WO2018231905A1 - Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia - Google Patents
Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia Download PDFInfo
- Publication number
- WO2018231905A1 WO2018231905A1 PCT/US2018/037213 US2018037213W WO2018231905A1 WO 2018231905 A1 WO2018231905 A1 WO 2018231905A1 US 2018037213 W US2018037213 W US 2018037213W WO 2018231905 A1 WO2018231905 A1 WO 2018231905A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- subject
- seq
- actriib
- signaling inhibitor
- specific embodiments
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/179—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1793—Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/11—Protein-serine/threonine kinases (2.7.11)
- C12Y207/1103—Receptor protein serine/threonine kinase (2.7.11.30)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- kits for treating myeloproliferative neoplasm-associated myelofibrosis in a subject comprising administering to the subject an ActRIIB signaling inhibitor.
- methods for treating myeloproliferative neoplasm-associated myelofibrosis in a subject in need thereof comprising administering to the subject a pharmaceutically effective amount of an ActRIIB signaling inhibitor, and wherein said treating reduces or palliates one or more symptoms of said myeloproliferative neoplasm- associated myelofibrosis in said subject.
- Also provided herein is a method for treating anemia in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of an ActRIIB signaling inhibitor, wherein the subject has myeloproliferative neoplasm- associated myelofibrosis.
- Anemia is a decrease in number of red blood cells or less than the normal quantity of hemoglobin in the blood. Anemia can also be caused by decreased oxygen-binding ability of the hemoglobin. Anemia is the most common disorder of the blood. Anemia can be caused by ineffective erythropoiesis. Ineffective erythropoiesis is present if active erythropoiesis takes place but mature red blood cells fail to develop at the proper rate. Progenitor cells undergo apoptosis before the stage of mature red blood cells is reached.
- Myeloproliferative neoplasm- (MPN-) associated myelofibrosis is an umbrella term that is used to describe a clonal myeloid neoplasm that can develop directly (primary
- myelofibrosis also known as agnogenic myeloid metaplasia, chronic idiopathic myelofibrosis, myelosclerosis with myeloid metaplasia, and idiopathic myelofibrosis
- myeloid neoplasms polycythemia vera and essential thrombocythemia
- MPN-associated myelofibrosis results in excessive fibrous tissue formation in the bone marrow, which can lead to severe anemia, fatigue, weakness, and enlarged spleen and liver.
- ActRIIA and ActRIIB Two related type II receptors, ActRIIA and ActRIIB, have been identified as the type II receptors for activins (Mathews and Vale, 1991, Cell 65:973-982; Attisano et al., 1992, Cell 68: 97-108). Besides activins, ActRIIA and ActRIIB can biochemically interact with several other TGF-beta family proteins, including BMP7, Nodal, GDF8, and GDF11 (Yamashita et al., 1995, J. Cell Biol. 130:217-226; Lee and McPherron, 2001, Proc. Natl. Acad. Sci.
- ALK4 is the primary type I receptor for activins, particularly for activin A, and ALK-7 may serve as a receptor for activins as well, particularly for activin B.
- ActRIIB signaling inhibitors have been described for treating ineffective erythropoiesis and myelodysplastic syndromes (see, e.g., International Patent Application Publication Nos. WO 2013/059347, WO 2011/020045, and WO 2016/090077).
- a method for treating myeloproliferative neoplasm-associated myelofibrosis in a subject in need thereof comprises administering to the subject a pharmaceutically effective amount of an ActRIIB signaling inhibitor.
- the subject has anemia.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is red blood cell transfusion- independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the pharmaceutically effective amount is from 0.3 mg/kg to 2.0 mg.kg, e.g., 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg. In specific embodiments, the pharmaceutically effective amount is 1 mg/kg.
- the ActRIIB signaling inhibitor is administered to the subject once every 21 days, once every 28 days, or once every 48 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject once every 21 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject intravenously or subcutaneously.
- the pharmaceutically effective amount is 1 mg/kg and the ActRIIB signaling inhibitor is administered to the subject subcutaneously once every 21 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject subcutaneously. In specific embodiments, the ActRIIB signaling inhibitor is a humanized fusion-protein consisting of the extracellular domain of ActRIIB and the human IgGl Fc domain. In specific embodiments, the ActRIIB signaling inhibitor is a fusion-protein comprising the extracellular domain of ActRIIB and the human IgGl Fc domain.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO:4; (b) 95% identical to SEQ ID NO:4; (c) 98% identical to SEQ ID NO:4; (d) SEQ ID NO:4; (e) 90% identical to SEQ ID NO:7; (f) 95% identical to SEQ ID NO:7; (g) 98% identical to SEQ ID NO:7; (h) SEQ ID NO:7; (i) 90% identical to SEQ ID NO:8; (j) 95% identical to SEQ ID NO:8; (k) 98% identical to SEQ ID NO:8; (1) SEQ ID NO:8; (m) 90% identical to SEQ ID NO: 11; (n) 95% identical to SEQ ID NO: 11 ; (o) 98% identical to SEQ ID NO: 11 ; and (p) SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO: 11; (b) 95% identical to SEQ ID NO: 11 ; (c) 98% identical to SEQ ID NO: 11 ; and (d) SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the subject is a human.
- the symptom is one or more of fatigue, night sweats, itchiness, abdominal discomfort, pain under the ribs on the left side, early satiety, or bone pain.
- the subject has anemia.
- the myeloproliferative neoplasm-associated myelofibrosis is primary
- the myeloproliferative neoplasm-associated myelofibrosis in specific embodiments, the myeloproliferative neoplasm-associated myelofibrosis.
- myelofibrosis is polycythemia vera myelofibrosis.
- the myelofibrosis is polycythemia vera myelofibrosis.
- polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is post- polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion- dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the pharmaceutically effective amount is from 0.3 mg/kg to 2.0 mg.kg, e.g., 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg. In specific embodiments, the pharmaceutically effective amount is 1 mg/kg.
- the ActRIIB signaling inhibitor is administered to the subject once every 21 days, once every 28 days, or once every 48 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject once every 21 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject intravenously or subcutaneously. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject subcutaneously. In specific embodiments, the
- the ActRIIB signaling inhibitor is a humanized fusion-protein consisting of the extracellular domain of ActRIIB and the human IgGl Fc domain. In specific embodiments, the ActRIIB signaling inhibitor is a fusion-protein comprising the extracellular domain of ActRIIB and the human IgGl Fc domain.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO:4; (b) 95% identical to SEQ ID NO:4; (c) 98% identical to SEQ ID NO:4; (d) SEQ ID NO:4; (e) 90% identical to SEQ ID NO:7; (f) 95% identical to SEQ ID NO:7; (g) 98% identical to SEQ ID NO:7; (h) SEQ ID NO:7; (i) 90% identical to SEQ ID NO:8; (j) 95% identical to SEQ ID NO:8; (k) 98% identical to SEQ ID NO:8; (1) SEQ ID NO:8; (m) 90% identical to SEQ ID NO: 11; (n) 95% identical to SEQ ID NO: 11; (o) 98% identical to SEQ ID NO: 11 ; and (p) SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO: 11; (b) 95% identical to SEQ ID NO: 11; (c) 98% identical to SEQ ID NO: 11 ; and (d) SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the subject is a human.
- Also provided herein is a method for treating anemia in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of an ActRIIB signaling inhibitor, wherein the subject has myeloproliferative neoplasm-associated
- the myeloproliferative neoplasm-associated myelofibrosis in specific embodiments, the myeloproliferative neoplasm-associated myelofibrosis.
- myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post- polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post- essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
- the pharmaceutically effective amount is from 0.3 mg/kg to 2.0 mg.kg, e.g., 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg. In specific embodiments, the pharmaceutically effective amount is 1 mg/kg. In specific,
- the ActRIIB signaling inhibitor is administered to the subject once every 21 days, once every 28 days, or once every 48 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject once every 21 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject intravenously or subcutaneously. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject
- the pharmaceutically effective amount is 1 mg/kg and the ActRIIB signaling inhibitor is administered to the subject subcutaneously once every 21 days.
- the ActRIIB signaling inhibitor is a humanized fusion-protein consisting of the extracellular domain of ActRIIB and the human IgGl Fc domain.
- the ActRIIB signaling inhibitor is a fusion-protein comprising the extracellular domain of ActRIIB and the human IgGl Fc domain.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO:4; (b) 95% identical to SEQ ID NO:4; (c) 98% identical to SEQ ID NO:4; (d) SEQ ID NO:4; (e) 90% identical to SEQ ID NO:7; (f) 95% identical to SEQ ID NO:7; (g) 98% identical to SEQ ID NO:7; (h) SEQ ID NO:7; (i) 90% identical to SEQ ID NO:8; (j) 95% identical to SEQ ID NO:8; (k) 98% identical to SEQ ID NO:8; (1) SEQ ID NO:8; (m) 90% identical to SEQ ID NO: 11; (n) 95% identical to SEQ ID NO: 11 ; (o) 98% identical to SEQ ID NO: 11 ; and (p) SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO: 11; (b) 95% identical to SEQ ID NO: 11 ; (c) 98% identical to SEQ ID NO: 11 ; and (d) SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the subject is a human.
- Also provided herein is a method for treating myeloproliferative neoplasm-associated myelofibrosis in a subject in need thereof, wherein the method comprises administering to the subject a dose of 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg of a polypeptide comprising the amino acid sequence of SEQ ID NO: 11, wherein the polypeptide is administered to the subject subcutaneously once every 21 days.
- the subject has anemia.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post- polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post- essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
- the subject is a human.
- Also provided herein is a method for treating myeloproliferative neoplasm-associated myelofibrosis in a subject in need thereof, wherein the method comprises administering to the subject a dose of 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg of a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11, wherein the polypeptide is administered to the subject subcutaneously once every 21 days.
- the dose is 1 mg/kg.
- the subject has anemia.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the psot- polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post- essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
- the subject is a human.
- the dose is 1 mg/kg.
- the subject has anemia.
- the myeloproliferative neoplasm-associated myelofibrosis is
- polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion- dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is a human.
- ActRII refers to activin receptor type II.
- ActRIIA refers to activin receptor type IIA. See, for example, Mathews and Vale, 1991, Cell 65:973-982.
- GenBankTM accession number M_001278579.1 provides an exemplary human ActRIIA nucleic acid sequence.
- GenBankTM accession number P 001265508.1 provides an exemplary human ActRIIA amino acid sequence.
- ActRIIB refers to activin receptor type IIB. See, for example, Attisano et al., 1992, Cell 68: 97-108.
- GenBankTM accession number M 001106.3 provides an exemplary human ActRIIB nucleic acid sequence.
- GenBankTM accession number P 001097.2 provides an exemplary human ActRIIB amino acid sequence.
- Hb and Hgb refer to hemoglobin.
- mg/kg in the context of a dose of an ActRIIB signaling inhibitor, refers to milligrams of the ActRIIB signaling inhibitor per kilogram of the weight of the subject to whom the ActRIIB signaling inhibitor is to be administered.
- MF myelofibrosis
- PMF primary myelofibrosis
- post-PV MF refers to post-polycythemia vera myelofibrosis.
- post-ET MF refers to post-essential thrombocythemia
- MPN myeloproliferative neoplasm
- RBC red blood cell
- RBC-TI refers to red blood cell transfusion independent.
- FIG. 1 Mechanism of Action of Luspatercept.
- FIG. 2 Study Design.
- a method for treating myeloproliferative neoplasm-associated myelofibrosis in a subject in need thereof comprises administering to the subject a pharmaceutically effective amount of an ActRIIB signaling inhibitor.
- the subject has anemia.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is red blood cell transfusion- independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the pharmaceutically effective amount is from 0.3 mg/kg to 2.0 mg.kg, e.g., 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg.
- the ActRIIB signaling inhibitor is administered to the subject once every 21 days, once every 28 days, or once every 48 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject once every 21 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject intravenously or subcutaneously. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject subcutaneously.
- the ActRIIB signaling inhibitor is a humanized fusion-protein consisting of the extracellular domain of ActRIIB and the human IgGl Fc domain.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO:4; (b) 95% identical to SEQ ID NO:4; (c) 98% identical to SEQ ID NO:4; (d) SEQ ID NO:4; (e) 90% identical to SEQ ID NO:7; (f) 95% identical to SEQ ID NO:7; (g) 98% identical to SEQ ID NO:7; (h) SEQ ID NO:7; (i) 90% identical to SEQ ID NO:8; (j) 95% identical to SEQ ID NO:8; (k) 98% identical to SEQ ID NO:8; (1) SEQ ID NO:8; (m) 90% identical to SEQ ID NO: 11; (n) 95% identical to SEQ ID NO: 11
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO: 11; (b) 95% identical to SEQ ID NO: 11; (c) 98% identical to SEQ ID NO: 11 ; and (d) SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the subject is a human.
- a method for treating myeloproliferative neoplasm-associated myelofibrosis in a subject in need thereof comprises administering to the subject a pharmaceutically effective amount of an ActRIIB signaling inhibitor, and wherein said treating reduces or palliates one or more symptoms of said myeloproliferative neoplasm- associated myelofibrosis in said subject.
- the symptom is one or more of fatigue, night sweats, itchiness, abdominal discomfort, pain under the ribs on the left side, early satiety, or bone pain.
- the subject has anemia.
- the myeloproliferative neoplasm-associated myelofibrosis is primary
- the myeloproliferative neoplasm-associated myelofibrosis in specific embodiments, the myeloproliferative neoplasm-associated myelofibrosis.
- myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- the myeloproliferative neoplasm-associated myelofibrosis is post- polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion- dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the pharmaceutically effective amount is from 0.3 mg/kg to 2.0 mg.kg, e.g., 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg.
- the ActRIIB signaling inhibitor is administered to the subject once every 21 days, once every 28 days, or once every 48 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject once every 21 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject intravenously or subcutaneously. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject subcutaneously.
- the ActRIIB signaling inhibitor is a humanized fusion-protein consisting of the extracellular domain of ActRIIB and the human IgGl Fc domain.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO:4; (b) 95% identical to SEQ ID NO:4; (c) 98% identical to SEQ ID NO:4; (d) SEQ ID NO:4; (e) 90% identical to SEQ ID NO:7; (f) 95% identical to SEQ ID NO:7; (g) 98% identical to SEQ ID NO:7; (h) SEQ ID NO:7; (i) 90% identical to SEQ ID NO:8; (j) 95% identical to SEQ ID NO:8; (k) 98% identical to SEQ ID NO:8; (1) SEQ ID NO:8; (m) 90% identical to SEQ ID NO: 11; (n) 95% identical to SEQ ID NO: 11
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO: 11; (b) 95% identical to SEQ ID NO: 11 ; (c) 98% identical to SEQ ID NO: 11 ; and (d) SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the subject is a human.
- Also provided herein is a method for treating anemia in a subject in need thereof, comprising administering to the subject a pharmaceutically effective amount of an ActRIIB signaling inhibitor, wherein the subject has myeloproliferative neoplasm-associated
- the myeloproliferative neoplasm-associated myelofibrosis in specific embodiments, the myeloproliferative neoplasm-associated myelofibrosis.
- myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post- polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post- essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
- the pharmaceutically effective amount is from 0.3 mg/kg to 2.0 mg.kg, e.g., 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg.
- the ActRIIB signaling inhibitor is administered to the subject once every 21 days, once every 28 days, or once every 48 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject once every 21 days. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject intravenously or subcutaneously. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject subcutaneously.
