ACTX-Hvla is SEQ ID NO: 1 :
SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVK CD SEQ ID NO: l
A modified form of omega-ACTX-Hvla has a K34 alteration, using the amino acid numbering of SEQ ID NO: l; preferably, the amino acid K34 of omega-ACTX-Hvla is substituted. By "substituted" it is meant that the Lysine amino acid residue at the position 34 is replaced with another amino acid; preferably the 34Lys is substituted for Glutamine (this is called herein K34Q substitution according to the numbering of SEQ ID NO: 1). The amino acid sequence of the K34Q modified omega-ACTX-Hvla is SEQ ID NO:2: SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVQRCD SEQ ID NO:2
Preferably, the amino acid K34 of omega-ACTX-Hvla protein toxin is modified.
Preferably, the omega-ACTX-Hvla protein toxin has a K34Q substitution.
Preferably, the omega-ACTX-Hvla protein toxin comprises the amino acid sequence of SEQ
ID NO: l or of SEQ ID NO:2;
more preferably, the peptide toxin to be used in FUSP has the amino acid sequence of SEQ ID
NO: l or of SEQ ID NO:2.
"Fragment or variant" of omega-ACTX-Hvla includes that FUSP can comprise an amino acid sequence of omega-ACTX-Hvla that can vary from the sequence provided in SEQ ID NO: 1 or SEQ ID NO:2 with the proviso that the fragment or variant substantially retain the biological activity of the omega-ACTX-Hvla.
"Variants" of a polypeptide include insertions, deletions and substitutions, either conservative or non-conservative. This also includes where the peptide sequence omits several amino acids; preferably less than 5, 4, or 3 amino acids are deleted from the sequence provided in SEQ ID NO: l or SEQ ID NO:2. In particular variants of the polypeptide are included where such changes do not substantially alter the omega-ACTX-Hvla toxin activity. A skilled person knows that the sequence of SEQ ID NO: 1 or SEQ ID NO:2 can be altered without the loss of biological activity. In particular, single like for like changes with respect to the physio-chemical properties of the respective amino acid should not disturb the functionality, and moreover small deletions within non- functional regions of the toxin
peptide can also be tolerated and hence are considered "variants" for the purpose of the present invention.
By "conservative substitutions" is intended combinations such as Gly, Ala; Val, He, Leu; Asp, Glu; Asn, Gin; Ser, Thr; Lys, Arg; and Phe, Tyr.
It is particularly preferred if the variant has an amino acid sequence which has at least 75%, yet still more preferably at least 80%, in further preference at least 85%, in still further preference at least 90% and most preferably at least 95% or 97% identity with the amino acid sequence of the omega-ACTX-Hvla toxin provided herein.
The percent sequence identity between two polypeptides may be determined using suitable computer programs, for example the GAP program of the University of Wisconsin
Genetic Computing Group and it will be appreciated that percent identity is calculated in relation to polypeptides whose sequence has been aligned optimally.
There are also naturally occurring homologues to the omega-ACTX-Hvla peptide toxin which can also be used. Such homologues are considered to be "variants" as defined above. Hadroncyhe versuta also produces the toxins omega-hexatoxin-Hvle, omega- hexatoxin-Hvlc, omega- hexatoxin-Hv Id, and omega-hexatoxin-Hvlb which each have a very high level of sequence identity (only a few amino acid substitutions or deletions). The Sydney funnel- web spider (Atrax robustus) produces the peptide toxin omega-hexatoxin-Arld which has an identical amino acid sequence to omega-ACTX-Hvla, and omega- hexatoxin-Arlh and omegahexatoxin-Arlf which have a very high level of sequence identity (only a few amino acid substitutions or deletions).
Further peptide toxins are produced by the Toowoomba funnel- web spider, Hadronyche
infensa (omega-hexatoxin-Hilb lO, 8, 5, 2, 1 series; omega- hexatoxin-Hild; omega- hexatoxin-Hile; omega-hexatoxin-Hilf) and the Tasmanian funnel- web spider,
Hadronyche venenata (omega-hexatoxin-Hvnlb_6, _ 4, _3, _2, _1 series) and the
Northern tree-dwelling funnel- web spider Hadronyche formidabilis (omega-hexatoxin- Hfla). The peptide toxins listed above have only a few amino acid substitutions or deletions to the amino acid sequence for the omega-ACTX-Hvla peptide toxin of SEQ ID NO: l or SEQ ID NO:2. Therefore each of these peptides toxins are considered to be homologous peptides to the omega- ACTX-Hvl a peptide toxin of SEQ ID NO: 1 or SEQ
ID NO:2 and hence can be used in FUSP, and are embodiments of the invention.
Further information concerning homologous peptide toxins may be found in the GenBank database. The ArachnoServer database is also very helpful (www.arachnoserver.org) as it includes information regarding a large number of spider toxins, arranged by toxin type
and species. From the information provided in the databases above and by using the well- known BLAST search, the skilled person can readily identify additional peptide toxins that can be used.
Preferably, the first and second portions (i) and (ii) of FUSP are linked together by genetic or biochemical means and so, in the first instance, by at least one linking amino acid residue or peptide or, in the second instance, by a covalent or non-covalent bond or bonds or other linking moiety. Where a peptide is used to link said members together the number of amino acid residues in the peptide is variable, and is determined by the distance between the relevant ends of each member necessary to allow FUSP to be in a biologically active conformation. The portions of FUSP may be reversibly linked by means adapted to dissociate and release the toxic agent in situ in an invertebrate gut or circulatory system, for example on being metabolised by an invertebrate animal or may be irreversibly linked, depending on the form of the toxic agent.
The second portion of FUSP aids passage of the toxic member through the invertebrate gut, this allowing the protein to move to a site of toxicity in the invertebrate animal. The second portion can be considered as a translocating moiety that is capable of acting as a carrier to translocate the first portion across the gut wall of an invertebrate animal. Thus, FUSP can be used as a pesticide by delivering a toxin to a site of toxicity in an
invertebrate pest animal.
The protein capable of mediating translocation of FUSP from the invertebrate gut preferably mediates the translocation of FUSP from the invertebrate gut to the circulatory system of an invertebrate animal, preferably of insects, molluscs and nematodes, more preferably of moluscs.
Suitable proteins capable of mediating translocation of FUSP from the invertebrate gut include plant lectins.
Generally any lectin that binds to invertebrate gut can be used.
Preferably, the protein capable of mediating translocation of FUSP from the invertebrate gut is a plant lectin selected from any one or more of the following: snowdrop lectin Galanthus nivalis agglutinin (GNA), garlic lectin Allium sativum, pea lectin Pisum sativum (P-lec),
peanut lectin Arachis hypogaea, french bean lectin (PHA, Phytohaemoglutinin), or fragments, variants or derivatives thereof.
"Fragment or variant" of the plant lectin includes that the amino acid sequence of the
particular lectin protein can differ from that known in the art and that naturally occurring, with the proviso that the fragment or variant substantially retain the biological activity of the lectin, i.e. be capable of mediating translocation of FUSP from the invertebrate gut.
Preferably, the lectin is GNA.
In example for the amino acid sequence of GNA is SEQ ID NO:3:
DNILYSGETLSTGEFLNYGSFVFIMQEDCNLVLYDVDKPIWATNTGGLSRSCFLSMQT DGNLVVYNPSNKPIWASNTGGQNGNYVCILQKDRNVVIYGTDRWATG
Preferably, the GNA comprises the amino acid sequence of SEQ ID NO:3. Preferably, FUSP further comprises an affinity tag to aid purification. The use of short amino acid tag sequences to aid the affinity purification of recombinant
proteins is well known in the art. Indeed, many commercially available protein expression constructs include nucleic acid sequences encoding such tags. The protein of interest is inserted into the expression construct in such a manner that the affinity tag is linked to said protein. A variety of different affinity tags are known in the art, including chitin binding protein (CBP), maltose binding protein (MBP), glutathione-S-transferase (GST), and the His-tag.
A polyhistidine-tag is an amino acid motif in proteins that consists of at least five histidine (His) residues, often at the N- or C-terminus of the protein. It is also known as hexa histidine-tag, 6xHis-tag, and by the trademarked name His-tag®. They are a well known affinity tag and methods of introducing His-tags to recombinant proteins are known in art, as are routine methods of purifying proteins with His-tags.
Preferably, the affinity tag is a His tag.