- the ActRIIB signaling inhibitor is a humanized fusion-protein consisting of the extracellular domain of ActRIIB and the human IgGl Fc domain.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO:4; (b) 95% identical to SEQ ID NO:4; (c) 98% identical to SEQ ID NO:4; (d) SEQ ID NO:4; (e) 90% identical to SEQ ID NO: 7; (f) 95% identical to SEQ ID NO: 7; (g) 98% identical to SEQ ID NO:7; (h) SEQ ID NO:7; (i) 90% identical to SEQ ID NO:8; (j) 95% identical to SEQ ID NO:8; (k) 98% identical to SEQ ID NO:8; (1) SEQ ID NO:8; (m) 90% identical to SEQ ID NO: 11; (n) 95% identical to SEQ ID NO: 11
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence selected from the group consisting of: (a) 90% identical to SEQ ID NO: 11; (b) 95% identical to SEQ ID NO: 11; (c) 98% identical to SEQ ID NO: 11; and (d) SEQ ID NO: l l .
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the subject is a human.
- Also provided herein is a method for treating myeloproliferative neoplasm-associated myelofibrosis in a subject in need thereof, wherein the method comprises administering to the subject a dose of 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg of a polypeptide consisting of the amino acid sequence of SEQ ID NO: 11, wherein the polypeptide is administered to the subject subcutaneously once every 21 days.
- the subject has anemia.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post- polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post- essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is a human.
- a method for treating myeloproliferative neoplasm-associated myelofibrosis in a subject in need thereof comprises administering to the subject a pharmaceutically effective amount of an ActRIIB signaling inhibitor.
- the myeloproliferative neoplasm-associated myelofibrosis is primary
- the myeloproliferative neoplasm-associated myelofibrosis in specific embodiments, the myeloproliferative neoplasm-associated myelofibrosis.
- myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- the myeloproliferative neoplasm-associated myelofibrosis is post- polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is a subject described in Section 5.3. In specific embodiments, the subject is a human. In specific embodiments, the subject has anemia. In specific embodiments, the subject is red blood cell transfusion-independent. In specific embodiments, the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent. In specific embodiments, the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the ActRIIB signaling inhibitor is administered to the subject as part of a composition.
- the composition is a composition described in Section 5.5.
- the pharmaceutically effective dose is a dose described in Section 5.6.
- the pharmaceutically effective amount is from 0.3 mg/kg to 2.0 mg.kg, e.g., 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg of the ActRIIB signaling inhibitor.
- the ActRIIB signaling inhibitor is administered to the subject at a frequency described in Section 5.6.
- the ActRIIB signaling inhibitor is administered to the subject once every 21 days, once every 28 days, or once every 48 days. In preferred embodiments, the ActRIIB signaling inhibitor is administered to the subject once every 21 days.
- the ActRIIB signaling inhibitor is administered to the subject via a route of administration described in Section 5.6. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject intravenously or subcutaneously. In preferred embodiments, the ActRIIB signaling inhibitor is administered to the subject subcutaneously. [0034] In specific embodiments, the ActRIIB signaling inhibitor is an ActRIIB signaling inhibitor described in Section 5.4. In specific embodiments, the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11. In specific embodiments, the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is luspatercept.
- the subject is a human.
- Also provided herein is a method for treating myeloproliferative neoplasm-associated myelofibrosis in a subject in need thereof, wherein the method comprises administering to the subject a pharmaceutically effective amount of an ActRIIB signaling inhibitor, and wherein said treating reduces or palliates one or more symptoms of said myeloproliferative neoplasm- associated myelofibrosis in said subject.
- the symptom is one or more of fatigue, night sweats, itchiness, abdominal discomfort, pain under the ribs on the left side, early satiety, or bone pain.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- JAK2 mutation e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post- polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post- essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is a subject described in Section 5.3. In specific embodiments, the subject is a human. In specific embodiments, the subject has anemia. In specific embodiments, the subject is red blood cell transfusion-independent. In specific embodiments, the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent. In specific embodiments, the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the ActRIIB signaling inhibitor is administered to the subject as part of a composition.
- the composition is a composition described in Section 5.5.
- the pharmaceutically effective dose is a dose described in Section 5.6.
- the pharmaceutically effective amount is from 0.3 mg/kg to 2.0 mg.kg, e.g., 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg of the ActRIIB signaling inhibitor.
- the ActRIIB signaling inhibitor is administered to the subject at a frequency described in Section 5.6.
- the ActRIIB signaling inhibitor is administered to the subject once every 21 days, once every 28 days, or once every 48 days. In preferred embodiments, the ActRIIB signaling inhibitor is administered to the subject once every 21 days.
- the ActRIIB signaling inhibitor is administered to the subject via a route of administration described in Section 5.6. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject intravenously or subcutaneously. In preferred embodiments, the ActRIIB signaling inhibitor is administered to the subject subcutaneously.
- the ActRIIB signaling inhibitor is an ActRIIB signaling inhibitor described in Section 5.4.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is luspatercept.
- the subject is a human.
- a method for treating anemia in a subject in need thereof comprising administering to the subject a pharmaceutically effective amount of an ActRIIB signaling inhibitor, wherein the subject has myeloproliferative neoplasm-associated
- the myeloproliferative neoplasm-associated myelofibrosis in specific embodiments, the myeloproliferative neoplasm-associated myelofibrosis.
- myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post- polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post- essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is a subject described in Section 5.3. In specific embodiments, the subject is a human. In specific embodiments, the subject is red blood cell transfusion-independent. In specific embodiments, the subject is red blood cell transfusion- independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent. In specific embodiments, the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the ActRIIB signaling inhibitor is administered to the subject as part of a composition.
- the composition is a composition described in Section 5.5.
- the pharmaceutically effective dose is a dose described in Section 5.6.
- the pharmaceutically effective amount is from 0.3 mg/kg to 2.0 mg.kg, e.g., 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg of the ActRIIB signaling inhibitor.
- the ActRIIB signaling inhibitor is administered to the subject at a frequency described in Section 5.6.
- the ActRIIB signaling inhibitor is administered to the subject once every 21 days, once every 28 days, or once every 48 days. In preferred embodiments, the ActRIIB signaling inhibitor is administered to the subject once every 21 days.
- the ActRIIB signaling inhibitor is administered to the subject via a route of administration described in Section 5.6. In specific embodiments, the ActRIIB signaling inhibitor is administered to the subject intravenously or subcutaneously. In preferred embodiments, the ActRIIB signaling inhibitor is administered to the subject subcutaneously.
- the ActRIIB signaling inhibitor is an ActRIIB signaling inhibitor described in Section 5.4.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is luspatercept.
- the subject is a human.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- the myeloproliferative neoplasm-associated myelofibrosis is post- polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is a subject described in Section 5.3.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the ActRIIB signaling inhibitor is administered to the subject as part of a composition.
- the composition is a composition described in Section 5.5.
- Also provided herein is a method for treating myeloproliferative neoplasm-associated myelofibrosis in a subject in need thereof, wherein the method comprises administering to the subject a dose of 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg of a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11, wherein the polypeptide is administered to the subject subcutaneously once every 21 days.
- the myeloproliferative neoplasm- associated myelofibrosis is primary myelofibrosis.
- the method comprises administering to the subject a dose of 0.33 mg/kg, 0.45 mg/kg, 0.6 mg/kg, 0.8 mg/kg, 1 mg/kg, 1.33 mg/kg, 1.75 mg/kg, or 2.0 mg/kg of a polypeptide comprising an amino acid sequence consisting of the
- myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is a subject described in Section 5.3.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the ActRIIB signaling inhibitor is administered to the subject as part of a composition.
- the composition is a composition described in Section 5.5.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- the myeloproliferative neoplasm-associated myelofibrosis is post- polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- the subject is a subject described in Section 5.3.
- the subject is red blood cell transfusion-independent.
- the subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to administration of the ActRIIB signaling inhibitor to the subject.
- the subject is red blood cell transfusion-dependent.
- the subject is red blood cell transfusion dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67,
- the ActRIIB signaling inhibitor is administered to the subject as part of a composition.
- the composition is a composition described in Section 5.5.
- the subjects treated in accordance with the methods described herein can be any mammals such as rodents and primates, and in a preferred embodiment, humans.
- the subject is a human.
- the methods described herein can be used to treat myeloproliferative neoplasm-associated myelofibrosis and/or anemia in any mammals, such as rodents and primates, and in a preferred embodiment, in human subjects.
- the subject treated in accordance with the methods described here can be of any age. In certain embodiments, the subject treated in accordance with the methods described herein is less than 18 years old. In a specific embodiment, the subject treated in accordance with the methods described herein is less than 13 years old. In another specific embodiment, the subject treated in accordance with the methods described herein is less than 12, less than 11, less than 10, less than 9, less than 8, less than 7, less than 6, or less than 5 years old.
- the subject treated in accordance with the methods described herein is 1-3 years old, 3-5 years old, 5-7 years old, 7-9 years old, 9-11 years old, 11-13 years old, 13-15 years old, 15-20 years old, 20-25 years old, 25-30 years old, or greater than 30 years old.
- the subject treated in accordance with the methods described herein is 30-35 years old, 35-40 years old, 40-45 years old, 45-50 years old, 50-55 years old, 55-60 years old, or greater than 60 years old.
- the subject treated in accordance with the methods described herein is 60-65 years old, 65-70 years old, 70-75 years old, 75-80 years old, or greater than 80 years old.
- a subject treated according to the methods provided herein has myeloproliferative neoplasm-associated myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., & JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., & JAK2 V617F mutation or JAK2 exon 12 mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- a subject treated according to the methods provided herein has anemia.
- a subject treated according to the methods provided herein has myeloproliferative neoplasm-associated myelofibrosis and anemia.
- the myeloproliferative neoplasm-associated myelofibrosis is primary myelofibrosis.
- the myeloproliferative neoplasm-associated myelofibrosis is polycythemia vera myelofibrosis.
- the polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation or JAK2 exon 12 mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is post-polycythemia vera myelofibrosis.
- the post-polycythemia vera myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a thrombopoietin receptor (MPL) mutation.
- a JAK2 mutation e.g., a JAK2 V617F mutation
- MPL thrombopoietin receptor
- the myeloproliferative neoplasm-associated myelofibrosis is essential thrombocytopenia or post-essential thrombocythemia myelofibrosis.
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis is associated with, or caused by, a JAK2 mutation, e.g., a JAK2 V617F mutation, or a
- the essential thrombocytopenia or post-essential thrombocythemia myelofibrosis includes reticulin fibrosis or trichrome fibrosis.
- a subject treated according to the methods provided herein has previously been treated with ruxolitinib.
- a subject treated according to the methods provided herein has been on a stable dose of ruxolitinib for at least 112 days immediately prior to treatment.
- a subject treated according to the methods provided herein has not previously been treated with ruxolitinib.
- a subject treated according to the methods provided herein is red blood cell transfusion-independent.
- a subject is red blood cell transfusion-independent if the subject has received no (0) red blood cell units during a period of time of 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to a first administration of the ActRIIB signaling inhibitor to the subject.
- a subject treated according to the methods provided herein is red blood cell transfusion-dependent.
- a subject is red blood cell transfusion-dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to a first administration of the ActRIIB signaling inhibitor to the subject.
- ActRIIB refers to a family of activin receptor type IIB (ActRIIB) proteins from any species and variants derived from such ActRIIB proteins by mutagenesis or other modification.
- Reference to ActRIIB herein is understood to be a reference to any one of the currently identified forms of the receptor.
- Members of the ActRIIB family are generally transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
- ActRIIB signaling inhibitors to be used in the compositions and methods described herein include, without limitation, activin-binding soluble ActRIIB polypeptides; antibodies that bind to activin (particularly the activin A or B subunits, also referred to as BA or BB) and disrupt ActRIIB binding; antibodies that bind to ActRIIB and disrupt activin binding; non-antibody proteins selected for activin or ActRIIB binding; and randomized peptides selected for activin or ActRIIB binding, which can be conjugated to an Fc domain.
- two or more different proteins (or other moieties) with activin or ActRIIB binding activity may be linked together to create a bifunctional or multifunctional binding molecule that inhibits ActRIIB and thus can be used in the compositions and methods described herein include.
- activin-ActRIIB signaling axis antagonists that inhibit ActRIIB include nucleic acid aptamers, small molecules and other agents are used in the compositions and methods described herein include.
- ActRIIB polypeptide refers to polypeptides comprising any naturally occurring polypeptide of an ActRIIB family member as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity.
- ActRIIB polypeptides include polypeptides derived from the sequence of any known ActRIIB receptor having a sequence at least about 80% identical to the sequence of an ActRIIB polypeptide, and optionally at least 85%, 90%, 95%, 96%, 97%, 98%, 99% or greater identity.
- an ActRIIB polypeptide may bind to and inhibit the function of an ActRIIB protein and/or activin.
- an example of an ActRIIB polypeptide includes the human ActRIIB precursor polypeptide (SEQ ID NO:3 or SEQ ID NO: 14).
- the signal peptide of the ActRIIB precursor polypeptide is located at amino acids 1 to 18; the extracellular domain is located at amino acids 19 to 134 and the potential N-linked glycosylation sites are located at amino acid positions 42 and 65.
- SEQ ID NO:6 provides an alanine at the codon corresponding to amino acid position 64, but could be readily modified by one of skill in the art using methods known in the art to provide an arginine at the codon corresponding to amino acid position 64 instead). See Table 2 for a description of the sequences.
- the numbering of amino acids for all of the ActRIIB -related polypeptides described herein is based on the amino acid numbering for SEQ ID NO: 3 and SEQ ID NO: 14 (which only differ in the amino acid expressed at position 64), unless specifically designated otherwise.
- SEQ ID NO: 3 and SEQ ID NO: 14 which only differ in the amino acid expressed at position 64
- position 79 refers to the 79th amino acid in SEQ ID NO:3 or SEQ ID NO: 14, from which the ActRIIB polypeptide is derived.
- the inhibitors of ActRIIB signaling used in the compositions and methods described herein comprise polypeptides comprising an activin-binding domain of ActRIIB.
- the activin-binding domains of ActRIIB comprise the extracellular domain of ActRIIB, or a portion thereof.
- the extracellular domain or portion thereof of ActRIIB is soluble.
- Illustrative modified forms of ActRIIB polypeptides are disclosed in U.S. Patent Application Publication Nos. 20090005308 and 20100068215, the disclosures of which are incorporated herein by reference in their entireties.
- Illustrative modified forms of ActRIIB polypeptides are also disclosed in International Patent Application Publication Nos. WO 2008/097541 and WO 2010/019261, the disclosures of which are incorporated herein by reference in their entireties.
- the ActRIIB polypeptides used in the compositions and methods described herein are soluble ActRIIB polypeptides.
- the term "soluble ActRIIB polypeptide” generally refers to polypeptides comprising an extracellular domain of an ActRIIB protein, including any naturally occurring extracellular domain of an ActRIIB protein as well as any variants thereof (including mutants, fragments and peptidomimetic forms). Soluble ActRIIB polypeptides can bind to activin; however, the wild type ActRIIB protein does not exhibit significant selectivity in binding to activin versus GDF8/11. In certain embodiments, altered forms of ActRIIB with different binding properties can be used in the methods provided herein.
- an ActRIIB precursor amino acid sequence with an arginine at position 64 is presented in SEQ ID NO: 14.
- the ActRIIB polypeptides used in accordance with the compositions and methods described herein may comprise either (i) an alanine at the position corresponding to amino acid 64 of the ActRIIB precursor amino acid sequence, i.e., SEQ ID NO:3; or (ii) an arginine at position 64 of the ActRIIB precursor amino acid sequence, i.e., SEQ ID NO: 14.
- the ActRIIB polypeptides used in accordance with the compositions and methods described herein may comprise an amino acid that is not alanine or arginine at the position corresponding to amino acid 64 of the ActRIIB precursor amino acid sequence, i.e., SEQ ID NO:3 or SEQ ID NO: 14.
- An ActRIIB-Fc fusion protein containing amino acids 20-119 of SEQ ID NO: 14 i.e., SEQ ID NO: 18
- ActRIIB(20-l 19)-Fc has reduced binding to GDF-11 and activin relative to an ActRIIB-Fc fusion protein containing amino acids 20-134 of SEQ ID NO: 14 (i.e., SEQ ID NO: 17), "ActRIIB(20-134)-Fc", which includes the proline knot region and the complete juxtamembrane domain.
- ActRIIB-Fc fusion protein containing amino acids 20-129 of SEQ ID NO: 14, "ActRIIB(20-129)-Fc" retains similar but somewhat reduced activity relative to the non-truncated extracellular domain of ActRIIB, even though the proline knot region is disrupted.
- ActRIIB polypeptides comprising
- extracellular domains that stop at amino acid 134, 133, 132, 131, 130 and 129 of SEQ ID NO: 14 are all expected to be active, but constructs stopping at amino acid 134 or 133 may be most active.
- mutations at any of residues 129-134 are not expected to alter ligand binding affinity by large margins, as indicated by the fact that mutations of PI 29 and P130 of SEQ ID NO: 14 do not substantially decrease ligand binding.
- ActRIIB polypeptides used in accordance with the methods and compositions described herein may end as early as amino acid 109 (i.e., the final cysteine) of SEQ ID NO: 14 (or SEQ ID NO:3), however, forms ending at or between amino acid positions 109 and 119 of SEQ ID NO: 14 (or SEQ ID NO: 3) are expected to have reduced ligand binding ability.
- Amino acid 29 of SEQ ID NO: 3 and SEQ ID NO: 14 represents the initial cysteine in the ActRIIB precursor sequence. It is expected that an ActRIIB polypeptide beginning at amino acid 29 of the N-terminus of SEQ ID NO:3 or SEQ ID NO: 14, or before these amino acid positions, will retain ligand binding activity. An alanine to asparagine mutation at position 24 of SEQ ID NO:3 or SEQ ID NO: 14 introduces an N-linked glycosylation sequence without substantially affecting ligand binding.
- the active portions (i.e., ActRIIB polypeptides) of the ActRIIB precursor protein (i.e., SEQ ID NO:3 or SEQ ID NO: 14) to be used in accordance with the methods and compositions described herein will generally comprise amino acids 29-109 of SEQ ID NO: 3 or SEQ ID NO: 14, and such ActRIIB polypeptides may, for example, begin at a residue corresponding to any one of amino acids 19-29 of SEQ ID NO: 3 or SEQ ID NO: 14 and end at a position corresponding to any one of amino acids 109-134 of SEQ ID NO:3 or SEQ ID NO: 14.
- ActRIIB polypeptides encompassed herein include those that begin at an amino acid position from 19-29, 20-29 or 21-29 of SEQ ID NO: 3 or SEQ ID NO: 14 and end at an amino acid position from 119-134, 119-133 or 129-134, 129-133 of SEQ ID NO:3 or SEQ ID NO: 14.
- ActRIIB polypeptides encompassed herein include those that begin at an amino acid position from 20-24 (or 21-24, or 22-25) of SEQ ID NO: 3 or SEQ ID NO: 14 and end at an amino acid position from 109-134 (or 109-133), 119-134 (or 119-133) or 129-134 (or 129-133) of SEQ ID NO:3 or SEQ ID NO: 14.
- Variant ActRIIB polypeptides falling within these ranges are also contemplated, particularly those having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity or sequence homology to the corresponding portion of SEQ ID NO:3 or SEQ ID NO: 14.
- the inhibitors of ActRIIB signaling used in the compositions and methods described herein comprise a truncated form of an extracellular domain of ActRIIB.
- the truncation can be at the carboxy terminus and/or the amino terminus of the ActRIIB polypeptide.
- the truncation can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids long relative to the mature ActRIIB polypeptide extracellular domain.
- the truncation can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 N-terminal amino acids of the mature ActRIIB polypeptide extracellular domain. In certain embodiments, the truncation can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 C- terminal amino acids of the mature ActRIIB polypeptide extracellular domain.
- truncated forms of ActRIIB include polypeptides with amino acids 20-119; 20-128; 20-129; 20- 130; 20-131; 20-132; 20-133; 20-134; 20-131; 21-131; 22-131; 23-131; 24-131; and 25-131, wherein the amino acid positions refer to the amino acid positions in SEQ ID NO:3 or SEQ ID NO: 14.
- Additional exemplary truncated forms of ActRIIB include (i) polypeptides beginning at amino acids at any of amino acids 21-29 of SEQ ID NO: 3 or SEQ ID NO: 14 (optionally beginning at 22-25 of SEQ ID NO: 3 or SEQ ID NO: 14) and ending at any of amino acids 109- 134 of SEQ ID NO:3 or SEQ ID NO: 14; (ii) polypeptides beginning at any of amino acids 20-29 of SEQ ID NO: 3 or SEQ ID NO: 14 (optionally beginning at 22-25 of SEQ ID NO: 3 or SEQ ID NO: 14) and ending at any of amino acids 109-133 of SEQ ID NO: 3 or SEQ ID NO: 14; (iii) polypeptides beginning at any of amino acids 20-24 of SEQ ID NO: 3 or SEQ ID NO: 14
- an ActRIIB polypeptides comprises, consists essentially of, or consists of, an amino acid sequence beginning at amino acid position 25 of SEQ ID NO: 3 or SEQ ID NO: 14 and ending at amino acid position 131 of SEQ ID NO:3 or SEQ ID NO: 14.
- an ActRIIB polypeptide consists of, or consists essentially of, the amino acid sequence of SEQ ID NO:4, 18, 23, 26, 27, 29, 30, 31, 32, or 33.
- any of the ActRIIB polypeptides used in the compositions and methods described herein may be produced as a homodimer. Any of the ActRIIB polypeptides used in the compositions and methods described herein may be formulated as a fusion protein having a heterologous portion that comprises a constant region from an IgG heavy chain, such as an Fc domain. Any of the ActRIIB polypeptides used in the compositions and methods described herein may comprise an acidic amino acid at the position corresponding to position 79 of SEQ ID NO: 3 or SEQ ID NO: 14, optionally in combination with one or more additional amino acid substitutions, deletions or insertions relative to SEQ ID NO:3 or SEQ ID NO: 14.
- the inhibitors of ActRIIB signaling used in the compositions and methods described herein comprise an extracellular domain of ActRIIB with one or more amino acid substitutions/mutations.
- an amino acid substitution/mutation can be, for example, an exchange from the leucine at amino acid position 79 of SEQ ID NO: 3 or SEQ ID NO: 14 to an acidic amino acid, such as aspartic acid or glutamic acid.
- position L79 of SEQ ID NO: 3 or SEQ ID NO: 14 may be altered in ActRIIB extracellular domain polypeptides to confer altered activin-myostatin (GDF-11) binding properties.
- L79A and L79P mutations reduce GDF-11 binding to a greater extent than activin binding.
- L79E and L79D mutations retain GDF-11 binding, while demonstrating greatly reduced activin binding.
- the inhibitors of ActRIIB signaling used in the compositions and methods described herein comprise a truncated form of an ActRIIB extracellular domain that also carries an amino acid substitution, e.g., an exchange from the leucine at amino acid position 79 of SEQ ID NO: 3 or SEQ ID NO: 14 to an acidic amino acid, such as aspartic acid or glutamic acid.
- the truncated form of an extracellular domain of ActRIIB polypeptide that also carries an amino acid substitution used in the compositions and methods described herein is SEQ ID NO:9.
- Forms of ActRIIB that are truncated and/or carry one or more amino acid substitutions can be linked to an Fc domain of an antibody as discussed above.
- Functionally active fragments of ActRIIB polypeptides can be obtained, for example, by screening polypeptides recombinantly produced from the corresponding fragment of the nucleic acid encoding an ActRIIB polypeptide.
- fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry. The fragments can be produced (recombinantly or by chemical synthesis) and tested to identify those peptidyl fragments that can function as antagonists (inhibitors) of ActRIIB protein or signaling mediated by activin.
- a functional variant of ActRIIB polypeptides can be obtained, for example, by screening libraries of modified polypeptides recombinantly produced from the corresponding mutagenized nucleic acids encoding an ActRIIB polypeptide. The variants can be produced and tested to identify those that can function as antagonists (inhibitors) of ActRIIB protein or signaling mediated by activin.
- a functional variant of the ActRIIB polypeptides comprises an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NO:4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28, and 29.
- the functional variant has an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from SEQ ID NO:4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28, and 29.
- Functional variants may be generated, for example, by modifying the structure of an ActRIIB polypeptide for such purposes as enhancing therapeutic efficacy, or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo).
- modified ActRIIB polypeptides when selected to retain activin binding, are considered functional equivalents of the naturally-occurring ActRIIB polypeptides.
- Modified ActRIIB polypeptides can also be produced, for instance, by amino acid substitution, deletion, or addition.
- ActRIIB polypeptide mutants particularly sets of combinatorial mutants of an ActRIIB polypeptide, as well as truncation mutants; pools of combinatorial mutants are especially useful for identifying functional variant sequences can be used in the methods and compositions described herein.
- the purpose of screening such combinatorial libraries may be to generate, for example, ActRIIB polypeptide variants which can act as either agonists or antagonist, or alternatively, which possess novel activities all together.
- the ligand binding pocket of ActRIIB is defined by residues Y31, N33, N35, L38 through T41, E47, E50, Q53 through K55, L57, H58, Y60, S62, K74, W78 through N83, Y85, R87, A92, and E94 through F101 of SEQ ID NO:3 or SEQ ID NO: 14. At these positions, it is expected that conservative mutations will be tolerated, although a K74A mutation is well-tolerated, as are R40A, K55A, F82A and mutations at position L79. R40 is a K in Xenopus, indicating that basic amino acids at this position will be tolerated.
- an ActRIIB polypeptide for use in the methods and compositions described herein is one that comprises amino acids 29- 109 of SEQ ID NO: 3 or SEQ ID NO: 14, but optionally beginning at an amino acid position ranging from 20-24 or 22-25 of SEQ ID NO: 3 or SEQ ID NO: 14 and ending at an amino acid position ranging from 129-134 of SEQ ID NO:3 or SEQ ID NO: 14, and comprising no more than 1, 2, 5, or 15 conservative amino acid changes in the ligand binding pocket, and zero, one or more non-conservative alterations at amino acid positions 40, 53, 55, 74, 79 and/or 82 of SEQ ID NO: 3 or SEQ ID NO: 14 in the ligand binding pocket.
- Such an ActRIIB polypeptide may retain greater than 80%, 90%, 95% or 99% sequence identity or sequence homology to the sequence of amino acids 29-109 of SEQ ID NO:3 or SEQ ID NO: 14.
- Sites outside the binding pocket, at which variability may be particularly well tolerated, include the amino and carboxy termini of the extracellular domain of ActRIIB, and positions 42-46 and 65-73.
- An asparagine to alanine alteration at position 65 of SEQ ID NO: 3 or SEQ ID NO: 14 (N65A) actually improves ligand binding in the A64 background, and is thus expected to have no detrimental effect on ligand binding in the R64 background.
- the positively-charged amino acid residue Asp (D80) of the ligand-binding domain of ActRIIB can be mutated to a different amino acid residue such that the variant ActRIIB polypeptide preferentially binds to GDF8, but not activin.
- the D80 residue is changed to an amino acid residue selected from the group consisting of: an uncharged amino acid residue, a negative amino acid residue, and a hydrophobic amino acid residue.
- the hydrophobic residue L79 can be altered to the acidic amino acids aspartic acid or glutamic acid to greatly reduce activin binding while retaining GDF11 binding.
- most of the described mutations, variants or modifications may be made at the nucleic acid level or, in some cases, by post translational modification or chemical synthesis. Such techniques are well known in the art.
- the inhibitors of ActRIIB signaling used in the compositions and methods described herein comprise a conjugate/fusion protein comprising an extracellular domain (e.g., an activin-binding domain) of an ActRIIB receptor linked to an Fc portion of an antibody.
- conjugate/fusion proteins may comprise any of the ActRIIB polypeptides disclosed herein (e.g., any of SEQ ID NOs: 17, 18, 23, 26, 27, 29, 30, 31, 32, 33), any ActRIIB polypeptides known in the art, or any ActRIIB polypeptides generated using methods known in the art and/or provided herein.
- the extracellular domain is linked to an Fc portion of an antibody via a linker, e.g., a peptide linker.
- linkers include short polypeptide sequences such as 2-10, 2-5, 2-4, 2-3 amino acid residues (e.g., glycine residues), such as, for example, a Gly-Gly-Gly linker.
- the linker comprises the amino acid sequence Gly-Gly-Gly (GGG).
- the linker comprises the amino acid sequence Thr-Gly-Gly-Gly (TGGG).
- the Fc domain has one or more mutations at residues such as Asp-265, lysine 322, and Asn-434.
- the mutant Fc domain having one or more of these mutations has a reduced ability to bind to the Fey receptor relative to a wild-type Fc domain.
- the mutant Fc domain having one or more of these mutations e.g., an Asn-434 mutation
- Exemplary fusion proteins comprising a soluble extracellular domain of ActRIIB fused to an Fc domain are set forth in SEQ ID NOs:20, 21, 24, 25, or 34.
- the ActRIIB signaling inhibitors used in the compositions and methods described herein comprise the extracellular domain of ActRIIB, or a portion thereof, linked to an Fc portion of an antibody, wherein said ActRIIB signaling inhibitor comprises an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NOs:20, 21, 24, 25, 34.
- the ActRIIB signaling inhibitors used in the compositions and methods described herein comprise the extracellular domain of ActRIIB, or a portion thereof, linked to an Fc portion of an antibody, wherein said ActRIIB signaling inhibitor comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identical to an amino acid sequence selected from SEQ ID NOs:20, 21, 24, 25, and 34.
- the ActRIIB signaling inhibitor to be used in the compositions and methods described herein is a fusion protein between the extracellular domain of the human ActRIIB receptor and the Fc portion of IgGl .
- the ActRIIB signaling inhibitor to be used in the compositions and methods described herein is a fusion protein between a truncated extracellular domain of the human ActRIIB receptor and the Fc portion of IgGl .
- the ActRIIB signaling inhibitor to be used in the compositions and methods described herein is a fusion protein between a truncated extracellular domain of the human ActRIIB receptor and the Fc portion of IgGl, wherein the truncated extracellular domain of the human ActRIIB receptor possesses an amino acid substitution at the amino acid position corresponding to amino acid 79 of SEQ ID NO:3 or SEQ ID NO: 14.
- the amino acid substitution at the amino acid position corresponding to amino acid 79 of SEQ ID NO:3 or SEQ ID NO: 14 is substitution of Leucine for Aspartic Acid (i.e., an L79D mutation).
- the ActRIIB signaling inhibitor to be used in the compositions and methods described herein is SEQ ID NO: 10 or 11, which represents a fusion protein between the extracellular domain of the human ActRIIB receptor and the Fc portion of IgGl, wherein said ActRIIB extracellular domain comprises amino acids 25-131 of SEQ ID NO: 14 with an L79D mutation.
- the nucleic acid sequence encoding the ActRIIB-Fc fusion protein of SEQ ID NO: 10 is presented in SEQ ID NO:31.
- the ActRIIB signaling inhibitor to be used in the compositions and methods described herein is SEQ ID NO:20 or 21, which represents a fusion protein between the extracellular domain of the human ActRIIB receptor and the Fc portion of IgGl, wherein said ActRIIB extracellular domain comprises amino acids 25-131 of SEQ ID NO: 3 with an L79D mutation.
- Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine (or asparagine-X-serine) (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the wild-type ActRIIB polypeptide (for O-linked glycosylation sites).