In one embodiment, the second portion, which is preferably GNA, is located at the N-terminus of the omega-ACTX-Hvla protein toxin. Hence such a FUSP has the arrangement: NH2- (GNA: omega- ACTX-Hvla)-COOH, such as the peptide with SEQ ID NO: 4:
DNILYSGETLSTGEFLNYGSFVFIMQEDCNLVLYDVDKPIWATNTGGLSRSCFLSMQT DGNLVVYNPSNKPIWASNTGGQNGNYVCILQKDRNVVIYGTDRWATGAAASPTCIPS GQPCP YNENCC S Q S CTFKENENGNT VKRCD VDHHHHHH SEQ ID NO:4
The peptide of SEQ ID NO:4 has a six amino acid HIS tag placed at the C-terminus. The HIS tag can be used to aid recovery of FUSP when prepared as part of a recombinant protein expression system. However, the presence of the HIS tag is optional and therefore a variant of SEQ ID NO:4 can include that peptide sequence without the HIS tag.
In another embodiment, FUSP is NH2-(GNA: MODIFIED omega- ACTX-Hvla)-COOH with SEQ ID NO:5:
HHHHHHDNILYSGETLSTGEFLNYGSFVFIMQEDCNLVLYDVDKPIWATNTGGLSRSC FLSMQTDGNLVVYNPSNKPIWASNTGGQNGNYVCILQKDRNVVIYGTDRWATGAAA SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVQRCD SEQ ID NO:5
In this embodiment the HIS tag placed at the N-terminus. Similar to SEQ ID NO:4, the HIS tag is optional and therefore a variant of SEQ ID NO: 5 can include that peptide sequence without the HIS tag.
Also, SEQ ID NO:5 includes the modified amino acid sequence of omega-ACTX-Hvla, i.e. having a K34Q substitution as discussed above and as provided in SEQ ID NO:2.
The location of omega-ACTX-Hvla at the N-terminus relative to GNA in FUSP can have a greater pesticide effect, hence this arrangement is a preferred embodiment of the invention.
Therefore a preferred embodiment of the invention is wherein the GNA peptide is located at the C-terminus of the omega- ACTX-Hvl a protein toxin, such as the FUSP arrangements:
NH2-(omega-ACTX-Hvla: GNA)-COOH with SEQ ID NO:6:
ASPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCDAAADNILYSGETLSTGEFLNY GSFVFIMQEDCNLVLYDVDKPIWATNTGGLSRSCFLSMQTDGNLVVYNPSNKPIWAS NTGGQNGNYVCILQKDRNVVIYGTDRWATG SEQ ID NO:6
NH2-(omega-ACTX-Hvla: GNA: HIS)-COOH with SEQ ID NO:7:
ASPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCDAAADNILYSGETLSTGEFLNY GSFVFIMQEDCNLVLYDVDKPIWATNTGGLSRSCFLSMQTDGNLVVYNPSNKPIWAS NTGGQNGNYVCILQKDRNVVIYGTDRWATGVDHHHHHH SEQ ID NO:7
In this embodiment the HIS tag placed at the C-terminus. Similar to SEQ ID NO:4, the HIS tag is optional.
NH2-(MODIFIED omega-ACTX-Hvla: GNA)-COOH with SEQ ID NO:8:
ASPTCIPSGQPCPYNENCCSQSCTFKENENGNTVQRCDAAADNILYSGETLSTGEFLNY GSFVFIMQEDCNLVLYDVDKPIWATNTGGLSRSCFLSMQTDGNLVVYNPSNKPIWAS NTGGQNGNYVCILQKDRNVVIYGTDRWATG SEQ ID NO: 8
Also, SEQ ID NO:8 includes the modified amino acid sequence of omega-ACTX-Hvla, i.e. having a K34Q substitution as discussed above and as provided in SEQ ID NO:2. NH2-(MODIFIED omega-ACTX-Hvla: GNA: HIS)-COOH with SEQ ID NO:9:
ASPTCIPSGQPCPYNENCCSQSCTFKENENGNTVQRCDAAADNILYSGETLSTGEFLNY GSFVFIMQEDCNLVLYDVDKPIWATNTGGLSRSCFLSMQTDGNLVVYNPSNKPIWAS NTGGQNGNYVCILQKDRNVVIYGTDRWATGHHHHHH SEQ ID NO:9
In this embodiment the HIS tag placed at the C-terminus. FUSP with in SEQ 10 NO:9 is a particularly preferred embodiment of the invention
SEQ ID NOs 1 to 9 have been copied from WO 2012/131302 Al, in case of a typo or discrepancy the version of the sequences as published in WO 2012/131302 Al prevails.
Preferably, FUSP comprises the amino acid sequence of any of SEQ ID NOs 4, 5, 6, 7, 8 or 9.
Preferably, the omega-ACTX-Hvla protein toxin is linked to the N-terminus of the protein capable of mediating translocation of FUSP from the invertebrate gut.
Preferably, FUSP comprises the amino acid sequence of any of SEQ ID NOs 6, 7, 8 or 9.
FUSP may be presented as a substantially purified form or preparation. By "purified" is meant that FUSP has been at least partially separated from other components in the presence of which it has been formed, for example other components of a recombinant cell. Methods of purification are known to the skilled person.
The form or preparation of FUSP may be substantially pure. By "substantially pure" it is
meant that the FUSP is substantially free of other proteins. Thus, any form or preparation of FUSP is included that includes at least 30% of the protein content by weight as FUSP , preferably at least 50%, more preferably at least 70%, still more preferably at least 90% and most preferably at least 95% of the protein content is FUSP, based on the total weight of the form or preparation of FUSP.
Thus, FUSP includes compositions comprising the said FUSP and a contaminant wherein the contaminant comprises less than 70% of the composition by weight, preferably less than 50% of the composition, more preferably less than 30% of the composition, still more preferably less than 10% of the composition and most preferably less than 5% of the composition by weight.
The invention also includes the substantially pure FUSP when combined with other
components ex vivo, said other components not being all of the components found in the cell in which said polypeptides are found. Methods for preparation for FUSP are known.
Preferably, the active ingredient is metaldehyde.
Preferably, the composition has the form of a homogeneous mixture of its components.
The acrylamide based polymer, in the sense of the invention, is selected from the group consisting of polyacrylamide, copolymer of acrylic acid and acrylamide, and mixtures thereof.
Polyacrylamide can be a non- ionic, a cationic or a anionic polyacrylamide, preferably it is a non-ionic or a cationic polyacrylamide; more preferably it is a non-ionic polyacrylamide.
Preferably, the wax based on polyethylene glycol or polypropylene glycol as alcohol
component have as acid component a carboxylic acid; the carboxylic acid is preferably a C9-26 fatty acid;
more preferably, the wax based on polyethylene glycol or polypropylene glycol as alcohol component are polyethylene glycol mono stearate or polyethylene glycol mono oleate.
Preferably, the disintegrant is acrylamide based polymer, sodium salt of polymerized alkyl naphthalene sulfonic acid, or a mixture thereof.
Additionally to any other components, the composition can comprise a bulking agent;
the bulking agent is selected from the group consisting of phyllosihcate, calcium carbonate, silica, starch, limestone, and mixtures thereof.
Phyllosilicates can be clays and clay minerals. Examples are kaolin, bentonite and their
components kaolinite and montmorillonite. One type of kaolin is commercially available under the name "bolus alba". The preferred phyllo silicate is kaoline.
Starch can be used as such or as pregelatinised starch, preferably as pregelatinised starch.
Preferably, the bulking agent is selected from the group consisting of phyllosihcate, calcium carbonate, limestone, and mixtures thereof.
Preferably, the composition comprises the active ingredient, the disintegrant and the bulking agent; also in combination with the embodiments of these three components.
In one more preferred embodiment the composition comprises the active ingredient
metaldehyde, the disintegrant acrylamide based polymer, sodium salt of polymerized
alkyl naphthalene sulfonic acid or a mixture of acrylamide based polymer and sodium salt of polymerized alkyl naphthalene sulfonic acid, and the bulking agent phyllosilicate, calcium carbonate, limestone, or mixtures thereof;
more preferably, the composition comprises the active ingredient metaldehyde, the
disintegrant acrylamide based polymer, and the bulking agent phyllosilicate, calcium carbonate or mixtures thereof;
even more preferably, the composition comprises the active ingredient metaldehyde, the
disintegrant acrylamide based polymer, and the bulking agent phyllosilicate.
Additionally to any other components, the composition can comprise a wetting agent;
the wetting agent is water or polyvinyl alcohol, preferably the wetting agent is water.
More preferably, the composition comprises the active ingredient, the disintegrant, the bulking agent and the wetting agent; also in combination with the embodiments of these four components.
In one more preferred embodiment the composition comprises the active ingredient
metaldehyde, the disintegrant acrylamide based polymer, sodium salt of polymerized alkyl naphthalene sulfonic acid or a mixture of acrylamide based polymer and sodium salt of polymerized alkyl naphthalene sulfonic acid, the bulking agent phyllosilicate, calcium carbonate, limestone, or mixtures thereof, and the wetting agent.