- a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
- Another means of increasing the number of carbohydrate moieties on an ActRIIB polypeptide is by chemical or enzymatic coupling of glycosides to the ActRIIB polypeptide.
- the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or
- Removal of one or more carbohydrate moieties present on an ActRIIB polypeptide may be accomplished chemically and/or enzymatically. Chemical deglycosylation may involve, for example, exposure of the ActRIIB polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while leaving the amino acid sequence intact.
- ActRIIB polypeptide may be subsequent, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
- ActRIIB proteins for use in humans will be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other expression systems, such as other mammalian expression cell lines, yeast cell lines with engineered glycosylation enzymes and insect cells, are expected to be useful as well.
- mutated ActRIIB polypeptides comprising the addition of a further N-linked glycosylation site (N-X-S/T) that increases the serum half-life of an ActRIIB-Fc fusion protein, relative to the ActRIIB (R64)-Fc form can be used in the methods and
- compositions described herein introduction of an asparagine at position 24 of SEQ ID NO: 3 or SEQ ID NO: 14 (A24N) results in the creation of an NXT sequence that confers a longer half-life.
- Other NX(T/S) sequences can be found at 42-44 (NQS) and 65-67 (NSS), although the latter may not be efficiently glycosylated with the R at position 64 (i.e., in R64 polypeptides).
- N-X-S/T sequences may be generally introduced at positions outside the ligand binding pocket of ActRIIB, which is detailed above.
- N-X-S/T sequences include amino acids 20-29, 20-24, 22-25, 109-134, 120-134 or 129-134 of SEQ ID NO:3 or SEQ ID NO: 14.
- N-X-S/T sequences may also be introduced into the linker between the ActRIIB sequence and the Fc or other fusion component. Such a site may be introduced with minimal effort by introducing an N in the correct position with respect to a pre-existing S or T, or by introducing an S or T at a position corresponding to a pre-existing N.
- desirable alterations that would create an N-linked glycosylation site are: A24N, R64N, S67N (possibly combined with an N65A alteration), E106N, Rl 12N, G120N, E123N, P129N, A132N, Rl 12S and Rl 12T (with all amino acid positions corresponding to the positions they can be found in SEQ ID NO: 3 or SEQ ID NO: 14). Any S that is predicted to be glycosylated may be altered to a T without creating an
- any T that is predicted to be glycosylated may be altered to an S.
- S67T and S44T are encompassed herein.
- an S26T alteration may be used.
- an ActRIIB polypeptide may include one or more additional, non-endogenous N- linked glycosylation consensus sequences.
- an ActRIIB polypeptide variant may be screened for ability to bind to an ActRIIB ligand, to prevent binding of an ActRIIB ligand to an ActRIIB polypeptide or to interfere with signaling caused by an ActRIIB ligand.
- the activity of an ActRIIB polypeptide or its variants may also be tested in a cell-based or in vivo assay.
- Combinatorially-derived variants can be generated which have a selective or generally increased potency relative to a naturally occurring ActRIIB polypeptide.
- mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding wild-type ActRIIB polypeptide.
- the altered protein can be rendered either more stable or less stable to proteolytic degradation or other cellular processes which result in destruction of, or otherwise inactivation of a native ActRIIB polypeptide.
- Such variants, and the genes which encode them can be utilized to alter ActRIIB polypeptide levels by modulating the half-life of the ActRIIB polypeptides.
- a short half-life can give rise to more transient biological effects and can allow tighter control of recombinant ActRIIB polypeptide levels within the subject.
- mutations may be made in the linker (if any) and/or the Fc portion to alter the half-life of the protein.
- a combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ActRIIB polypeptide sequences.
- a mixture of synthetic oligonucleotides can be
- the library of potential homologs can be generated from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes then be ligated into an appropriate vector for expression.
- ActRIIB polypeptide variants can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis and the like (Ruf et al., (1994) Biochemistry 33 : 1565-1572; Wang et al., (1994) J. Biol. Chem. 269:3095-3099; Balint et al., (1993) Gene 137: 109-1 18; Grodberg et al., (1993) Eur. J. Biochem. 218:597-601; Nagashima et al., (1993) J. Biol. Chem.
- a wide range of techniques are known in the art for screening gene products of combinatorial libraries made by point mutations and truncations, and, for that matter, for screening cDNA libraries for gene products having a certain property. Such techniques will be generally adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of ActRIIB polypeptides.
- the most widely used techniques for screening large gene libraries typically comprises cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
- Preferred assays include activin binding assays and activin-mediated cell signaling assays.
- ActRIIB polypeptides used in the methods and compositions described herein may further comprise post-translational modifications in addition to any that are naturally present in the ActRIIB polypeptides.
- modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
- the modified ActRIIB polypeptides may contain non-amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharide, and phosphates. Effects of such non- amino acid elements on the functionality of an ActRIIB polypeptide may be tested by any method known to the skilled artisan.
- an ActRIIB polypeptide When an ActRIIB polypeptide is produced in cells by cleaving a nascent form of the ActRIIB polypeptide, post-translational processing may also be important for correct folding and/or function of the protein.
- Different cells such as CHO, HeLa, MDCK, 293, W138, NIH-3T3 or HEK293 have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the ActRIIB polypeptides.
- fusion proteins having at least a portion of the ActRIIB polypeptides and one or more fusion domains.
- fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy chain constant region (Fc), maltose binding protein (MBP), or human serum albumin.
- a fusion domain may be selected so as to confer a desired property. For example, some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
- matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt-conjugated resins are used.
- Many of such matrices are available in "kit” form, such as the Pharmacia GST purification system and the QIAexpressTM system (Qiagen) useful with (HIS6) fusion partners.
- a fusion domain may be selected so as to facilitate detection of the ActRIIB polypeptides. Examples of such detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
- fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins there from. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation.
- an ActRIIB polypeptide is fused with a domain that stabilizes the ActRIIB polypeptide in vivo (a "stabilizer" domain).
- stabilizing is meant anything that increases serum half life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect. Fusions with the Fc portion of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins. Likewise, fusions to human serum albumin can confer desirable properties. Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function, such as further stimulation of bone growth or muscle growth, as desired).
- an ActRIIB polypeptide may be placed C-terminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to an ActRIIB polypeptide.
- the ActRIIB polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
- the ActRIIB polypeptides used in the methods and compositions described herein contain one or more modifications that are capable of stabilizing the ActRIIB polypeptides.
- modifications enhance the in vitro half life of the ActRIIB polypeptides, enhance circulatory half life of the ActRIIB polypeptides or reduce proteolytic degradation of the ActRIIB polypeptides.
- stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an
- ActRIIB polypeptide and a stabilizer domain modifications of a glycosylation site (including, for example, addition of a glycosylation site to an ActRIIB polypeptide), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from an ActRIIB polypeptide).
- an ActRIIB polypeptide is fused to a stabilizer domain such as an IgG molecule (e.g., an Fc domain).
- stabilizer domain not only refers to a fusion domain (e.g., Fc) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinaceous polymer, such as polyethylene glycol.
- the methods and compositions described herein use isolated or purified ActRIIB polypeptides, i.e., ActRIIB polypeptides which are isolated from, or otherwise substantially free of, other proteins can be used with the methods and compositions described herein.
- ActRIIB polypeptides will generally be produced by expression from recombinant nucleic acids.
- the ActRIIB polypeptides used in the methods and compositions described herein are encoded by isolated and/or recombinant nucleic acids, including fragments, functional variants and fusion proteins disclosed herein.
- SEQ ID NO:6 encodes the naturally occurring human ActRIIB precursor polypeptide.
- the subject nucleic acids may be single-stranded or double stranded.
- Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making ActRIIB polypeptides or as direct therapeutic agents (e.g., in a gene therapy approach).
- nucleic acids that can be used to produce ActRIIB polypeptides suitable for use in the methods and compositions described herein are further understood to include nucleic acids that are variants of SEQ ID NO: 6 as well as variants of those nucleic acid sequences that encode soluble ActRIIB polypeptides (e.g., nucleic acids that encode SEQ ID NOs: 4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28, and 29).
- Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions or deletions, such as allelic variants.
- the isolated or recombinant nucleic acid sequences that can be used to produce ActRIIB polypeptides suitable for use in the methods and compositions described herein are at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO:6 or those nucleic acid sequences that encode soluble ActRIIB polypeptides (e.g., nucleic acids that encode SEQ ID NOs: 4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28, and 29).
- nucleic acid sequences complementary to SEQ ID NO: 6 or those nucleic acid sequences that encode soluble ActRIIB polypeptides e.g., nucleic acids that encode SEQ ID NOs: 4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28, and 29
- variants of SEQ ID NO: 6 or those nucleic acid sequences that encode soluble ActRIIB polypeptides e.g., nucleic acids that encode SEQ ID NOs: 4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28, and 29
- the nucleic acid sequences can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
- nucleic acids that can be used to produce ActRIIB are nucleic acids that can be used to produce ActRIIB
- polypeptides suitable for use in the methods and compositions described herein include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NO: 6 or those nucleic acid sequences that encode soluble ActRIIB polypeptides (e.g., nucleic acids that encode SEQ ID NOs: 4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28, and 29), complement sequence of SEQ ID NO: 6 or those nucleic acid sequences that encode soluble ActRIIB polypeptides (e.g., nucleic acids that encode SEQ ID NOs: 4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28, and 29), or fragments thereof.
- nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NO: 6 or those nucleic acid sequences that encode soluble ActRIIB polypeptides e.g., nucleic acids that encode SEQ ID NOs: 4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28,
- appropriate stringency conditions which promote DNA hybridization can be varied. For example, one can perform the hybridization at 6.0 times sodium chloride/sodium citrate (SSC) at about 45° Celsius, followed by a wash of 2.0 times SSC at 50° Celsius.
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 times SSC at 50° Celsius to a high stringency of about 0.2 times SSC at 50° Celsius.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22° Celsius, to high stringency conditions at about 65° Celsius. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
- nucleic acids which hybridize under low stringency conditions of 6 times SSC at room temperature followed by a wash at 2 times SSC at room temperature can be used with the methods and compositions described herein.
- Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NO:6 or those nucleic acid sequences that encode soluble ActRIIB polypeptides (e.g., nucleic acids that encode SEQ ID NOs: 4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28, and 29) due to degeneracy in the genetic code can also be used to produce ActRIIB polypeptides suitable for use in the methods and compositions described herein. For example, a number of amino acids are designated by more than one triplet. Codons that specify the same amino acid, or synonyms (for example, CAU and CAC are synonyms for histidine) may result in "silent" mutations which do not affect the amino acid sequence of the protein.
- DNA sequence polymorphisms that do lead to changes in the amino acid sequences of the subject proteins will exist among mammalian cells.
- these variations in one or more nucleotides (up to about 3-5% of the nucleotides) of the nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms can be used with the methods and compositions described herein.
- the recombinant nucleic acids that can be used to produce ActRIIB polypeptides suitable for use in the methods and compositions described herein may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
- regulatory nucleotide sequences will generally be appropriate to the host cell used for expression.
- suitable regulatory sequences are known in the art for a variety of host cells.
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences.
- Constitutive or inducible promoters as known in the art can be used with the methods and compositions described herein.
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
- nucleic acids that can be used to produce ActRIIB polypeptides suitable for use in the methods and compositions described herein are provided in an expression vector comprising a nucleotide sequence encoding an ActRIIB polypeptide and operably linked to at least one regulatory sequence.
- Regulatory sequences are art-recognized and are selected to direct expression of the ActRIIB polypeptide. Accordingly, the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, Calif. (1990).
- any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an ActRIIB polypeptide.
- useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda, the control regions for fd coat protein, the promoter for 3 -phosphogly cerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast .alpha.- mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression
- the design of the expression vector may depend on such factors as the choice of the host cell to be transformed and/or the type of protein desired to be expressed. Moreover, the vector's copy number, the ability to control that copy number and the expression of any other protein encoded by the vector, such as antibiotic markers, should also be considered.
- a recombinant nucleic acid can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
- Expression vehicles for production of a recombinant ActRIIB polypeptide include plasmids and other vectors.
- suitable vectors include plasmids of the types: pBR322-derived plasmids, pEMBL-derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
- Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
- the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
- vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
- bacterial plasmids such as pBR322
- derivatives of viruses such as the bovine papilloma virus (BPV-1), or Epstein-Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
- BBV-1 bovine papilloma virus
- pHEBo Epstein-Barr virus
- pREP-derived and p205 Epstein-Barr virus
- examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
- the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
- baculovirus expression systems include pVL- derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the .beta.-gal containing pBlueBac III).
- pVL- derived vectors such as pVL1392, pVL1393 and pVL941
- pAcUW-derived vectors such as pAcUWl
- pBlueBac-derived vectors such as the .beta.-gal containing pBlueBac III.
- a vector can be designed for production of the ActRIIB polypeptides used in the methods and compositions described herein in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wis.).
- a Pcmv-Script vector (Stratagene, La Jolla, Calif)
- pcDNA4 vectors Invitrogen, Carlsbad, Calif.
- pCI-neo vectors Promega, Madison, Wis.
- Host cells transfected with a recombinant gene including a coding sequence e.g., SEQ ID NO: 6 or those nucleic acid sequences that encode soluble ActRIIB polypeptides (e.g., nucleic acids that encode SEQ ID NOs: 4, 5, 9, 12, 13, 15, 16, 17, 18, 19, 22, 23, 28, and 29)) for one or more of the subject ActRIIB polypeptides can be used to produce ActRIIB polypeptides suitable for use in the methods and compositions described herein.
- the host cell may be any prokaryotic or eukaryotic cell.
- an ActRIIB polypeptide may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art.
- a host cell transfected with an expression vector encoding an ActRIIB polypeptide can be cultured under appropriate conditions to allow expression of the ActRIIB polypeptide to occur.
- the ActRIIB polypeptide may be secreted and isolated from a mixture of cells and medium containing the ActRIIB polypeptide.
- the ActRIIB polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
- a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
- the subject ActRIIB polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange
- the ActRIIB polypeptide is a fusion protein containing a domain which facilitates its purification.
- purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenyl sepharose chromatography, size exclusion chromatography, and cation exchange chromatography.
- the purification could be completed with viral filtration and buffer exchange.
- ActRIIB -hFc protein was purified to a purity of >98% as determined by size exclusion chromatography and >95% as determined by SDS PAGE. This level of purity was sufficient to achieve desirable effects on bone in mice and an acceptable safety profile in mice, rats and non-human primates.
- a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant ActRIIB polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni2+ metal resin.
- the purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified ActRIIB
- fusion genes are well known. Essentially, the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992).
- ActRIIB -Fc fusion protein can be expressed in stably transfected CHO-DUKX Bl 1 cells from a pAID4 vector (SV40 ori/enhancer, CMV promoter), using a tissue plasminogen leader sequence of SEQ ID NO:2.
- the Fc portion can comprise a human IgGl Fc sequence, as shown in SEQ ID NO: l .
- the protein contained upon expression, has, on average, between about 1.5 and 2.5 moles of sialic acid per molecule of ActRIIB-Fc fusion protein.
- the long serum half-life of an ActRIIB-Fc fusion can be 25- 32 days in human subjects.
- the CHO cell expressed material can have a higher affinity for activin B ligand than that reported for an ActRIIB-hFc fusion protein expressed in human 293 cells (del Re et al., J Biol Chem. 2004 Dec 17;279(51):53126-35).
- the use of the TPA leader sequence provided greater production than other leader sequences and, unlike ActRIIB-Fc expressed with a native leader, may provide a highly pure N-terminal sequence. Use of the native leader sequence may result in two major species of ActRIIB-Fc, each having a different N-terminal sequence.
- the ActRIIB signaling inhibitor is luspatercept (see International Nonproprietary Names for Pharmaceutical Substances (INN), WHO Drug
- ActRIIB signaling inhibitors are formulated with a pharmaceutically acceptable carrier for use with the methods described herein.