In one especial embodiment, the composition comprises the active ingredient metaldehyde, the disintegrant acrylamide based polymer, the bulking agent phyllosilicate or calcium carbonate, and the wetting agent water.
In another especial embodiment, the composition comprises the active ingredient
metaldehyde, the disintegrant sodium salt of polymerized alkyl naphthalene sulfonic acid, the bulking agent phyllosilicate, limestone, or mixtures thereof, and the wetting agent polyvinyl alcohol.
Additionally to any other components, the composition can comprise an additive;
the additive is selected from the group consisting of sodium propionate, magnesium stearate, nicotinamide, sodium bicarbonate, and mixtures thereof.
Preferably, the additive is selected from the group consisting of sodium propionate, magnesium stearate, sodium bicarbonate, and mixtures thereof.
In another preferred embodiment, the composition comprises the active ingredient
metaldehyde, the disintegrant acrylamide based polymer, and the bulking agent phyllosilicate, calcium carbonate or mixtures thereof, and the additive sodium propionate, magnesium stearate or mixtures thereof;
in a more preferably, the composition comprises the active ingredient metaldehyde, the
disintegrant acrylamide based polymer, the bulking agent phyllosilicate, and the additive sodium propionate.
In another more preferred embodiment, the composition comprises the active ingredient
metaldehyde, the disintegrant acrylamide based polymer, and the bulking agent phyllosilicate, calcium carbonate or mixtures thereof, the additive sodium propionate, magnesium stearate or mixtures thereof, and the wetting agent water;
in a more preferably, the composition comprises the active ingredient metaldehyde, the
disintegrant acrylamide based polymer, the bulking agent phyllosilicate, the additive sodium propionate, and the wetting agent water. Additionally to any other components, the compositions can comprise known anti mold
agents, such as C1-10 alkyl isothiazolinon, 2-butyl-l,2-benzisothiazolin-3-one, phenoxy ethanol, zinc pyrithion and the like.
Preferably, the C1-10 alkyl isothiazolinon is a C1-10 alkyl 4-isothiazolin-3-on, more preferably it is selected from the group consisting of methylisothiazolinon, butylisothiazolinon, and octylisothiazolinon.
Further known anti mold agents are published in the book Microbicides for the Protection of
Materials, edited by W. Paulus, Springer; 2005 edition.
The additive sodium propionate shows also anti mold activity.
Preferably, the composition comprises
the active ingredient in an amount of from 7 to 60 wt%, the wt% being based on the total weight of the composition.
More preferably, the composition, when it comprises metaldehyde, comprises metaldehyde in an amount of from 7 to 55 wt%, the wt% being based on the total weight of the composition.
Embodiments of the possible ranges of the amount of metaldehyde are: 7.5 to 52.5 wt%, 7.5 to 32.5 wt% and 7.5 to 25 wt% of metaldehyde, the wt% being based on the total weight of the composition.
More preferably, the composition, when it comprises iron(III) phosphate, comprises iron(III) phosphate in an amount of from 5 to 15 wt%, the wt% being based on the total weight of the composition.
More preferably, the composition, when it comprises metaldehyde and iron(III) phosphate, comprises metaldehyde in an amount of from 10 to 25 wt% and iron(III) phosphate in an amount of from 5 to 15 wt%, the wt% being based on the total weight of the composition.
More preferably, the composition, when it comprises niclosamide, comprises niclosamide in an amount of from 15 to 30 wt%, the wt% being based on the total weight of the composition. More preferably, the composition, when it comprises niclosamide ethanolamine salt,
comprises niclosamide ethanolamine salt in an amount of from 15 to 30 wt%, the wt% being based on the total weight of the composition.
More preferably, the composition, when it comprises iron(III) pyrophosphate, comprises
iron(III) pyrophosphate in an amount of from 10 to 30 wt%, the wt% being based on the total weight of the composition.
More preferably, the composition, when it comprises saponin, comprises saponin in an amount of from 17.5 to 52.5 wt%, the wt% being based on the total weight of the composition.
More preferably, the composition, when it comprises FUSP, comprises FUSP in an amount of from 20 to 30 wt%, the wt% being based on the total weight of the composition.
Preferably, the composition comprises
the disintegrant in an amount of from 5 to 80 wt%, the wt% being based on the total weight of the composition.
Preferably, when a bulking agent is present in the composition, then the composition
comprises the bulking agent in an amount of from 1 to 70 wt%, the wt% being based on the total weight of the composition.
Preferably, when an additive agent is present in the composition, then the composition
comprises the additive in an amount of from 1 to 15 wt%, the wt% being based on the total weight of the composition.
Preferably, when a wetting agent is present in the composition, then the composition
comprises the wetting agent in an amount of from 0.5 to 75 wt%;
more preferably, when a wetting agent is present in the composition, then the composition comprises the wetting agent in an amount of from 20 to 75 wt% in case the wetting agent is water, or in an amount of from 0.5 to 3 wt% in case the wetting agent is polyvinyl alcohol, the wt% being based on the total weight of the composition.
Preferably, the composition comprises
the active ingredient in an amount of from 7.5 to 52.5 wt%,
the disintegrant in an amount of from 0.5 to 20 wt%,
the bulking agent in an amount of from 7.5 to 70 wt%,
the wetting agent in an amount of from 0.5 to 70 wt%;
the wt% being based on the total weight of the composition.
More preferably, the composition comprises
the active ingredient in an amount of from 7.5 to 32.5 wt%,
the disintegrant, in case that the disintegrant is acrylamide based polymer, in an amount of from 5 to 20 wt%, or
the disintegrant in case that the disintegrant is sodium salt of polymerized alkyl naphthalene sulfonic acid, in an amount of from 0.5 to 2 wt%,
the bulking agent, in case that the disintegrant is acrylamide based polymer, in an amount of from 7.5 to 30 wt%, or
the bulking agent, in case that the disintegrant is sodium salt of polymerized alkyl naphthalene sulfonic acid, in an amount of from 25 to 70 wt%,
the wetting agent, in case that the wetting is water, in an amount of from 20 to 75 wt%, or the wetting agent, in case that the wetting is s polyvinyl alcohol, in an amount of from 0.5 to 3 wt%;
the wt% being based on the total weight of the composition,
In an even more preferred embodiment, the composition comprises
the active ingredient in an amount of from 7.5 to 32.5 wt%,
the disintegrant as acrylamide based polymer in an amount of from 5 to 20 wt%,
the bulking agent in an amount of from 7.5 to 30 wt%,
the wetting agent as water, in an amount of from 20 to 75 wt%;
the wt% being based on the total weight of the composition. In another even more preferred embodiment, the composition comprises
the active ingredient in an amount of from 7.5 to 32.5 wt%,
the disintegrant as sodium salt of polymerized alkyl naphthalene sulfonic acid in an amount of from 0.5 to 2 wt%,
the bulking agent in an amount of from 25 to 70 wt%,
the wetting agent as polyvinyl alcohol in an amount of from 0.5 to 3 wt%;
the wt% being based on the total weight of the composition.
In an especially preferred embodiment, the composition comprises
the active ingredient in an amount of from 10 to 30 wt%,
the disintegrant as acrylamide based polymer in an amount of from 7 to 17 wt%,
the bulking agent in an amount of from 10 to 30 wt%,
the wetting agent as water, in an amount of from 25 to 55 wt%;
the wt% being based on the total weight of the composition. In an especially preferred embodiment, the composition comprises
the active ingredient in an amount of from 10 to 30 wt%,
the disintegrant as acrylamide based polymer in an amount of from 7 to 17 wt%,
the bulking agent in an amount of from 10 to 30 wt%,
the wetting agent as water, in an amount of from 25 to 55 wt%;
the additive, preferably as sodium propionate, in an amount of from 5 to 10 wt%; the wt% being based on the total weight of the composition.
In an especially preferred embodiment, the composition contains
the active ingredient in an amount of from 7.5 to 32.5 wt%,
the disintegrant as acrylamide based polymer in an amount of from 5 to 20 wt%,
the bulking agent in an amount of from 7.5 to 30 wt%,
the wetting agent as water, in an amount of from 20 to 75 wt%;
the wt% being based on the total weight of the composition, and the amount of the
components relative to each other is chosen in such a way that the wt% add up to 100%.
In an especially embodiment, the composition contains
the active ingredient in an amount of from 7.5 to 32.5 wt%,
the disintegrant as sodium salt of polymerized alkyl naphthalene sulfonic acid in an amount of from 0.5 to 2 wt%,
the bulking agent in an amount of from 25 to 70 wt%,
the wetting agent as polyvinyl alcohol in an amount of from 0.5 to 3 wt%;
the wt% being based on the total weight of the composition, and the amount of the
components relative to each other is chosen in such a way that the wt% add up to 100%.
In an especially preferred embodiment, the composition contains
the active ingredient in an amount of from 10 to 30 wt%,
the disintegrant as acrylamide based polymer in an amount of from 7 to 17 wt%,
the bulking agent in an amount of from 10 to 30 wt%,
the wetting agent as water, in an amount of from 25 to 55 wt%;
the additive, preferably as sodium propionate, in an amount of from 5 to 10 wt%;
the wt% being based on the total weight of the composition, and the amount of the
components relative to each other is chosen in such a way that the wt% add up to 100%.
Further possible ranges of the amounts of the components in the compositions are shown in Table 4, preferred ranged are those of the compositions Kal, Ka2, Cal, G1A, GIB, G1C and G1D.
Table 4
CO AI [g] BA [g] DI [g] ADD [g] WA [g]
Kal Meta 10 Kaoline 10 FA920 6.17 SP 1 W 26 to to to to to
49 26 12.55 14 62.5
KaFel Meta 12.1 Kaoline 12.1 FA920 7.25 SP 6.1 w 23.2 to to to to to
23.2 23.2 15.15 11.6 48.5
FeP04 6.1
to
11.6
Ka2 Meta 10 Kaoline 10 FO4490 6.17 SP 5 w 62.5 to to to
49 26 12.55
Nil Nicl 23.19 Kaoline 23.19 FA920 7.26 SP 11.5 w 34.78
Ni2 NiclEt 23.19 Kaoline 23.19 FA920 7.26 SP 11.5 w 34.78
Pal Meta 10 — FA920 12.5 SP 5 w 72.5
Pa2 Meta 10 — FO4490 12.5 SP 5 w 72.5
Cal Meta 10 CaCOs 10 FA920 6.17 SP 1 w 26 to to to to to
49 26 12.55 14 62.5
Sil Meta 10 Silica 10 FA920 12.5 SP 5 w 51.6 to to to to to
12.9 12.9 16.13 6.45 62.5
Stl Meta 7 Stygel 1.75 FA920 7 ... w 30 to to to
28 17.5 54.25
2A Meta 20 — MC 78 MgSt 2 ... ...
4A Meta 20 CaCOs 20 MC 58 MgSt 2 ... ...
8A Meta 20 CaCOs 40 MC 38 MgSt 2 ... ...
10A Meta 20 CaCOs 70 MC 8 MgSt 2 ... ...
W1A Meta 50 ... ... Peg400 50 ... ... ...
W1B Meta 50 ... ... Peg50 50 ... ... ...
G1A Meta 30 LS 38 Dar670 1 — PVA 1
Kaoline 27
Sipernat 1
GIB Meta 30 LS 38 Dar670 1 NA 2 PVA 1
Kaoline 27
Sipernat 1
G1C Meta 30 LS 38 Dar670 1 NaBI 2 PVA 1
Kaoline 27
Sipernat 1
ID Meta 30 LS 65 Dar670 1 NA 2 PVA 1
Sipernat 1 NaBI 2
Preferably, the compositions Kal, Ka2, Cal, WIA, WIB, GIA, GIB, GIC and GID in Table 4 can contain FePP or a combination of Meta and FePP instead of the active ingredient stated in Table 4.
Further subject of the invention is a method for preparation of the molluscicidal compositions, the method comprises a premixing of the components to provide a premixture and comprises a shaping of a premixture of the components, with the molluscicidal compositions as defined herein, also with all its embodiment.
The shaping is preferably done by pressing or cutting or first pressing and then cutting a
premixture of the components into shape.
In case that a wetting agent is part of the composition, the wetting agent can be mixed with the other components in the premixing providing the premixture, or a first premixture is prepared by mixing the components except for the wetting agent, and then the wetting agent is mixed with the first premixture to provide a second premixture containing the wetting agent, this second premixture then is pressed or cut into shape. If the composition is damp or moist after the shaping then the composition is dried after shaping. This can be especially the case when a wetting agent is part of the composition. The final
compositions are dry.
Preferably, the mixing is done in such a way that any premixture and any composition
obtained from the premixture is a homogeneous mixture of the components.
For the mixing any known mixer can be used that is capable of mixing dry substances or that is capable of mixing pastes or doughs, this especially when a wetting agent is part of the composition. Possible mixers are for example extruders.
For the shaping by pressing or cutting any device can be used that is capable of pressing into shape a powder, a dough or a paste.
Preferably, the device used for mixing and shaping is a device that does both steps
simultaneously or at least consecutively, such as a granulating or pelleting device.
Examples suitable granulating or pelleting devices for both steps, the mixing and the shaping, are the commercially discs and drums as supplied by various manufacturers, such as
Eirich. Good results are achieved using the devices termed Eirich mixer/granulator. Using these, it is possible to make do with small amounts of wetting agent and thus to reduce the time and energy required for drying.
Drying is preferably carried out at a low temperature to avoid decomposition of any
components, such as metaldehyde, which is heat-sensitive.
The final compositions are provided after the shaping and optionally the drying in form of cubes, granules, pellets, tablets, and the like.
Therefore another subject of the invention is composition as defined herein in form of cubes, granules, pellets, tablets.
The diameter or the longest dimension of the final compositions is preferably between 1 mm and 15 mm, more preferably 3 mm and 10 mm.
Further subject of the invention is the use of the molluscicidal composition for controlling aquatic snails and slugs, with the molluscicidal compositions as defined herein, also with all its embodiment.
This control is done by application of the compositions to the water surface.
Further subject of the invention is a method for controlling aquatic snails and slugs, wherein the molluscicidal compositions are applied to the water surface, with the molluscicidal compositions as defined herein, also with all its embodiment.
The controlling of aquatic snails and slugs is in particular done in fish ponds or paddy fields.
The compositions act by releasing the active substance while being submerged under the water and lying on the ground. Therefore the components of the compositions are chosen in such a way that the final compositions after shaping show a density of greater than 1 in order to sink after the application to the water surface to the ground.
The rate of application depends, inter alia, on the size of the pest population and is, as a rule, from 0.1 to 10 g /m2, preferably 0.1 to 1 g/m2 (1 to 100 kg/ha, preferably, 1 to 10 kg/ha) based on the amount of active ingredient.
Examples
Compositions
Table 1 gives the list of materials.
Table 1
Name Product Specification Description Source identifier
Meta Meta® > 98 wt% Lonza Ltd
Metaldehyde
2,4,6,8-
Tetramethyl-
1,3,5,7-tetraoxa- cyclooctane
FeP04 Iron (III) Fe: 29% white powder Sigma- phosphate Aldrich dihydrate Co. LLC FeP04 x 2H20
FePP Fe4(P207)3; Iron content: Light Yellow to Sigma-
Diphosphoric 10.5 to 12.5% Very Dark Aldrich acid iron(III) Yellow and Co. LLC salt; Light Green to
Ferric Very Dark
pyrophosphate; Green
iron(III) and Yellow- pyrophosphate Green and
Green- Yellow
Crystals
Sap Saponin Sapogenin: Extracted from Sigma- 8 to 25% natural Aldrich resources Co. LLC
Nicl Niclosamide Appearance: Nantong
Light yellow Luosen powder; Chemical
Niclosamide: Co., Ltd.