- an ActRIIB signaling inhibitor can be administered alone or as a component of a pharmaceutical formulation (therapeutic composition).
- the subject compounds may be formulated for administration in any convenient way for use in human or veterinary medicine.
- the ActRII signaling inhibitor is formulated for subcutaneous administration.
- the ActRIIB signaling inhibitor is packaged in a container as a sterile, preservative-free lyophilized powder or cake.
- the container comprises 25 mg of the ActRIIB signaling inhibitor.
- the container comprising 25 mg of the ActRIIB signaling inhibitor comprises a total of 37.5 mg of protein.
- ActRIIB signaling inhibitor in the container comprising 25 mg of the ActRIIB signaling inhibitor is reconstituted with 0.68 mL of water for injection.
- the container comprises 75 mg of the ActRIIB signaling inhibitor.
- the container comprising 75 mg of the ActRIIB signaling inhibitor comprises a total of 87.5 mg of protein.
- ActRIIB signaling inhibitor in the container comprising 75 mg of the ActRIIB signaling inhibitor is reconstituted with 1.6 mL of water for injection.
- the ActRIIB signaling inhibitor in the container is reconstituted with a volume of water for injection, such that the final concentration of the reconstituted ActRIIB signaling inhibitor in the water for injection is 50 mg/mL with a pH of approximately 6.5.
- the ActRIIB signaling inhibitor is administered to a subject within 10 hours of reconstitution.
- the container comprises the ActRIIB signaling inhibitor at a concentration of 50 mg/mL in a 10 mM citrate buffer-based solution, wherein the 10 mM citrate-buffer based solution comprises 10 mM citrate, pH 6.5, 9% sucrose, and 0.02% polysorbate 80.
- the container is stored at between 2°C and 8°C. In certain embodiments, the container is stored at between 2°C and 8°C for 18 months.
- the container is a 3 mL glass vial with a gray butyl coated stopper. In certain embodiments, the container is a 3 mL glass vial with a gray rubber stopper.
- the rubber stopper is secured in place by a crimped aluminum flip cap with a colored plastic button.
- the 3 mL glass vial comprises 25 mg of the ActRIIB signaling inhibitor and the colored plastic button is red. In certain embodiments, 3 mL glass vial comprises 75 mg of the ActRIIB signaling inhibitor and the colored plastic button is white.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11. In specific embodiments, the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is packaged in a container as a sterile, preservative-free lyophilized powder or cake.
- the container comprises 50 mg/mL of ActRIIB signaling inhibitor in 10 mM citrate buffer pH 6.5.
- the container comprises 56 mg of ActRIIB signaling inhibitor, 0.19 mg of citric acid monohydrate, 3.03 mg of tri-sodium citrate dehydrate, 0.24 mg of polysorbate 80, and 100.80 mg of sucrose.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 1 1. In specific embodiments, the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 1 1. In specific embodiments, the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 1 1.
- the therapeutic methods provided herein include administering the composition (comprising an ActRIIB signaling inhibitor) systemically, or locally as an implant or device.
- the therapeutic composition for uses provided herein is in a pyrogen-free, physiologically acceptable form.
- Therapeutically useful agents other than the ActRIIB signaling inhibitors which may also optionally be included in the composition as described above, may be administered simultaneously or sequentially with the subject compounds (e.g., ActRII polypeptides, such as ActRIIA and / or ActRIIB polypeptides).
- ActRIIB signaling inhibitors will be administered parenterally.
- the ActRIIB signaling inhibitor will be administered subcutaneously.
- Pharmaceutical compositions suitable for parenteral administration may comprise one or more ActRIIB polypeptides in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- the compositions described herein may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents.
- microorganisms Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption, such as aluminum monostearate and gelatin.
- agents which delay absorption such as aluminum monostearate and gelatin.
- the ActRIIB signaling inhibitor is substantially pure in a pharmaceutical composition. Specifically, at most 20%, 10%, 5%, 2.5%, 1%, 0.1%, or at most
- ActRIIB signaling inhibitor and the pharmaceutical acceptable carrier.
- the ActRIIB signaling inhibitor is administered at room temperature to a patient according to a method provided herein.
- an ActRIIB signaling inhibitor for administering to a subject in connection with a method of treatment described herein (see, e.g., Section 5.2).
- the dose is a pharmaceutically effective dose.
- the pharmaceutically effective dose of the ActRII signaling inhibitor is a dose sufficient to reduce or palliate one or more symptoms of myeloproliferative neoplasm-associated myelofibrosis. In certain embodiments, the pharmaceutically effective dose of the ActRII signaling inhibitor is a dose sufficient to prevent at least one symptom of myeloproliferative neoplasm-associated myelofibrosis from worsening.
- myeloproliferative neoplasm-associated myelofibrosis include fatigue, night sweats, itchiness, abdominal discomfort, pain under the ribs on the left side, early satiety, or bone pain.
- the pharmaceutically effective dose of the ActRII signaling inhibitor is a dose sufficient to reduce or palliate one or more symptoms of anemia caused by or associated with myeloproliferative neoplasm-associated myelofibrosis. In certain embodiments, the pharmaceutically effective dose of the ActRII signaling inhibitor is a dose sufficient to prevent at least one symptom of anemia from worsening.
- anemia include fatigue, loss of energy, rapid heartbeat, shortness of breath, headaches, difficulty concentrating, dizziness, pale skin, leg cramps, and insomnia.
- the pharmaceutically effective dose of the ActRII signaling inhibitor is a dose sufficient to reduce or palliate one or more symptoms of anemia and one or more symptoms of myeloproliferative neoplasm-associated myelofibrosis.
- the pharmaceutically effective dose of the ActRII signaling inhibitor is a dose sufficient to prevent at least one symptom of anemia from worsening and at least one symptom of myeloproliferative neoplasm-associated myelofibrosis from worsening.
- anemia include fatigue, loss of energy, rapid heartbeat, shortness of breath, headaches, difficulty concentrating, dizziness, pale skin, leg cramps, and insomnia.
- myeloproliferative neoplasm-associated myelofibrosis include fatigue, night sweats, itchiness, abdominal discomfort, pain under the ribs on the left side, early satiety, or bone pain.
- the ActRIIB signaling inhibitor is dosed at intervals and amounts sufficient to achieve serum concentrations of 0.2 mg/kg or greater, for example, serum levels of 1 mg/kg or 2 mg/kg or greater.
- Dosing regimens may be designed to reach serum concentrations of between 0.2 and 15 mg/kg, and optionally between 1 and 5 mg/kg.
- serum levels of 0.2 mg/kg may be achieved with a single dose of 0.1 mg/kg or greater and serum levels of 1 mg/kg may be achieved with a single dose of 0.3 mg/kg or greater.
- the observed serum half-life of the molecule is between about 20 and 30 days, substantially longer than most Fc fusion proteins, and thus a sustained effective serum level may be achieved, for example, by dosing with 0.2-0.4 mg/kg on a weekly or biweekly basis, or higher doses may be used with longer intervals between dosings.
- doses of 1-3 mg/kg might be used on a monthly or bimonthly basis, and the effect on bone may be sufficiently durable that dosing is necessary only once every 3, 4, 5, 6, 9, 12 or more months.
- Serum levels of the ActRIIB signaling inhibitor can be measured by any means known to the skilled artisan.
- antibodies against the ActRIIB signaling inhibitor can be used to determine the serum levels of the ActRIIB signaling inhibitor using, e.g., an ELISA.
- the method provided herein also achieves significant effects on bone density and strength.
- the dose of the ActRIIB signaling inhibitor is about 0.1 mg/kg, about 0.3 mg/kg, about 0.45 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, 0.75 mg/kg, about 0.8 mg/kg, about 1.0 mg/kg, about 1.25 mg/kg, about 1.33 mg/kg, about 1.5 mg/kg, about 1.75 mg/kg, about 2.0 mg/kg, or about 2.25 mg/kg.
- the dose of the ActRIIB signaling inhibitor is between 0.1 mg/kg and 2.25 mg/kg. In certain embodiments, the dose of the ActRIIB signaling inhibitor is between 0.1 mg/kg and 1 mg/kg.
- the dose of the ActRIIB signaling inhibitor is between 0.3 mg/kg and 1.25 mg/kg. In certain embodiments, the dose of the ActRIIB signaling inhibitor is between 0.5 mg/kg and 1.5 mg/kg. In certain embodiments, the dose of the ActRIIB signaling inhibitor is between 0.1 mg/kg and 2.0 mg/kg. In certain embodiments, the dose of the ActRIIB signaling inhibitor is between 0.33 mg/kg and 2.0 mg/kg.
- the dose of the ActRIIB signaling inhibitor is between 0.75 mg/kg and 1.0 mg/kg, between 1.0 mg/kg and 1.25 mg/kg, between 1.25 mg/kg and 1.5 mg/kg, between 1.5 mg/kg and 1.75 mg/kg, or between 1.75 mg/kg and 2.0 mg/kg.
- the dose of the ActRIIB signaling inhibitor is a pharmaceutically effective dose.
- the dose of the ActRIIB signaling inhibitor is 0.33 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 0.45 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 0.6 mg/kg. In a specific
- the dose of the ActRIIB signaling inhibitor is 0.8 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 1.0 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 1.33 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 1.75 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 2.00 mg/kg.
- a dose provided herein e.g., a dose of an ActRIIB signaling inhibitor or a dose of a second active agent
- the word “about” refers to any number within 1, 5 or 10% of the referenced number.
- the dose of the ActRIIB signaling inhibitor is a
- the pharmaceutically effective dose of the ActRIIB signaling inhibitor is about 0.1 mg/kg, about 0.3 mg/kg, about 0.45 mg/kg, about 0.5 mg/kg, about 0.6 mg/kg, 0.75 mg/kg, about 0.8 mg/kg, about 1.0 mg/kg, about 1.25 mg/kg, about 1.33 mg/kg, about 1.5 mg/kg, about 1.75 mg/kg, about 2.0 mg/kg, or about 2.25 mg/kg.
- the pharmaceutically effective dose of the ActRIIB signaling inhibitor is between 0.1 mg/kg and 2.25 mg/kg.
- the pharmaceutically effective dose of the ActRIIB signaling inhibitor is between 0.1 mg/kg and 1 mg/kg.
- the pharmaceutically effective dose of the ActRIIB signaling inhibitor is between 0.3 mg/kg and 1.25 mg/kg. In certain embodiments, the pharmaceutically effective dose of the ActRIIB signaling inhibitor is between 0.5 mg/kg and 1.5 mg/kg. In certain embodiments, the pharmaceutically effective dose of the ActRIIB signaling inhibitor is between 0.1 mg/kg and 2.0 mg/kg. In certain embodiments, the pharmaceutically effective dose of the ActRIIB signaling inhibitor is between 0.33 mg/kg and 2.0 mg/kg.
- the pharmaceutically effective dose of the ActRIIB signaling inhibitor is between 0.75 mg/kg and 1.0 mg/kg, between 1.0 mg/kg and 1.25 mg/kg, between 1.25 mg/kg and 1.5 mg/kg, between 1.5 mg/kg and 1.75 mg/kg, or between 1.75 mg/kg and 2.0 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 0.33 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 0.45 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 0.6 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 0.8 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 1.0 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 1.33 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 1.75 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 2.00 mg/kg.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to increase the level of hemoglobin in the subject as compared to the level of hemoglobin in the subject at baseline.
- baseline refers to the time immediately prior to the first administration of the ActRIIB signaling inhibitor to the subject.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to increase the level of hemoglobin in the subject by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% over any consecutive 84-day period after the subject has been administered a first dose of the ActRIIB signaling inhibitor, wherein the subject has been transfused 0 units of red blood cell units during the consecutive 84-day period, as compared to the level of hemoglobin in the subject at baseline.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to increase the level of hemoglobin in the subject by at most 5%, at most 10%, at most 15%, at most 20%, at most 25%, at most 30%, at most 35%, at most 40%, at most 45%, at most 50%, at most 55%, at most 60%, at most 65%, at most 70%, at most 75%, at most 80%, at most 85%, at most 90%, at most 95%, or at most 100% over any consecutive 84-day period after the subject has been administered a first dose of the ActRIIB signaling inhibitor, wherein the subject has been transfused 0 units of red blood cell units during the consecutive 84-day period, as compared to the level of hemoglobin in the subject at baseline.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to increase the level of hemoglobin by at least 1.5 g/dL, at least 1.8 g g/dL, at least 2.0 g/dL, at least 2.2 g/dL, at least 2.4 g/dL, at least 2.6 g/dL, at least 2.8 g/dL, at least 3.0 g/dL, at least 3.2 g/dL, at least 3.4 g/dL, at least 3.6 g/dL, at least 3.8 g/dL, at least 4.0 g/dL, at least 5.0 g/dL, or at least 6.0 g/dL over any consecutive 84-day period after the subject has been administered a first dose of the ActRIIB signaling inhibitor, wherein the subject has been transfused 0 units of red blood cell units during the consecutive 84-day period, as compared to the level of hemoglobin in the
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to increase the level of hemoglobin by at most 1.5 g/dL, at most 1.8 g g/dL, at most 2.0 g/dL, at most 2.2 g/dL, at most 2.4 g/dL, at most 2.6 g/dL, at most 2.8 g/dL, at most 3.0 g/dL, at most 3.2 g/dL, at most 3.4 g/dL, at most 3.6 g/dL, at most 3.8 g/dL, at most 4.0 g/dL, at most 5.0 g/dL, or at most 6.0 g/dL over any consecutive 84-day period after the subject has been administered a first dose of the ActRIIB signaling inhibitor, wherein the subject has been transfused 0 units of red blood cell units during the consecutive 84-day period, as compared to the level of hemoglobin in the
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to result in the increase in hemoglobin level in the subject for at least 3, at least 4, at least 5, at least 6, at least 12, at least 18, at least 24 or at least 48 months after administration of the ActRIIB signaling inhibitor. In certain embodiments, the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to result in the increase in hemoglobin level in the subject indefinitely after administration of the ActRIIB signaling inhibitor. In certain
- the dose of the ActRIIB signaling inhibitor is between 0.33 mg/kg and 2.0 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.33 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.45 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.6 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.8 mg/kg. In a specific
- the dose of the ActRIIB signaling inhibitor is 1.0 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 1.33 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 1.75 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 2.00 mg/kg.
- the ActRIIB signaling inhibitor is an ActRIIB signaling inhibitor described in Section 5.4.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is luspatercept.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to result in red blood cell transfusion independence in the subject over any consecutive 84-day period after the subject has been administered a first dose of the ActRIIB signaling inhibitor.
- a subject is red blood cell transfusion- independent if the subject has received 0 red blood cell units during any consecutive 60-day, 61- day, 62-day, 63-day, 64-day, 65-day, 66-day, 67-day, 68-day, 69-day, 70-day, 71-day, 72-day, 73-day, 74-day, 75-day, 76-day, 77-day, 78-day, 79-day, 80-day, 81-day, 82-day, 83-day, 84- day, 85-day, 86-day, 87-day, 88-day, 89-day, or 90-day period.
- a subject is red blood cell transfusion-dependent if the subject has received an average red blood cell transfusion frequency of 2 to 4 red blood cell units per 28 days during a period of time of at least 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, or 90 days prior to a first administration of the ActRIIB signaling inhibitor to the subject.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to result in red blood cell transfusion independence in the subject for at least 3, at least 4, at least 5, at least 6, at least 12, at least 18, at least 24 or at least 48 months after administration of the ActRIIB signaling inhibitor.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to result in red blood cell transfusion independence in the subject indefinitely after administration of the ActRIIB signaling inhibitor.