>= 98.0%;
5-Chlorosalicylic
acid: <= 0.1%;
2-Chloro-4- nitro aniline:
<= 0.1%;
pH value: 6.0 to
9.0;
Moisture: <= 0.5%
NiclEt Niclosamide Appearance: Nantong ethanolamine Yellow uniform Luosen salt loose powder; Chemical
Niclosamide Co., Ltd. ethanolamine
salt: >= 98.0%;
Moisture:
<= 1.0%;
pH value: 6.0 to
9.0
Kaoline Kaoline clay X-Ray Diffraction Appearance Sigma- Conforms to Structure (Color): Aldrich
Loss on Drying: White to Light Co. LLC
< 2.0 wt% Yellow
pH: 3.5 - 5.0 Appearance
(Form):
Powder
CaCOs Appearance Sigma- (Color): White; Aldrich Appearance Co. LLC (Form): Powder;
Solubility
(Turbidity): Clear;
Solubility
(Color):
Colorless;
Purity Titration
by EDTA:
>= 99.0 %
Silica Silica gel, high- pore size 60 Fluka
purity grade Angstrom;
220 to 240 mesh
35 to 75 micro
meter
Stygel Stygel T Pregelatinised Tongaat
Starch Hulett,
South Africa
LS Limestone 0.1 to 0.6 mm particle FOB
size Alabaster,
Al, US (Southern Clay Brick)
FA920 FA 920 SH; Form: powder; Non-ionic SNF
FLOPAM; MW: high polyacrylamide Floerger,
PAA France
FO4490 FO 4490 SH; Form: powder; Cationic SNF
FLOPAM; MW: very high polyacrylamide Floerger, PAA France
MC Methyl Loss on drying Acros cellulose; <= 1.5 %; Organics microcrystalline, Residue after (as average particle ignition <= 0.05 Thermo size 50 micro %; Fisher meter Heavy metals (as Scientific
Pb) <= 10 ppm; Inc.) pH 5 to 7;
Particle size <= 1
% (> 250
micrometer),
<= 30 % (> 75
micrometer),
>=50 % (> 32
micrometer);
Appearance (Color):
White
Appearance (Form):
Crystalline powder
Infrared spectrometry:
Authentic
Peg400 Pegosperse 400 Acid Value: 10 polyethylene Lonza Ltd
DS Max.; glycol mono
Saponification oleate;
Value: 115 to 125%; nonionic and
Moisture: 1 compatible
Max.; with
Color, Gardner cationic,
1963: 1 Max.; amphoteric,
Melting Point: anionic, and
33°C; nonionic
Appearance at surface active
25°C: Solid; agents
pH (5%): 5
HLB: 8
Peg50 Pegosperse 50 Acid Value: 5; polyethylene Lonza Ltd
MS Saponification glycol mono
Value: 180 to stearate;
190%; nonionic
Moisture: 0.5; and compatible
Color, Gardner with cationic,
1963: 2 Max.; amphoteric,
Appearance at anionic, and
25°C: Beads; nonionic
pH (5%): 5.8; surface
HLB (hydrophilic- active agents
lipophilic balance): 2
Dar670 DARVAN® Color, Gardner, Composition: Vanderbilt
670 1% Solution: Sodium salts Minerals,
4 maximum; of polymerized LLC pH, 1% Solution: alkyl
8.0 to 10.5; naphthalene
Total Solids : sulfonic acids
92.0% minimum;
Moisture Physical State:
Content: Amber powder
8.0% maximum
Sipernat SIPERNAT® Specific surface (highly disperse Evonik
22 LS area (N2): 175 precipitated Industries m2/g; silica AG
Mean particle size: 3
micro
meter;
Particle size, d50:
8 micro meter;
Tamped density:
70 g/1;
Loss on drying:
6%;
Loss on ignition:
5%;
pH value: 6.2;
DBP absorption:
265 g / 100 g;
Si02 content:
98%;
Na content as Na20:
1%;
Fe content as Fe203:
0.03%;
Sulfate content as S03:
0.8%;
Sieve residue 45
micro meter
Spray: 0.0%
SP Sodium Appearance Sigma- propionate (Color): Aldrich
CH3CH2COONa White; Co. LLC
Appearance
(Form):
Powder;
Solubility
(Color):
Colorless to
Very Faint
Yellow;
Solubility
(Turbidity):
Clear 1 g/ml,
H20;
Titration with
HC104:
> 99.0%
MgSt Mg-stearate Titration Appearance Acros
3.8 to 5.0% Mg Complexometric (Color): White Organics
3.8 to 5.0 % to almost white (as (Mg) On dried Appearance Thermo substance; (Form): Powder Fisher GC >=40.0 % Infrared Scientific relative content of spectrometry: Inc.) stearic acid, Authentic
>=90.0 % rel. content of
stearic and palmitic acid;
Loss on drying
<= 6 % (1 g,
105°C);
Heavy metals (as
Pb) <= 40 ppm,
Cd <= 3 ppm,
Ni <= 5 ppm,
Pb <=10 ppm;
Cl <= 1000 ppm;
S04 <=1 %
NA Nicotinamide; content >= 98 %; White powder; Lonza Ltd
Niacinamide pH: 6.0 to 7.5 technical
(50g/L; 20°C) quality
NaBI NaHCOs NH4: <= 5 ppm; Sigma-
Appearance Aldrich Co.
(Color): White; LLC
Appearance
(Form): Powder;
Content: 99.7 to
100.3%;
Ca: <= 0.02%;
CI: <= 0.003%;
Heavy Metals:
<= 5 ppm;
Insoluble
Matter:
<= 0.015%;
Fe: <= 0.001%;
Mg: <= 0.005%;
P04: <= 0.001%;
K: <= 0.005%
W Water Deionized Lonza Ltd water
PVA SELVOL™ E Viscosity (cps): Sekisui
103; 3.5 - 4.5; Chemical
Polyvinyl Degree of Co., Ltd alcohol Hydrolysis Mol
%: 98.0 - 98.8;
Ash wt%: 1.2
Max.;
Volatile wt %:
5.0 Max.;
pH: 5.0 - 7.0;
Methanol wt%:
0.9 Max;
VOC wt%: 1.0
Max
Preparation of Compositions
If not stated otherwise, the compositions were prepared in the following manner:
The active ingredient, bulking agent, disintegrant, and additive (as was the case and as indicated in table 2) were premixed in the respective quantities to yield a homogenous premixture. The resulting premixture was either directly pressed and/or cut in shape into shape, or optionally the premixture was mixed with a wetting agent to yield a homogenous mixture that was subsequently pressed and/or cut in shape.
Mixing was done in a beaker and shaping was done either with a cake form or by pressing the mixture through a nozzle and then cutting into shape.
Table 2 shows the details of the different compositions.
Table 2
CO AI [g] BA [g] DI [g] ADD [g] WA [g]
1 Meta 10 Kaoline 10 FA920 12.5 SP 5 W 62.5
2 Meta 26.23 Kaoline 26.2 FA920 8.2 SP 13.11 w 26.23
3 Meta 20.51 Kaoline 20.5 FA920 12.82 SP 5.13 w 41.03
4 Meta 28.07 Kaoline 28.0 FA920 8.78 SP 7.02 w 28.07
5 Meta 24.62 Kaoline 24.6 FA920 7.69 SP 6.15 w 36.92
6 Meta 18.18 Kaoline 36.3 FA920 5.45 SP 3.64 w 36.36
7 Meta 26.67 Kaoline 26.6 FA920 4.00 SP 2.67 w 40.00
8 Meta 34.09 Kaoline 22.7 FA920 3.41 SP 5.68 w 34.09
9 Meta 34.09 Kaoline 22.7 FO4490 3.41 SP 5.68 w 34.09
10 Meta 44.12 Kaoline 14.7 FA920 4.41 SP 7.35 w 29.41
11 Meta 44.12 Kaoline 14.7 FO4490 4.41 SP 7.35 w 29.41
12 Meta 40.82 Kaoline 20.4 FA920 3.06 SP 5.10 w 30.61
13 Meta 40.82 Kaoline 20.4 FO4490 3.06 SP 5.10 w 30.61
14 Meta 12.90 Kaoline 12.9 FA920 16.13 SP 6.45 w 51.61
15 Meta 12.90 Kaoline 12.9 FO4490 16.13 SP 6.45 w 51.61
16 Meta 19.51 Kaoline 19.5 FA920 12.20 SP 9.76 w 39.02
Meta 19.51 Kaoline 19.5 FO4490 12.20 SP 9.76 W 39.02
Meta 45.45 Kaoline 22.7 FA920 5.68 SP 5.68 W 34.09
Meta 45.45 Kaoline 22.7 FO4490 5.68 SP 5.68 w 34.09
Meta 58.82 Kaoline 14.7 FA920 7.35 SP 7.35 w 44.12
Meta 58.82 Kaoline 14.7 FO4490 7.35 SP 7.35 w 44.12
Meta 42.11 Kaoline 14.0 FA920 8.77 SP 7.02 w 28.07
Meta 42.11 Kaoline 14.0 FO4490 8.77 SP 7.02 w 28.07
Meta 56.14 FA920 8.77 SP 7.02 w 28.07
Meta 56.14 FO4490 8.77 SP 7.02 w 28.07
Meta 43.84 Kaoline 10.9 FA920 6.85 SP 5.48 w 32.88
Meta 43.84 Kaoline 10.9 FO4490 6.85 SP 5.48 w 32.88
Meta 49.38 Kaoline 9.88 FA920 6.17 SP 4.94 w 29.63
Meta 49.38 Kaoline 9.88 FO4490 6.17 SP 4.94 w 29.63
Meta 12.64 Kaoline 12.6 FA920 15.80 SP 6.32 w 50.57
NA 2.02
Meta 12.64 Kaoline 12.6 FO4490 15.80 SP 6.32 w 50.57
NA 2.02
Meta 12.64 Kaoline 12.6 FA920 15.80 SP 6.32 w 50.57
NaBI 2.02
Meta 12.64 Kaoline 12.6 FO4490 15.80 SP 6.32 w 50.57
NaBI 2.02
Meta 12.1 Kaoline 12.1 FA920 15.15 SP 11.6 w 48.5 FeP04 6.1
Meta 22.38 Kaoline 22.3 FO4490 10.49 SP 11.19 w 33.56
Meta 26.23 Kaoline 26.2 FO4490 8.21 SP 13.11 w 26.23
Meta 17.39 Kaoline 17.3 FO4490 10.87 SP 8.70 w 34.78 CaCOs
10.8
Meta 15.53 Kaoline 31.0 FO4490 9.71 SP 7.77 w 31.07 CaCOs
FePP 6.1 CaCOs 5.5
Pool Tests - Study of Diffusion Kinetics
Diffusion rate of the active ingredient in water for the different compositions was determined in a static test setup comprising of a water pool of a defined length and a defined water height. The tested compositions was put in place at the center of the pool. Samples were taken at predefined and fixed sample points in a distance of 25, 50, and 75 cm from the center of the pool. Values given in the tables are the average of 4 different samples taken at 2 different sample points, these two different sample points had the same radial distance to the right and to the left of the composition. The amount of sample that was present in each experiment was adjusted to the total content of active ingredient in the respective composition to have an equal amount of active ingredient present in each experiment.
The results of the tested compositions with respect to their release of active ingredient are summarized in table 3. The performance of these different compositions was compared to the state of the art Lonza molluscicidal product J-LON-5, which is currently available on the market as snail and slug bait. J-LON-5 contains ca. 95 wt% of corn flour and 5 wt% of Meta as active ingredient.
The commercial product J-LON-5, that was used as comparative example in these release experiments, was also compared to a composition J-LON-5-LAB, that contained the same components as the commercial product J-LON-5, but that was prepared in the same way as the tested compositions of the instant invention. J-LON-5 -LAB showed the same release behavior of Meta as J-LON-5.
Table 3
Time Meta concentration [mg/L] from sample position at
CO
[h] 25 cm 50 cm 75 cm
J-LON-5 0 0 0 0
1 0 0 0
8 0 0 0.02
24 1.78 0.43 0.18
72 2.06 3.68 2.26
120 5.01 5.45 2.84
168 7.36 10.28 6.85
240 13.10 12.27 12.65
336 20.28 17.84 16.15
14 0 0 0 0
1 0 0 0
8 0 0 0
24 0.05 0.08 0.30
72 0.56 0.67 0.75
120 0.85 0.68 0.63
168 1.95 1.60 1.57
240 1.82 2.00 2.08
336 2.12 1.93 1.83
0 0 0 0
1 0.40 0.05 0.01
8 0.50 0.54 0.73
24 1.10 1.63 1.09
72 1.35 1.24 1.65
120 1.64 1.56 1.45
168 2.29 1.99 1.84
240 2.18 2.13 2.03
336 2.10 1.89 1.83
0 0 0 0
1 0.09 0 0
8 0.52 0.44 0
24 0.98 0.77 0.70
72 1.25 1.32 1.21
120 2.04 2.16 2.45
168 1.95 1.75 1.99
240 2.53 2.97 2.44
336
0 0 0 0
1 0.08 0.07 0
8 0 0.07 0.12
24 0.19 0.25 0.64
72 1.39 1.51 1.68
120 2.49 2.56 2.86
168 2.86 3.29 3.41
240 4.17 4.11 4.07
336
0 0 0 0
1 0 0 0
8 0.16 0 0
24 0.12 0.27 0.20
72 0.94 0.75 2.11
120 1.46 1.17 1.17
168 2.81 1.40 1.24
240 3.16 2.58 2.43
336 3.77 3.27 3.28
0 0 0 0
1 0.13 0 0
8 0.98 0.32 0.32
24 2.16 1.48 1.42
72 3.60 3.14 3.23
120 2.80 2.13 1.92
168 2.19 2.49 1.96
240 5.01 4.56 3.91
336 4.88 4.69 4.26
58 0 0 0 0
1 0 0 0
8 0 0 0
24 0 0 0
72 0.24 0.28 0.28
120 0.91 0.94 0.78
168 1.16 1.17 1.24
240 1.00 1.26 1.35
336 1.39 1.41 1.26
Preparation of Compositions with an Extruder
Materials used:
Extruder BTSK 20/40D, Buhler AG, Switzerland
Kaoline anhydrous, free flowing, Redi-Dri™, Sigma-Aldrich, 765453
Sodium propionate >= 99.0%: Sigma-Aldrich, PI 880
Preparation of a premix:
250 g of FA920, 1375 g of Kaoline, 125 g of sodium propionate and 750 g of Meta, all in powder form, were mixed to provide a homogeneous powder.
Extrusion
This homogeneous powder was charged continuously with a screw feeder into the extruder while separately from but simultaneously with the homogeneous powder charging water into the extruder at such a rate that the pressure in the extruder could be maintained between 48 and 69 bar. The temperature in the extruder was between 58 to 75 °C.
The product was extruded through a nozzle with a diameter of 2 mm and was cut by rotating baldes into pellets of defined length of 3 to 4 mm.
The pellets were dried under air atmosphere at ambient temperature.
Content of Meta in the pellets was about 30 wt%.
Sequence Listing Free Text
SEQUENCE LISTING <110> Lonza Ltd
<120> MOLLUSCICIDAL COMPOSITIONS
<130> LP2500PC00
<160> 9
<170> Patentln version 3.5 <210> 1
<211> 37
<212> PRT
<213> Artificial Sequence <220>
<223> Synthetic construct
<400> 1 Ser Pro Thr Cys lie Pro Ser Gly Gin Pro Cys Pro Tyr Asn Glu Asn 1 5 10 15
Cys Cys Ser Gin Ser Cys Thr Phe Lys Glu Asn Glu Asn Gly Asn Thr
20 25 30
Val Lys Arg Cys Asp
35
<210> 2
<211> 37
<212> PRT
<213> Artificial Sequence
Synthetic construct <400> 2
Ser Pro Thr Cys He Pro Ser Gly Gin Pro Cys Pro Tyr Asn Glu Asn 1 5 10 15
Cys Cys Ser Gin Ser Cys Thr Phe Lys Glu Asn Glu Asn Gly Asn Thr
20 25 30
Val Gin Arg Cys Asp
35
<210> 3
<211> 105
<212> PRT
<213> Artificial Sequence <220>
<223> Synthetic construct
<400> 3
Asp Asn He Leu Tyr Ser Gly Glu Thr Leu Ser Thr Gly Glu Phe Leu 1 5 10 15
Asn Tyr Gly Ser Phe Val Phe He Met Gin Glu Asp Cys Asn Leu Val 20 25 30
Leu Tyr Asp Val Asp Lys Pro He Trp Ala Thr Asn Thr Gly Gly Leu
35 40 45
Ser Arg Ser Cys Phe Leu Ser Met Gin Thr Asp Gly Asn Leu Val Val 50 55 60
Tyr Asn Pro Ser Asn Lys Pro He Trp Ala Ser Asn Thr Gly Gly Gin 65 70 75 80
Asn Gly Asn Tyr Val Cys He Leu Gin Lys Asp Arg Asn Val Val He
85 90 95
Tyr Gly Thr Asp Arg Trp Ala Thr Gly
100 105
<210> 4
<211> 153
<212> PRT
<213> Artificial Sequence
<220>
<223> Synthetic construct <400> 4
Asp Asn He Leu Tyr Ser Gly Glu Thr Leu Ser Thr Gly Glu Phe Leu 1 5 10 15
Asn Tyr Gly Ser Phe Val Phe He Met Gin Glu Asp Cys Asn Leu Val
20 25 30
Leu Tyr Asp Val Asp Lys Pro He Trp Ala Thr Asn Thr Gly Gly Leu
35 40 45
Ser Arg Ser Cys Phe Leu Ser Met Gin Thr Asp Gly Asn Leu Val Val 50 55 60
Tyr Asn Pro Ser Asn Lys Pro He Trp Ala Ser Asn Thr Gly Gly Gin 65 70 75 80
Asn Gly Asn Tyr Val Cys He Leu Gin Lys Asp Arg Asn Val Val He
85 90 95
Tyr Gly Thr Asp Arg Trp Ala Thr Gly Ala Ala Ala Ser Pro Thr Cys
100 105 110
He Pro Ser Gly Gin Pro Cys Pro Tyr Asn Glu Asn Cys Cys Ser Gin
115 120 125
Ser Cys Thr Phe Lys Glu Asn Glu Asn Gly Asn Thr Val Lys Arg Cys 130 135 140
Asp Val Asp His His His His His His
145 150
<210> 5
<211> 151
<212> PRT
<213> Artificial Sequence
<220>
<223> Synthetic construct <400> 5
His His His His His His Asp Asn lie Leu Tyr Ser Gly Glu Thr Leu 1 5 10 15
Ser Thr Gly Glu Phe Leu Asn Tyr Gly Ser Phe Val Phe lie Met Gin