- the dose of the ActRIIB signaling inhibitor is between 0.33 mg/kg and 2.0 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.33 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 0.45 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.6 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.8 mg/kg. In a specific
- the dose of the ActRIIB signaling inhibitor is 1.0 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 1.33 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 1.75 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 2.00 mg/kg.
- the ActRIIB signaling inhibitor is an ActRIIB signaling inhibitor described in Section 5.4.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is luspatercept.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to decrease the frequency of red blood cell transfusion in the subject as compared to the frequency of red blood cell transfusion in the subject at baseline.
- baseline refers to the time immediately prior to the first administration of the ActRIIB signaling inhibitor to the subject.
- the mean number of red blood cell units transfused in the subject per a four week period after the subject has been administered a first dose of the ActRIIB signaling inhibitor is compared to the mean number of red blood cell units transfused in the subject per a four week period at baseline.
- the dose of an ActRIIB signaling inhibitor administered to a subject treated according to the methods provided herein is sufficient to reduce the mean number of red blood cell units transfused in the subject per a four week period after the subject has been administered a first dose of the ActRIIB signaling inhibitor by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%), at least 80%>, at least 90%, or by at least 100% as compared to the mean number of red blood cell units transfused in the subject per a four week period at baseline.
- the dose of an ActRIIB signaling inhibitor administered to a subject treated according to the methods provided herein is sufficient to reduce the mean number of red blood cell units transfused in the subject per a four week period after the subject has been administered a first dose of the ActRIIB signaling inhibitor by at most 10%, at most 20%, at most 30%, at most 40%), at most 50%, at most 60%, at most 70%, at most 80%, at most 90%, or by at most 100%) as compared to the mean number of red blood cell units transfused in the subject per a four week period at baseline.
- the dose of an ActRIIB signaling inhibitor administered to a subject treated according to the methods provided herein is sufficient to reduce the mean number of red blood cell units transfused in the subject per a four week period after the subject has been administered a first dose of the ActRIIB signaling inhibitor by at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, or at least 8 units as compared to the mean number of red blood cell units transfused in the subject per a four week period at baseline.
- the dose of an ActRIIB signaling inhibitor administered to a subject treated according to the methods provided herein is sufficient to reduce the mean number of red blood cell units transfused in the subject per a four week period after the subject has been administered a first dose of the ActRIIB signaling inhibitor by at most 1, at most 2, at most 3, at most 4, at most 5, at most 6, at most 7, or at most 8 units as compared to the mean number of red blood cell units transfused in the subject per a four week period at baseline.
- one RBC unit refers to about 150 mL, 200 mL, 250 mL, 300 mL, 350 mL, 100-200 mL, 150-250 mL, 200-300 mL, 250-300 mL, or 250-350 mL of RBCs.
- the dose of the ActRIIB signaling inhibitor is between 0.33 mg/kg and 2.0 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.33 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.45 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.6 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 0.8 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 1.0 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 1.33 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 1.75 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 2.00 mg/kg. In certain embodiments, the ActRIIB signaling inhibitor is an ActRIIB signaling inhibitor described in Section 5.4. In specific embodiments, the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11. In specific embodiments, the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11. In a preferred embodiment, the ActRIIB signaling inhibitor is luspatercept.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to decrease transfusion burden in the subject by at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% over any period of time after the subject has been administered a first dose of the ActRIIB signaling inhibitor as compared to the transfusion burden in the subject at baseline.
- baseline refers to the time immediately prior to the first administration of the ActRIIB signaling inhibitor to the subject.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to decrease transfusion burden in the subject by at most 5%, at most 10%, at most 15%, at most 20%, at most 25%, at most 30%, at most 35%), at most 40%, at most 45%, at most 50%, at most 55%, at most 60%, at most 65%, at most 70%), at most 75%, at most 80%, at most 85%, at most 90%, at most 95%, or at most 100%) over any period of time after the subject has been administered a first dose of the ActRIIB signaling inhibitor as compared to the transfusion burden in the subject at baseline.
- the period of time over which the transfusion burden is decreased in the subject is at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, or at least 12 weeks. In certain embodiments, the period of time over which the transfusion burden is decreased in the subject is 12 weeks (i.e., 84 days). In certain embodiments, the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to decrease transfusion burden in the subject by at least 50% over any consecutive 84-day period after the subject has been administered a first dose of the ActRIIB signaling inhibitor as compared to the transfusion burden in the subject at baseline.
- the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to decrease the transfusion burden in the subject for at least 3, at least 4, at least 5, at least 6, at least 12, at least 18, at least 24 or at least 48 months after administration of the ActRIIB signaling inhibitor. In certain embodiments, the dose of an ActRIIB signaling inhibitor administered to a subject according to the methods provided herein is sufficient to decrease the transfusion burden in the subject indefinitely after administration of the ActRIIB signaling inhibitor. In certain embodiments, the dose of the ActRIIB signaling inhibitor is between 0.33 mg/kg and 2.0 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.33 mg/kg.
- the dose of the ActRIIB signaling inhibitor is 0.45 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.6 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 0.8 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 1.0 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 1.33 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 1.75 mg/kg. In a specific embodiment, the dose of the ActRIIB signaling inhibitor is 2.00 mg/kg.
- the ActRIIB signaling inhibitor is an ActRIIB signaling inhibitor described in Section 5.4. In specific embodiments, the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 11. In specific embodiments, the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 11. In specific embodiments, the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 11. In a preferred embodiment, the ActRIIB signaling inhibitor is luspatercept.
- anemia response is measured.
- anemia response is measured as it relates to hemoglobin (Hgb) increase, e.g., proportion of subjects achieving > 1.5 g/dL hemoglobin increase from baseline over any consecutive 84-day period without an RBC transfusion (e.g., in subjects receiving luspatercept).
- anemia response is measured as it relates to increased red blood cell (RBC)-transfusion independence, e.g., proportion of subjects who become RBC-transfusion free over any consecutive 84-day period (e.g., in subjects receiving luspatercept).
- RBC red blood cell
- anemia response is measured as it relates to time to anemia response, e.g., time from first luspatercept dose to first onset of anemia response (e.g., in subjects receiving luspatercept).
- anemia response is measured as it relates to duration of anemia response, e.g., the maximum duration of anemia response in subjects (e.g., in subjects receiving
- anemia response is measured as it relates to frequency of RBC transfusions, e.g., the mean number of RBC units transfused per subject per four weeks (e.g., in subjects receiving luspatercept).
- anemia response is measured as it relates to frequency of RBC transfusion dependence, e.g., proportion of RBC transfusion dependent subjects who reduce their transfusion burden by > 50% from baseline over any consecutive 84-day period (e.g., in subjects receiving luspatercept).
- anemia response is measured as it relates to proportion of subjects who achieve a reduction in fatigue symptom as recorded and assessed via the modified Myeloproliferative Neoplasm Symptom Assessment Form (MPN-SAF), (see Emanual et al., "Myeloproliferative Neoplasm (MPN) Symptom Assessment Form Total Symptom Score: Prospective International Assessment of an Abbreviated Symptom Burden Scoring System Among Patients With MPNs," J. Clin. Oncol.
- MPN-SAF Myeloproliferative Neoplasm Symptom Assessment Form
- anemia response is measured as it relates to the proportion of subjects who achieve > 50% reduction in total symptom score (TSS) as recorded and assessed via the modified Myeloproliferative Neoplasm Symptom Assessment Form (MPN-SAF), (see Emanual et al., "Myeloproliferative Neoplasm (MPN) Symptom
- anemia response is measured as it relates to Health-related quality of life (HRQoL) measures, e.g., measure mean changes in HRQoL questionnaire domain scores compared to baseline scores (e.g., in subjects receiving luspatercept).
- HRQoL Health-related quality of life
- anemia response is measured as it relates to EQ-5D-5L questionnaires scores (EuroQol, Rotterdam, The Netherlands), e.g., measuring mean changes in EQ-5D-5L
- anemia response is measured as it relates to adverse events (AEs) e.g., the type, frequency, and severity, of adverse events (e.g., in subjects receiving luspatercept).
- AEs adverse events
- anemia response is measured using antidrug antibodies (ADA) (e.g., frequency of antidrug antibodies and effects on efficacy, safety, or
- anemia response is measured using pharmacokinetic parameters, e.g., plasma concentration-time curve, area under the curve (AUC), Cmax (e.g., for subjects receiving luspatercept).
- pharmacokinetic parameters e.g., plasma concentration-time curve, area under the curve (AUC), Cmax (e.g., for subjects receiving luspatercept).
- the dose of the ActRIIB signaling inhibitor is administered via injection. In certain embodiments, the dose of the ActRIIB signaling inhibitor is
- the dose of the ActRIIB signaling inhibitor is administered once every 3 weeks.
- the ActRIIB signaling inhibitor is a polypeptide comprising the amino acid sequence of SEQ ID NO: 1 1.
- the ActRIIB signaling inhibitor is a polypeptide comprising an amino acid sequence consisting of the amino acid sequence of SEQ ID NO: 1 1.
- the ActRIIB signaling inhibitor is a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO: 1 1.
- the ActRIIB signaling inhibitor is luspatercept.
- ActRIIB polypeptide variants may be tested for their ability to inhibit ActRIIB signaling.
- compounds can be tested for their ability to inhibit ActRIIB signaling. Once activity of inhibitors of ActRIIB signaling is confirmed, these compounds can be used with the methods provided herein.
- the assays below are described for ActRIIA but can be performed analogously for ActRIIB.
- an ActRIIA polypeptide variant on the expression of genes involved in bone production or bone destruction may be assessed. This may, as needed, be performed in the presence of one or more recombinant ActRIIA ligand proteins (e.g., activin), and cells may be transfected so as to produce an ActRIIA polypeptide and/or variants thereof, and optionally, an ActRIIA ligand.
- an ActRIIA polypeptide may be administered to a mouse or other animal, and one or more bone properties, such as density or volume may be assessed. The healing rate for bone fractures may also be evaluated.
- Dual-energy x-ray absorptiometry is a well-established, non-invasive, quantitative technique for assessing bone density in an animal.
- central DEXA systems may be used to evaluate bone density in the spine and pelvis. These are the best predictors of overall bone density.
- Peripheral DEXA systems may be used to evaluate bone density in peripheral bones, including, for example, the bones of the hand, wrist, ankle and foot.
- Traditional x-ray imaging systems, including CAT scans may be used to evaluate bone growth and fracture healing.
- bone density can be measured using quantitative computed tomography (qCT). The mechanical strength of bone may also be evaluated.
- qCT quantitative computed tomography
- ActRIIA polypeptides e.g., soluble ActRIIA polypeptides
- activin polypeptides to identify compounds (agents) which are agonist or antagonists of the activin-ActRIIA signaling pathway.
- Compounds identified through this screening can be tested to assess their ability to modulate bone growth or mineralization in vitro.
- these compounds can further be tested in animal models to assess their ability to modulate tissue growth in vivo.
- the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an ActRIIA polypeptide to activin.
- the assay can be used to identify compounds that enhance binding of an ActRIIA polypeptide to activin.
- the compounds can be identified by their ability to interact with an activin or ActRIIA polypeptide.
- test compounds (agents) used herein may be created by any combinatorial chemical method.
- the subject compounds may be naturally occurring biomolecules synthesized in vivo or in vitro.
- Compounds (agents) to be tested for their ability to act as modulators of tissue growth can be produced, for example, by bacteria, yeast, plants or other organisms (e.g., natural products), produced chemically (e.g., small molecules, including peptidomimetics), or produced recombinantly.
- Test compounds contemplated herein include non-peptidyl organic molecules, peptides, polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
- the test agent is a small organic molecule having a molecular weight of less than about 2,000 daltons.
- the test compounds can be provided as single, discrete entities, or provided in libraries of greater complexity, such as made by combinatorial chemistry. These libraries can comprise, for example, alcohols, alkyl halides, amines, amides, esters, aldehydes, ethers and other classes of organic compounds. Presentation of test compounds to the test system can be in either an isolated form or as mixtures of compounds, especially in initial screening steps.
- the compounds may be derivatized with other compounds and have derivatizing groups that facilitate isolation of the compounds.
- derivatizing groups include biotin, fluorescein, digoxygenin, green fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S transferase (GST), photoactivatible crosslinkers or any combination thereof.
- the compound of interest is contacted with an isolated and purified ActRIIA polypeptide which is ordinarily capable of binding to activin.
- an isolated and purified ActRIIA polypeptide which is ordinarily capable of binding to activin.
- a composition containing an ActRIIA ligand To the mixture of the compound and ActRIIA polypeptide is then added a composition containing an ActRIIA ligand.
- Detection and quantification of ActRIIA/activin complexes provides a means for determining the compound's efficacy at inhibiting (or potentiating) complex formation between the ActRIIA polypeptide and activin.
- the efficacy of the compound can be assessed by generating dose response curves from data obtained using various concentrations of the test compound.
- a control assay can also be performed to provide a baseline for comparison. For example, in a control assay, isolated and purified activin is added to a composition containing the ActRIIA polypeptide, and the formation of
- ActRIIA/activin complex is quantitated in the absence of the test compound. It will be understood that, in general, the order in which the reactants may be admixed can be varied, and can be admixed simultaneously. Moreover, in place of purified proteins, cellular extracts and lysates may be used to render a suitable cell-free assay system.
- Complex formation between the ActRIIA polypeptide and activin may be detected by a variety of techniques. For instance, modulation of the formation of complexes can be quantitated using, for example, detectably labeled proteins such as radiolabeled (e.g., 32P, 35S, 14C or 3H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIA polypeptide or activin, by immunoassay, or by chromatographic detection.
- detectably labeled proteins such as radiolabeled (e.g., 32P, 35S, 14C or 3H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIA polypeptide or activin
- contemplated herein is the use of fluorescence polarization assays and fluorescence resonance energy transfer (FRET) assays in measuring, either directly or indirectly, the degree of interaction between an ActRIIA polypeptide and its binding protein.
- FRET fluorescence resonance energy transfer
- other modes of detection such as those based on optical waveguides (PCT Publication WO 96/26432 and U. S. Pat. No. 5,677, 196), surface plasmon resonance (SPR), surface charge sensors, and surface force sensors, are compatible with many embodiments described herein.
- an interaction trap assay also known as the "two hybrid assay” can be used for identifying agents that disrupt or potentiate interaction between an ActRIIA polypeptide and its binding protein. See for example, U.S. Pat. No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J Biol Chem 268: 12046-12054; Bartel et al. (1993)
- the subject compounds are identified by their ability to interact with an ActRIIA or activin polypeptide.
- the interaction between the compound and the ActRIIA or activin polypeptide may be covalent or non-covalent.
- such interaction can be identified at the protein level using in vitro biochemical methods, including photo- crosslinking, radiolabeled ligand binding, and affinity chromatography (Jakoby W B et al., 1974, Methods in Enzymology 46: 1).
- the compounds may be screened in a mechanism based assay, such as an assay to detect compounds which bind to an activin or ActRIIA polypeptide. This may include a solid phase or fluid phase binding event.
- the gene encoding an activin or ActRIIA polypeptide can be transfected with a reporter system (e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein) into a cell and screened against the library preferably by a high throughput screening or with individual members of the library.
- a reporter system e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein
- Other mechanism based binding assays may be used, for example, binding assays which detect changes in free energy. Binding assays can be performed with the target fixed to a well, bead or chip or captured by an immobilized antibody or resolved by capillary electrophoresis. The bound compounds may be detected usually using colorimetric or fluorescence or surface plasmon resonance.
- This example relates to a Phase 2, multicenter, open-label study to evaluate luspatercept, an ActRIIB signaling inhibitor, in subjects with myeloproliferative neoplasm- associated myelofibrosis who have anemia with and without red blood cell-transfusion dependence.
- the study is divided into a Screening Period, a Treatment Period (consisting of a Primary Phase, a Day 169 Disease Response Assessment, and an Extension Phase), followed by a Posttreatment Follow-up Period.