20 25 30
Glu Asp Cys Asn Leu Val Leu Tyr Asp Val Asp Lys Pro lie Trp Ala
35 40 45
Thr Asn Thr Gly Gly Leu Ser Arg Ser Cys Phe Leu Ser Met Gin Thr 50 55 60
Asp Gly Asn Leu Val Val Tyr Asn Pro Ser Asn Lys Pro lie Trp Ala 65 70 75 80
Ser Asn Thr Gly Gly Gin Asn Gly Asn Tyr Val Cys He Leu Gin Lys
85 90 95
Asp Arg Asn Val Val He Tyr Gly Thr Asp Arg Trp Ala Thr Gly Ala
100 105 110
Ala Ala Ser Pro Thr Cys He Pro Ser Gly Gin Pro Cys Pro Tyr Asn
115 120 125
Glu Asn Cys Cys Ser Gin Ser Cys Thr Phe Lys Glu Asn Glu Asn Gly 130 135 140
Asn Thr Val Gin Arg Cys Asp
145 150
<210> 6
<211> 146
<212> PRT
<213> Artificial Sequence <220>
<223> Synthetic construct
<400> 6
Ala Ser Pro Thr Cys He Pro Ser Gly Gin Pro Cys Pro Tyr Asn Glu 1 5 10 15
Asn Cys Cys Ser Gin Ser Cys Thr Phe Lys Glu Asn Glu Asn Gly Asn 20 25 30
Thr Val Lys Arg Cys Asp Ala Ala Ala Asp Asn He Leu Tyr Ser Gly
35 40 45
Glu Thr Leu Ser Thr Gly Glu Phe Leu Asn Tyr Gly Ser Phe Val Phe 50 55 60
He Met Gin Glu Asp Cys Asn Leu Val Leu Tyr Asp Val Asp Lys Pro 65 70 75 80
He Trp Ala Thr Asn Thr Gly Gly Leu Ser Arg Ser Cys Phe Leu Ser
85 90 95
Met Gin Thr Asp Gly Asn Leu Val Val Tyr Asn Pro Ser Asn Lys Pro
100 105 110
He Trp Ala Ser Asn Thr Gly Gly Gin Asn Gly Asn Tyr Val Cys He
115 120 125
Leu Gin Lys Asp Arg Asn Val Val He Tyr Gly Thr Asp Arg Trp Ala 130 135 140
Thr Gly
145
<210> 7
<211> 154
<212> PRT
<213> Artificial Sequence
Synthetic construct <400> 7
Ala Ser Pro Thr Cys lie Pro Ser Gly Gin Pro Cys Pro Tyr Asn Glu 1 5 10 15
Asn Cys Cys Ser Gin Ser Cys Thr Phe Lys Glu Asn Glu Asn Gly Asn
20 25 30
Thr Val Lys Arg Cys Asp Ala Ala Ala Asp Asn lie Leu Tyr Ser Gly
35 40 45
Glu Thr Leu Ser Thr Gly Glu Phe Leu Asn Tyr Gly Ser Phe Val Phe 50 55 60
lie Met Gin Glu Asp Cys Asn Leu Val Leu Tyr Asp Val Asp Lys Pro 65 70 75 80
lie Trp Ala Thr Asn Thr Gly Gly Leu Ser Arg Ser Cys Phe Leu Ser
85 90 95
Met Gin Thr Asp Gly Asn Leu Val Val Tyr Asn Pro Ser Asn Lys Pro 100 105 110
lie Trp Ala Ser Asn Thr Gly Gly Gin Asn Gly Asn Tyr Val Cys lie
115 120 125
Leu Gin Lys Asp Arg Asn Val Val lie Tyr Gly Thr Asp Arg Trp Ala 130 135 140
Thr Gly Val Asp His His His His His His
145 150
<210>
<211> 146
<212> PRT
<213> Artificial Sequence
<220>
<223> Synthetic construct <400>
Ala Ser Pro Thr Cys lie Pro Ser Gly Gin Pro Cys Pro Tyr Asn Glu 1 5 10 15
Asn Cys Cys Ser Gin Ser Cys Thr Phe Lys Glu Asn Glu Asn Gly Asn
20 25 30
Thr Val Gin Arg Cys Asp Ala Ala Ala Asp Asn lie Leu Tyr Ser Gly
35 40 45
Glu Thr Leu Ser Thr Gly Glu Phe Leu Asn Tyr Gly Ser Phe Val Phe 50 55 60
He Met Gin Glu Asp Cys Asn Leu Val Leu Tyr Asp Val Asp Lys Pro 65 70 75 80
He Trp Ala Thr Asn Thr Gly Gly Leu Ser Arg Ser Cys Phe Leu Ser
85 90 95
Met Gin Thr Asp Gly Asn Leu Val Val Tyr Asn Pro Ser Asn Lys Pro
100 105 110
He Trp Ala Ser Asn Thr Gly Gly Gin Asn Gly Asn Tyr Val Cys He
115 120 125
Leu Gin Lys Asp Arg Asn Val Val He Tyr Gly Thr Asp Arg Trp Ala 130 135 140
Thr Gly
145
<210> 9
<211> 152
<212> PRT
<213> Artificial Sequence
<220 >
<223> Synthetic construct <400 > 9
Ala Ser Pro Thr Cys He Pro Ser Gly Gin Pro Cys Pro Tyr Asn Glu 1 5 10 15
Asn Cys Cys Ser Gin Ser Cys Thr Phe Lys Glu Asn Glu Asn Gly Asn
20 25 30
Thr Val Gin Arg Cys Asp Ala Ala Ala Asp Asn He Leu Tyr Ser Gly
35 40 45
Glu Thr Leu Ser Thr Gly Glu Phe Leu Asn Tyr Gly Ser Phe Val Phe 50 55 60
He Met Gin Glu Asp Cys Asn Leu Val Leu Tyr Asp Val Asp Lys Pro 65 70 75 80
He Trp Ala Thr Asn Thr Gly Gly Leu Ser Arg Ser Cys Phe Leu Ser
85 90 95
Met Gin Thr Asp Gly Asn Leu Val Val Tyr Asn Pro Ser Asn Lys Pro
100 105 110
He Trp Ala Ser Asn Thr Gly Gly Gin Asn Gly Asn Tyr Val Cys He
115 120 125
Leu Gin Lys Asp Arg Asn Val Val He Tyr Gly Thr Asp Arg Trp Ala 130 135 140
Thr Gly His His His His His His
Claims
1. A molluscicidal composition comprising as components
an active ingredient and
a disintegrant;
wherein
the active ingredient is selected from the group consisting of metaldehyde, iron(III) phosphate, iron(III) pyrophosphate, saponin, niclosamide, niclosamide ethanolamine salt, methiocarb, a fusion protein FUSP, and mixtures thereof; the disintegrant is acrylamide based polymer;
FSUP comprises: (i) an omega-ACTX-Hvla protein toxin, or a fragment or variant thereof, linked to (ii) a protein capable of mediating translocation of FUSP from an invertebrate gut.
2. A molluscicidal composition according to claim 1, wherein
the amino acid K34 of omega-ACTX-Hvla protein toxin is modified.
3. A molluscicidal composition according to claim 1 or 2, wherein
the omega-ACTX-Hvla protein toxin has a K34Q substitution.
4. A molluscicidal composition according to one or more of claims 1 or 3, wherein the omega-ACTX-Hvla protein toxin comprises the amino acid sequence of SEQ ID NO: 1 or of SEQ ID NO:2.
5. A molluscicidal composition according to one or more of claims 1 or 4, wherein the protein capable of mediating translocation of FUSP from the invertebrate gut is a plant lectin selected from any one or more of the following: snowdrop lectin Galanthus nivalis agglutinin (GNA), garlic lectin Allium sativum, pea lectin Pisum sativum (P-lec), peanut lectin Arachis hypogaea, french bean lectin (PHA, Phytohaemoglutinin), or fragments, variants or derivatives thereof.
6. A molluscicidal composition according to claim 5, wherein
the lectin is GNA.