- phase 2 study The purpose of this phase 2 study is to evaluate if there is an efficacy signal with luspatercept in patients with MPN-associated MF who are anemic and may or may not be RBC transfusion dependent by correcting ineffective erythropoiesis and thereby lessening anemia, a condition that develops in nearly all MPN-associated MF patients (of which fatigue is a symptom).
- Cohort 1 contains up to 20 subjects with anemia only that are not currently receiving RBC transfusions (these subjects are referred to as "anemia only” throughout this example, defined as having received 0 RBC units/84 days immediately up to the Cycle 1, Day 1 (ClDl) date);
- Cohort 2 contains up to 20 subjects that are RBC-transfusion dependent (these subjects are referred to as "RBC-transfusion dependent" throughout the example, defined as having received an average RBC transfusion frequency of 2 to 4 RBC units/28 days over at least the 84 days immediately up to the ClDl date);
- Cohort 3A contains > 10 subjects (Cohort 3 contains 30 subjects in total) who meet the eligibility criteria for Cohort 1 (anemia only) while being on a stable dose of ruxolitinib for at least 112 days immediately prior to the enrollment date; and
- Cohort 3A contains > 10 subjects (Cohort 3 contains 30 subjects in total) who meet the eligibility criteria for Cohort 1 (anemia only) while being on a stable dose of ruxolitin
- anemia response as it relates to hemoglobin (Hgb) increase proportion of cohorts 1 and 3 A subjects achieving > 1.5 g/dL hemoglobin increase from baseline over any consecutive 84-day period without an RBC transfusion; time frame of measurements is approximately up to day 168;
- time to anemia response time from first luspatercept dose to first onset of anemia response in each of the cohorts; time frame of measurements is approximately up to 2 years
- duration of anemia response the maximum duration of anemia response in each of the cohorts; time frame of measurements is approximately up to 2 years
- frequency of RBC transfusions the mean number of RBC units transfused per subject per four week; time frame of measurements is approximately up to 2 years
- frequency of RBC transfusion dependence Proportion of RBC transfusion dependent subjects who reduce their transfusion burden by > 50% from baseline over any consecutive 84-day period; time frame of measurements is approximately up to 2 years
- Subjects must satisfy the criteria in this section to be enrolled in the study (with the enrollment date defined as the date in which the subject is assigned a cohort in Integrated Response Technology [IRT]) and receive their first dose of luspatercept.
- IRT Integrated Response Technology
- the subject must be >18 years of age at the time of signing the informed consent form (ICF).
- the subject has MPN-associated myelofibrosis (PMF, post-PV MF, and/or post-ET MF) as confirmed from the local pathology report.
- PMF MPN-associated myelofibrosis
- post-PV MF post-PV MF
- post-ET MF MPN-associated myelofibrosis
- the subject has anemia defined as: (I) Cohorts 1 and 3 A: (a) subject has > 3 Hgb levels of ⁇ 9.5 g/dL recorded on > 3 different days, including the day of dosing, in the 84-day period immediately up to the C1D1 date; no subjects with an interval > 42 days between hemoglobin measurements are enrolled; and (b) there must not be any RBC transfusions within the 84-day period immediately up to the C1D1 date; and (II) Cohorts 2 and 3B: (a) subject has an average RBC-transfusion frequency of 2 to 4 RBC units/28 days over at least the 84 days immediately up to the C1D1 date; there must be no interval > 42 days without > 1 RBC- transfusion; (b) subjects must have a Hgb value of ⁇ 13 g/dL on C1D1 prior to luspatercept administration; (c) only RBC transfusions given when the Hgb ⁇ 9.5 g/dL are scored
- the subject has an Eastern Cooperative Oncology Group (ECOG) performance score of ⁇ 2. See, e.g., Oken et al. (1982). "Toxicity and response criteria of the Eastern Cooperative Oncology Group". Am. J. Clin. Oncol. 5 (6): 649-55, which is incorporated herein by reference in its entirety, regarding the ECOG performance score.
- ECOG performance score A subject having an ECOG performance score of 0 is asymptomatic (i.e., fully active, able to carry on all pre-disease activities without restriction).
- a subject having an ECOG performance score of 1 is symptomatic but completely ambulatory (i.e., restricted in physically strenuous activity but ambulatory and able to carry out work of a light or sedentary nature, for example, light housework, office work).
- a subject having an ECOG performance score of 2 is symptomatic, ⁇ 50% in bed during the day (i.e., ambulatory and capable of all self care but unable to carry out any work activities; up and about more than 50% of waking hours).
- a subject having an ECOG performance score of 3 is symptomatic, >50% in bed, but not bedbound (i.e., capable of only limited self-care, confined to bed or chair 50% or more of waking hours).
- a subject having an ECOG performance score of 4 is bedbound (i.e., completely disabled; cannot carry on any self-care; totally confined to bed or chair).
- a subject having an ECOG performance score of 5 is dead.
- the subject is not anticipated during the 6 months from the C1D1 date to receive a hematopoietic cell transplant.
- FCBP childbearing potential
- FCBP participating in the study must: (a) have 2 negative pregnancy tests as verified by the Investigator prior to starting study therapy; she must agree to ongoing pregnancy testing during the course of the study, and after end of study treatment, this applies even if the subject practices true abstinence from
- heterosexual contact either commit to true abstinence from heterosexual contact (which must be reviewed on a monthly basis and source documented) or agree to use, and be able to comply with, effective contraception without interruption, 28 days prior to starting
- investigational product during the study therapy (including dose interruptions), and for 12 weeks (approximately 5 times the mean terminal halflife of luspatercept based on multiple-dose pharmacokinetics [PK] data) after discontinuation of study therapy.
- Male subjects must: (a) practice true abstinence (which must be reviewed on a monthly basis) or agree to use a condom during sexual contact with a pregnant female or a female of childbearing potential while participating in the study, during dose interruptions and for at least 12 weeks (approximately 5 times the mean terminal half-life of luspatercept based on multiple-dose PK data) following investigational product discontinuation, even if he has undergone a successful vasectomy.
- the dose of luspatercept is 1.75 mg/kg.
- Luspatercept is administered to the subject subcutaneously once every 21 days for up to 2 years.
- Myeloproliferative neoplasm (MPN)-associated myelofibrosis (MF) is a clonal myeloid neoplasm characterized by bone marrow fibrosis, defective bone marrow function, extramedullary hematopoiesis, a propensity for transformation to blast phase, and inflammation (Mesa RA, et al. Leuk Res. 2011;35(1): 12-13).
- Anemia and red blood cell (RBC) transfusion dependence (TD) are independent adverse prognostic and predictive variables for survival among these patients (Passamonti F, et al. Blood. 2010; 115(9): 1703-1708; Maria C, et al.
- Luspatercept is a recombinant fusion protein consisting of a modified activin receptor type IIB linked to the Fc domain of human immunoglobulin Gl (IgGl) ( Figure 1) (Attie KM, et al. Am J Hematol. 2014;89(7):766-770; Suragani RN, et al. Nat Med. 2014;20(4):408-414). Luspatercept acts as an erythroid maturation agent by binding specific transforming growth factor- ⁇ (TGF- ⁇ ) superfamily ligands such as growth differentiation factor- 11 (GDF11), blocking their inhibitory effect, and leading to increased RBC production (Suragani RN, et al. Nat Med. 2014;20(4):408-414). In a recent phase 2 study, luspatercept was shown to be effective and well tolerated for the treatment of anemia in patients with lower-risk
- the objective of this clinical trial is to evaluate the efficacy and safety of luspatercept for the treatment of anemia in patients with MPN-associated MF with or without RBC-TD.
- the inclusion criteria for this study is: (i) age > 18 years; (ii) MPN-associated MF (primary MF, post-polycythemia vera MF, or post-essential thrombocythemia MF); (iii) Anemia, defined as: (a) Cohorts 1 and 3a: > 3 hemoglobin (Hb) levels ⁇ 9.5 g/dL on > 3 days (including day of dosing), with no RBC transfusions in the 84 days prior to cycle 1 day 1 (ClDl); > 42 days between measurements will be excluded; (b) Cohorts 2 and 3b: average RBC transfusion frequency of 2-4 RBC units/28 days over > 84 days prior to ClDl, with no interval > 42 days without > 1 RBC transfusion; Hb ⁇ 13 g/dL on ClDl prior to luspatercept administration; and (iv) Eastern Cooperative Oncology Group performance status ⁇ 2.
- the study comprises 3 periods (Figure 2): (i) Screening period; (ii) Treatment period (primary phase, disease response assessment at day 169, and extension phase); and (iii) Post- treatment follow-up period.
- All patients will receive luspatercept 1 mg/kg subcutaneously on day 1 of each 21- day cycle.
- Patients will be enrolled in cohorts according to RBC transfusion requirement: (i) Cohorts 1 and 3a (anemia only); and (ii) Cohorts 2 and 3b (RBC-TD). Best supportive care may be used in combination with study treatment.
- Disease response assessment should be completed at day 169 following the first dose of study treatment. Responders may continue treatment for up to an additional 1.5 years. Non-responders will discontinue treatment.
- Pharmacokinetic analyses will be based on all patients who have evaluable concentration data to determine the pharmacokinetic parameters.
- fusion protein comprising a SGRGEAETRECIYYNANWELERTNQSGLERCEGE soluble extracellular QDKRLHC YASWANS SGTIELVKKGCWLDDFNC Y domain of ActRIIB (A64; DRQECVATEENPQVYFCCCEGNFCNERFTHLPEA SEQ ID NO: 17) fused to an GGPEVTYEPPPTAPTGGGTHTCPPCPAPELLGGPS Fc domain VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK
- fusion protein comprising a SGRGEAETRECIYYNANWELERTNQSGLERCEGE soluble extracellular QDKRLHC YASWANS SGTIELVKKGCWLDDFNC Y domain of ActRIIB (A64) DRQECVATEENPQVYFCCCEGNFCNERFTHLPEA with the C-terminal 15 GGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS amino acids deleted (SEQ RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA ID NO: 5) fused to an Fc KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK domain CK VSNK ALP VPIEKTI SK AKGQPREPQ V YTLPP SR
- fusion protein comprising a SGRGEAETRECIYYNANWELERTNQSGLERCEGE soluble extracellular QDKRLHC YAS WRNS SGTIEL VKKGCWLDDFNC Y domain of ActRIIB (R64; DRQECVATEENPQVYFCCCEGNFCNERFTHLPEA SEQ ID NO: 15) fused to an GGPEVTYEPPPTAPTGGGTHTCPPCPAPELLGGPS Fc domain VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVK
- fusion protein comprising a SGRGEAETRECIYYNANWELERTNQSGLERCEGE soluble extracellular QDKRLHC YAS WRNS SGTIEL VKKGCWLDDFNC Y domain of ActRIIB (R64) DRQECVATEENPQVYFCCCEGNFCNERFTHLPEA with the C-terminal 15 GGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS amino acids deleted (SEQ RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNA ID NO: 16) fused to an Fc KTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK domain CK VSNK ALP VPIEKTI SK AKGQPREPQ V YTLPP SR
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Engineering & Computer Science (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- Gastroenterology & Hepatology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Wood Science & Technology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Engineering & Computer Science (AREA)
- Hematology (AREA)
- Biophysics (AREA)
- Diabetes (AREA)
- Dermatology (AREA)
- Toxicology (AREA)
- Biomedical Technology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN201880052595.1A CN111050770A (zh) | 2017-06-14 | 2018-06-13 | 治疗骨髓增生性肿瘤相关的骨髓纤维化和贫血的方法 |
| US16/621,866 US20200101134A1 (en) | 2017-06-14 | 2018-06-13 | Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia |
| RS20241154A RS66093B1 (sr) | 2017-06-14 | 2018-06-13 | Metode lečenja mijelofibroze povezane sa mijeloproliferativnom neoplazmom i anemije |
| LTEPPCT/US2018/037213T LT3638243T (lt) | 2017-06-14 | 2018-06-13 | Su mieloproliferacine neoplazma susijusios mielofibrozės ir anemijos gydymo būdai |
| ES18816685T ES2991738T3 (es) | 2017-06-14 | 2018-06-13 | Métodos para para tratar la mielofibrosis asociada a neoplasia mieloproliferativa y la anemia |
| DK18816685.4T DK3638243T3 (da) | 2017-06-14 | 2018-06-13 | Fremgangsmåder til behandling af myeloproliferativ neoplasma-forbundet myelofibrose og anæmi |
| SM20240437T SMT202400437T1 (it) | 2017-06-14 | 2018-06-13 | Metodi per trattare mielofibrosi associata a neoplasia mieloproliferativa e anemia |
| EP18816685.4A EP3638243B1 (en) | 2017-06-14 | 2018-06-13 | Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia |
| FIEP18816685.4T FI3638243T3 (fi) | 2017-06-14 | 2018-06-13 | Menetelmiä myeloproliferatiivin neoplasma-assosioidun myelofibroosin ja anemian hoitamiseksi |
| SI201831166T SI3638243T1 (sl) | 2017-06-14 | 2018-06-13 | Postopki Zdravljenja Mielofibroze In Anemije, Povezane Z Mieloproliferativno Neoplazmo |
| JP2019569312A JP7496686B2 (ja) | 2017-06-14 | 2018-06-13 | 骨髄増殖性腫瘍関連骨髄線維症及び貧血を治療するための方法 |
| EP24186606.0A EP4454707A3 (en) | 2017-06-14 | 2018-06-13 | Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia |
| PL18816685.4T PL3638243T3 (pl) | 2017-06-14 | 2018-06-13 | Sposoby leczenia mielofibrozy związanej z nowotworem mieloproliferacyjnym i niedokrwistości |
| HRP20241477TT HRP20241477T1 (hr) | 2017-06-14 | 2018-06-13 | Postupci liječenja mijeloproliferativne neoplazme povezane s mijelofibrozom i anemijom |