7. A moUuscicidal composition according to claim 5 or 6, wherein
the lectin comprises the amino acid sequence of SEQ ID NO:3.
8. A moUuscicidal composition according to one or more of claims 1 to 7, wherein FUSP further comprises an affinity tag to aid purification.
9. A moUuscicidal composition according to claim 8, wherein
the affinity tag is a His tag.
10. A moUuscicidal composition according to one or more of claims 1 to 9, wherein FUSP comprises the amino acid sequence of any of SEQ ID NOs 4, 5, 6, 7, 8 or 9.
11. A moUuscicidal composition according to one or more of claims 1 to 10, wherein the omega- ACTX-Hv la protein toxin is linked to the N-terminus of the protein capable of mediating translocation of FUSP from the invertebrate gut.
12. A moUuscicidal composition according to one or more of claims 1 to 11, wherein FUSP comprises the amino acid sequence of any of SEQ ID NOs 6, 7, 8 or 9.
13. A moUuscicidal composition according to claim 1, wherein
the active ingredient is metaldehyde.
14. A moUuscicidal composition according to one or more of claims 1 to 13, wherein the composition has the form of a homogeneous mixture of its components.
15. A moUuscicidal composition according to one or more of claims 1 to 14, wherein the acrylamide based polymer is selected from the group consisting of polyacrylamide, copolymer of acrylic acid and acrylamide, and mixtures thereof.
16. A moUuscicidal composition according to one or more of claims 1 to 15, wherein the acrylamide based polymer is a non- ionic acrylamide based polymer.
17. A moUuscicidal composition according to one or more of claims 1 to 16, wherein the composition comprises a bulking agent;
the bulking agent is selected from the group consisting of phyllosihcate, calcium carbonate, silica, starch, limestone, and mixtures thereof.
18. A moUuscicidal composition according to claim 17, wherein
the bulking agent is selected from the group consisting of phyllosihcate.
19. A moUuscicidal composition according to one or more of claims 1 to 18, wherein the composition comprises a wetting agent;
the wetting agent is water or polyvinyl alcohol.
20. A moUuscicidal composition according to one or more of claims 1 to 21, wherein the composition comprises an additive;
the additive is selected from the group consisting of sodium propionate, magnesium stearate, nicotinamide, sodium bicarbonate, and mixtures thereof.
21. A moUuscicidal composition according to one or more of claims 1 to 20, wherein the composition comprises
the active ingredient in an amount of from 7 to 60 wt%, the wt% being based on the total weight of the composition.
22. A moUuscicidal composition according to one or more of claims 1 to 21, wherein the composition have the form of cubes, granules, pellets, tablets.
23. A method for preparation of the moUuscicidal composition as defined in one or more of claims 1 to 22, wherein the method comprises a premixing of the components to provide a premixture and comprises a shaping of a premixture of the components.
24. Use of the moUuscicidal composition as defined in one or more of claims 1 to 22 for controlling aquatic snails and slugs.
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP17178212.1 | 2017-06-27 | ||
| EP17178212 | 2017-06-27 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2019002155A1 true WO2019002155A1 (en) | 2019-01-03 |
Family
ID=59227658
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2018/066848 Ceased WO2019002155A1 (en) | 2017-06-27 | 2018-06-25 | Molluscicidal compositions |
Country Status (1)
| Country | Link |
|---|---|
| WO (1) | WO2019002155A1 (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023180750A1 (en) * | 2022-03-24 | 2023-09-28 | University Of Durham | Topical application of insecticidal recombinant toxin fusion proteins |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR100684229B1 (en) * | 1999-04-12 | 2007-02-20 | 임페리알 케미칼 인더스트리즈 피엘씨 | Pesticide formulation |
| US20110319341A1 (en) * | 2004-06-01 | 2011-12-29 | Awada Salam M | Method of controlling pests with biosurfactant penetrants as carriers for active agents |
| WO2012131302A1 (en) | 2011-03-31 | 2012-10-04 | University Of Durham | Pesticides |
| CN104472511B (en) * | 2014-11-27 | 2016-06-08 | 安徽省农业科学院植物保护与农产品质量安全研究所 | A kind of molluscicide compositions containing the methaldehyde and emamectin benzoate |
-
2018
- 2018-06-25 WO PCT/EP2018/066848 patent/WO2019002155A1/en not_active Ceased
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR100684229B1 (en) * | 1999-04-12 | 2007-02-20 | 임페리알 케미칼 인더스트리즈 피엘씨 | Pesticide formulation |
| US20110319341A1 (en) * | 2004-06-01 | 2011-12-29 | Awada Salam M | Method of controlling pests with biosurfactant penetrants as carriers for active agents |
| WO2012131302A1 (en) | 2011-03-31 | 2012-10-04 | University Of Durham | Pesticides |
| CN104472511B (en) * | 2014-11-27 | 2016-06-08 | 安徽省农业科学院植物保护与农产品质量安全研究所 | A kind of molluscicide compositions containing the methaldehyde and emamectin benzoate |
Non-Patent Citations (3)
| Title |
|---|
| CHEMICAL ABSTRACTS, Columbus, Ohio, US; abstract no. 2032-65-7 |
| MARCOS MAYO-PEDROSA ET AL: "Sustained Release Pellets Based on Poly(N-Isopropyl Acrylamide): Matrix and In Situ Photopolymerization-Coated Systems", JOURNAL OF PHARMACEUTICAL SCIENCES, vol. 96, no. 1, 1 January 2007 (2007-01-01), US, pages 93 - 105, XP055500083, ISSN: 0022-3549, DOI: 10.1002/jps.20708 * |
| MICHAEL CAHN: "A Guide to Using Polyacrylamide (PAM) Polymers for Control of Irrigation Run-off on the Central Coast", 19 December 2010 (2010-12-19), CA (US), pages 1 - 13, XP055500081, Retrieved from the Internet <URL:https://web.archive.org/web/20160804110000/http://cesantabarbara.ucanr.edu/files/75493.pdf> [retrieved on 20180815] * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2023180750A1 (en) * | 2022-03-24 | 2023-09-28 | University Of Durham | Topical application of insecticidal recombinant toxin fusion proteins |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP0285404B1 (en) | Improved insecticidal delivery compositions and methods for controlling a population of insects in an aquatic environment | |
| US7294343B2 (en) | Biodegradable sorbents | |
| JPH03505459A (en) | Improved insecticide-releasing flowable compositions and methods for preparing insect populations in aquatic environments | |
| CA2445786A1 (en) | Floating sustained release pesticide granules | |
| Gaidau et al. | New mixes based on collagen extracts with bioactive properties, for treatment of seeds in sustainable agriculture | |
| Song et al. | Rotenone encapsulated in pH-responsive alginate-based microspheres reduces toxicity to zebrafish | |
| CN101697726A (en) | High-efficiency low-toxicity green insecticidal acaricide containing etoxazole-emamectin benzoate complex | |
| WO2019002155A1 (en) | Molluscicidal compositions | |
| KR20070036019A (en) | Improved Granule Formulation of Neem Seed Extract and Its Manufacturing Process | |
| PL172504B1 (en) | Method for the production of granular herbicidal product PL PL PL | |
| CN102204530B (en) | Imidacloprid suspension | |
| CN101161068B (en) | An environmental friendly controlled sustained-release insecticide and method for preparing the same | |
| DK3154339T3 (en) | MOLLUSCICID COMPOSITION | |
| JP2972336B2 (en) | Methaldehyde-containing pesticides | |
| KR20100084416A (en) | Environment friendly agent for controlling rice planthopper | |
| JPS6317802A (en) | Granular insecticide for application to water surface | |
| JP2000351705A (en) | Montan wax derivative mixture and agrochemical composition by using the same | |
| CN113662016A (en) | A kind of granule, its preparation method and its application | |
| DE102010018455A1 (en) | Producing plant protection product, comprises processing powdery alginate obtained from algae together with plant protection agent with polymerization of the alginate to form a plastic mass preparation and forming into granular bodies | |
| CN107593734A (en) | A kind of synergy nematicidal composition for being used to prevent and treat Chinese yam root knot nematode disease | |
| KR20060003223A (en) | Sleep Floating Diffusion | |
| JPH0780721B2 (en) | Sustained release pesticide composition | |
| KR840000669B1 (en) | Fungicidal composition for agricultural | |
| CN104068071A (en) | Insecticidal composition containing tetra-chlorantraniliprole | |
| JP2003113012A (en) | Planktonic blue-green alga inhibitory granular material for pond and marsh |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18731867 Country of ref document: EP Kind code of ref document: A1 |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| 122 | Ep: pct application non-entry in european phase |
Ref document number: 18731867 Country of ref document: EP Kind code of ref document: A1 |