| JP2024027645A JP2024075579A (ja) | 2017-06-14 | 2024-02-27 | 骨髄増殖性腫瘍関連骨髄線維症及び貧血を治療するための方法 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762519725P | 2017-06-14 | 2017-06-14 | |
| US62/519,725 | 2017-06-14 | ||
| US201862679210P | 2018-06-01 | 2018-06-01 | |
| US62/679,210 | 2018-06-01 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2018231905A1 true WO2018231905A1 (en) | 2018-12-20 |
| WO2018231905A8 WO2018231905A8 (en) | 2020-01-30 |
Family
ID=64660712
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/037213 Ceased WO2018231905A1 (en) | 2017-06-14 | 2018-06-13 | Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia |
Country Status (16)
| Country | Link |
|---|---|
| US (1) | US20200101134A1 (https=) |
| EP (2) | EP4454707A3 (https=) |
| JP (2) | JP7496686B2 (https=) |
| CN (1) | CN111050770A (https=) |
| DK (1) | DK3638243T3 (https=) |
| ES (1) | ES2991738T3 (https=) |
| FI (1) | FI3638243T3 (https=) |
| HR (1) | HRP20241477T1 (https=) |
| HU (1) | HUE068733T2 (https=) |
| LT (1) | LT3638243T (https=) |
| PL (1) | PL3638243T3 (https=) |
| PT (1) | PT3638243T (https=) |
| RS (1) | RS66093B1 (https=) |
| SI (1) | SI3638243T1 (https=) |
| SM (1) | SMT202400437T1 (https=) |
| WO (1) | WO2018231905A1 (https=) |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10548976B2 (en) | 2015-05-20 | 2020-02-04 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps |
| EP3490582A4 (en) * | 2016-07-27 | 2020-04-01 | Acceleron Pharma Inc. | METHOD AND COMPOSITIONS FOR TREATING MYELOFIBROSE |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| WO2023023345A3 (en) * | 2021-08-19 | 2023-05-11 | Keros Therapeutics, Inc. | Methods of using activin receptor type ii signaling inhibitors |
| JP2023526590A (ja) * | 2020-05-15 | 2023-06-22 | セルジーン コーポレーション | ActRIIBリガンドトラップ及びmTOR阻害剤を使用して貧血を治療するための方法及び組成物 |
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| EP4135736A4 (en) * | 2020-04-13 | 2024-06-26 | Celgene Corporation | METHODS OF TREATING ANEMIA USING ACTRIIB LIGAND TRAP AND FEDRATINIB |
| US12186370B1 (en) | 2020-11-05 | 2025-01-07 | Celgene Corporation | ACTRIIB ligand trap compositions and uses thereof |
| US12350313B2 (en) | 2016-11-10 | 2025-07-08 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
| US12522646B2 (en) | 2020-03-20 | 2026-01-13 | Keros Therapeutics, Inc. | Activin receptor type II chimeras and methods of use thereof |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JP7663502B2 (ja) * | 2018-10-31 | 2025-04-16 | セルジーン コーポレイション | 環状鉄芽球が見られる対象における非常に低リスク、低リスクまたは中程度のリスクの骨髄異形成症候群による貧血の、アクチビン-actriiリガンドトラップを用いた治療 |
| US20220372135A1 (en) | 2019-09-27 | 2022-11-24 | Disc Medicine, Inc. | Methods for treating myelofibrosis and related conditions |
| KR20230012539A (ko) | 2020-05-13 | 2023-01-26 | 디스크 메디슨, 인크. | 골수섬유증을 치료하기 위한 항-헤모주벨린 (hjv) 항체 |
| WO2022271716A2 (en) * | 2021-06-21 | 2022-12-29 | Keros Therapeutics, Inc. | Methods of using activin receptor type ii signaling inhibitors |
| WO2025137373A1 (en) * | 2023-12-19 | 2025-06-26 | Cellarity, Inc. | Disease detection systems and methods |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| WO2011020045A1 (en) | 2009-08-13 | 2011-02-17 | Acceleron Pharma Inc. | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| WO2013059347A1 (en) | 2011-10-17 | 2013-04-25 | Acceleron Pharma, Inc. | Methods and compositions for treating ineffective erythropoiesis |
| WO2016090077A1 (en) | 2014-12-03 | 2016-06-09 | Celgene Corporation | Activin-actrii antagonists and uses for treating anemia |
| WO2016183280A1 (en) * | 2015-05-13 | 2016-11-17 | Celgene Corporation | Treatment of beta-thalassemia using actrii ligand traps |
| US20170037100A1 (en) * | 2015-08-04 | 2017-02-09 | Acceleron Pharma Inc. | Methods for treating myeloproliferative disorders |
| WO2017091706A1 (en) * | 2015-11-23 | 2017-06-01 | Acceleron Pharma Inc. | Methods for treating eye disorders |
Family Cites Families (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO1987005330A1 (en) | 1986-03-07 | 1987-09-11 | Michel Louis Eugene Bergh | Method for enhancing glycoprotein stability |
| US5080891A (en) | 1987-08-03 | 1992-01-14 | Ddi Pharmaceuticals, Inc. | Conjugates of superoxide dismutase coupled to high molecular weight polyalkylene glycols |
| US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
| US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
| US5814565A (en) | 1995-02-23 | 1998-09-29 | University Of Utah Research Foundation | Integrated optic waveguide immunosensor |
| NZ306767A (en) | 1995-04-11 | 2000-03-27 | Univ Johns Hopkins | Method of identifying molecular interactions employing counterselection and at least two hybrid molecules or two hybrid systems |
| JP2008507288A (ja) | 2004-07-23 | 2008-03-13 | アクセルロン ファーマ インコーポレーテッド | ActRII受容体ポリペプチド、方法、および組成物 |
| US20100028332A1 (en) | 2006-12-18 | 2010-02-04 | Acceleron Pharma Inc. | Antagonists of actriib and uses for increasing red blood cell levels |
| TW201803890A (zh) | 2007-02-02 | 2018-02-01 | 艾瑟勒朗法瑪公司 | 衍生自ActRIIB的變體與其用途 |
| TW201803586A (zh) | 2008-08-14 | 2018-02-01 | 艾瑟勒朗法瑪公司 | 使用gdf阱以增加紅血球水平 |
| JP2017509647A (ja) | 2014-03-21 | 2017-04-06 | アクセルロン ファーマ, インコーポレイテッド | アクチビンbおよび/またはgdf11の阻害によって赤血球レベルを増大させ、無効赤血球生成を処置する方法 |
| CN114699529A (zh) * | 2014-06-13 | 2022-07-05 | 阿塞勒隆制药公司 | 用于治疗溃疡的方法和组合物 |
| MA45811A (fr) | 2016-07-27 | 2019-06-05 | Acceleron Pharma Inc | Méthodes et compositions de traitement de maladie. |
-
2018
- 2018-06-13 PL PL18816685.4T patent/PL3638243T3/pl unknown
- 2018-06-13 DK DK18816685.4T patent/DK3638243T3/da active
- 2018-06-13 SI SI201831166T patent/SI3638243T1/sl unknown
- 2018-06-13 PT PT188166854T patent/PT3638243T/pt unknown
- 2018-06-13 WO PCT/US2018/037213 patent/WO2018231905A1/en not_active Ceased
- 2018-06-13 RS RS20241154A patent/RS66093B1/sr unknown
- 2018-06-13 FI FIEP18816685.4T patent/FI3638243T3/fi active
- 2018-06-13 EP EP24186606.0A patent/EP4454707A3/en active Pending
- 2018-06-13 JP JP2019569312A patent/JP7496686B2/ja active Active
- 2018-06-13 LT LTEPPCT/US2018/037213T patent/LT3638243T/lt unknown
- 2018-06-13 HR HRP20241477TT patent/HRP20241477T1/hr unknown
- 2018-06-13 HU HUE18816685A patent/HUE068733T2/hu unknown
- 2018-06-13 ES ES18816685T patent/ES2991738T3/es active Active
- 2018-06-13 EP EP18816685.4A patent/EP3638243B1/en active Active
- 2018-06-13 SM SM20240437T patent/SMT202400437T1/it unknown
- 2018-06-13 CN CN201880052595.1A patent/CN111050770A/zh active Pending
- 2018-06-13 US US16/621,866 patent/US20200101134A1/en not_active Abandoned
-
2024
- 2024-02-27 JP JP2024027645A patent/JP2024075579A/ja active Pending
Patent Citations (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| WO2011020045A1 (en) | 2009-08-13 | 2011-02-17 | Acceleron Pharma Inc. | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| WO2013059347A1 (en) | 2011-10-17 | 2013-04-25 | Acceleron Pharma, Inc. | Methods and compositions for treating ineffective erythropoiesis |
| US20130243743A1 (en) * | 2011-10-17 | 2013-09-19 | Acceleron Pharma, Inc. | Methods and compositions for treating ineffective erythropoiesis |
| WO2016090077A1 (en) | 2014-12-03 | 2016-06-09 | Celgene Corporation | Activin-actrii antagonists and uses for treating anemia |
| WO2016183280A1 (en) * | 2015-05-13 | 2016-11-17 | Celgene Corporation | Treatment of beta-thalassemia using actrii ligand traps |
| US20170037100A1 (en) * | 2015-08-04 | 2017-02-09 | Acceleron Pharma Inc. | Methods for treating myeloproliferative disorders |
| WO2017091706A1 (en) * | 2015-11-23 | 2017-06-01 | Acceleron Pharma Inc. | Methods for treating eye disorders |
Non-Patent Citations (45)
| Title |
|---|
| A AGARWAL ET AL.: "Bone marrow fibrosis in primary myelofibrosis: pathogenic mechanisms and the role of TGF-beta", STEM CELL INVESTIGATION, 1 January 2016 (2016-01-01), pages 5 - 5, XP055738249, DOI: 10.3978/j.issn.2306-9759.2016.02.03 |
| ATTIE KM ET AL., AM J HEMATOL., vol. 89, no. 7, 2014, pages 766 - 770 |
| ATTISANO ET AL., CELL, vol. 68, no. 1, 1992, pages 97 - 108 |
| BALINT ET AL., GENE, vol. 137, 1993, pages 109 - 118 |
| BROWN ET AL., MOL. CELL BIOL., vol. 12, 1992, pages 2644 - 2652 |
| CUNNINGHAM ET AL., SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| CWIRLA ET AL., PNAS USA, vol. 87, 1990, pages 6378 - 6382 |
| DEVLIN ET AL., SCIENCE, vol. 249, 1990, pages 404 - 406 |
| EDGE ET AL., ANAL. BIOCHEM., vol. 118, 1981, pages 131 |
| ELENA C ET AL., HAEMATOLOGICA., vol. 96, no. 1, 2011, pages 167 - 170 |
| EMANUAL ET AL.: "Myeloproliferative Neoplasm (MPN) Symptom Assessment Form Total Symptom Score: Prospective International Assessment of an Abbreviated Symptom Burden Scoring System Among Patients With MPNs", J. CLIN. ONCOL., vol. 30, no. 33, 2012, pages 4098 - 4103 |
| GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS |
| GREENER ET AL., STRATEGIES IN MOL BIOL, vol. 7, 1994, pages 32 - 34 |
| GRODBERG ET AL., EUR. J. BIOCHEM., vol. 218, 1993, pages 597 - 601 |
| GUSTIN ET AL., VIROLOGY, vol. 193, 1993, pages 653 - 660 |
| HAKIMUDDIN ET AL.: "259", ARCH. BIOCHEM. BIOPHYS., 1987, pages 52 |
| IKE ET AL., NUCLEIC ACID RES., vol. 11, 1983, pages 477 |
| ITAKURA ET AL., ANNU. REV. BIOCHEM., vol. 53, 1984, pages 323 |
| ITAKURA ET AL., SCIENCE, vol. 198, 1984, pages 1056 |
| ITAKURA ET AL.: "Macromolecules", 1981, ELSEVIER, article "Recombinant DNA, Proc. 3rd Cleveland Sympos.", pages: 273 - 289 |
| KEOHANE C ET AL.: "Ruxolitinib for myelofibrosis", LINICAL INVESTIGATION, FUTURE SCIENCE, UK, vol. 2, 30 September 2012 (2012-09-30), pages 1023 - 1031, XP009519059, DOI: 10.4155/CLI.12.94 |
| LEEMCPHERRON, PROC. NATL. ACAD. SCI., vol. 98, no. 9306-93, 2001, pages 11 |
| LEUNG ET AL., METHOD CELL MOL BIOL, vol. 1, 1989, pages 11 - 19 |
| LOWMAN ET AL., BIOCHEMISTR, vol. 30, 1991, pages 10832 - 10838 |
| MATHEWSVALE, CELL, vol. 65, 1991, pages 973 - 982 |
| MCKNIGHT ET AL., SCIENCE, vol. 232, 1982, pages 316 |
| MESA RA ET AL., LEUK RES., vol. 35, no. 1, 2011, pages 12 - 13 |
| MEYERS ET AL., SCIENCE, vol. 232, 1986, pages 613 |
| MILLER ET AL.: "A Short Course in Bacterial Genetics", 1992, CSHL PRESS |
| NAGASHIMA ET AL., J. BIOL. CHEM., vol. 268, 1993, pages 2888 - 2892 |
| NARANG, S A, TETRAHEDRON, vol. 39, 1983, pages 3 |
| OH ET AL., GENES DEV., vol. 16, 2002, pages 2749 - 54 |
| OKEN ET AL.: "Toxicity and response criteria of the Eastern Cooperative Oncology Group", AM. J. CLIN. ONCOL., vol. 5, no. 6, 1982, pages 649 - 55, XP055910491 |
| PASSAMONTI F ET AL., BLOOD., vol. 115, no. 9, 2010, pages 1703 - 1708 |
| PLATZBECKER U ET AL., LANCET ONCOL., vol. 18, no. 10, 2017, pages 1338 - 1347 |
| R. N. V. S. SURAGANI ET AL.: "Modified activin receptor IIB ligand trap mitigates ineffective erythropoiesis and disease complications in murine beta-thalassemia", BLOOD, vol. 123, 2 May 2014 (2014-05-02), pages 3864 - 3872, XP055423087, DOI: 10.1182/blood-2013-06-511238 |
| ROBERTS ET AL., PNAS USA, vol. 89, 1992, pages 2429 - 2433 |
| RUF ET AL., BIOCHEMISTR, vol. 33, 1994, pages 1565 - 1572 |
| SAMBROOKFRITSCHMANIATIS: "Molecular Cloning A Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| SOCHACKI ET AL.: "Therapeutic approaches in myelofibrosis and myelodysplastic/myeloproliferative overlap syndromes", ONCO TARGETS THER, vol. 9, 2016, pages 2273 - 286 |
| SURAGANI RN ET AL., NAT MED., vol. 20, no. 4, 2014, pages 408 - 414 |
| THOTAKURA ET AL., METH. ENZYMOL., vol. 138, 1987, pages 350 |
| WANG ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 3095 - 3099 |
| YAMASHITA ET AL., J. CELL BIOL., vol. 130, 1995, pages 217 - 226 |
| YEOWHITMAN, MOL. CELL, vol. 7, 2001, pages 949 - 957 |
Cited By (18)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| US10548976B2 (en) | 2015-05-20 | 2020-02-04 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type II receptor ligand traps |
| EP3490582A4 (en) * | 2016-07-27 | 2020-04-01 | Acceleron Pharma Inc. | METHOD AND COMPOSITIONS FOR TREATING MYELOFIBROSE |
| US12194076B2 (en) | 2016-07-27 | 2025-01-14 | Acceleron Pharma Inc. | Methods and compositions for treating myelofibrosis |
| US12350313B2 (en) | 2016-11-10 | 2025-07-08 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| US12582700B2 (en) | 2016-11-10 | 2026-03-24 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12269858B2 (en) | 2018-01-12 | 2025-04-08 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12522646B2 (en) | 2020-03-20 | 2026-01-13 | Keros Therapeutics, Inc. | Activin receptor type II chimeras and methods of use thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
| EP4135736A4 (en) * | 2020-04-13 | 2024-06-26 | Celgene Corporation | METHODS OF TREATING ANEMIA USING ACTRIIB LIGAND TRAP AND FEDRATINIB |
| EP4149441A4 (en) * | 2020-05-15 | 2024-03-13 | Celgene Corporation | METHODS AND COMPOSITIONS FOR TREATING ANEMIA WITH ACTRIIB LIGAND TRAP AND MTOR INHIBITORS |
| JP2023526590A (ja) * | 2020-05-15 | 2023-06-22 | セルジーン コーポレーション | ActRIIBリガンドトラップ及びmTOR阻害剤を使用して貧血を治療するための方法及び組成物 |
| EP4649961A3 (en) * | 2020-05-15 | 2026-02-25 | Celgene Corporation | Methods and compositions for treating anemia using actriib ligand traps and mtor inhibitors |
| US12186370B1 (en) | 2020-11-05 | 2025-01-07 | Celgene Corporation | ACTRIIB ligand trap compositions and uses thereof |
| WO2023023345A3 (en) * | 2021-08-19 | 2023-05-11 | Keros Therapeutics, Inc. | Methods of using activin receptor type ii signaling inhibitors |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2020524139A (ja) | 2020-08-13 |
| JP2024075579A (ja) | 2024-06-04 |
| RS66093B1 (sr) | 2024-11-29 |
| EP3638243B1 (en) | 2024-08-07 |
| EP3638243A1 (en) | 2020-04-22 |
| JP7496686B2 (ja) | 2024-06-07 |
| ES2991738T3 (es) | 2024-12-04 |
| EP4454707A3 (en) | 2024-12-25 |
| US20200101134A1 (en) | 2020-04-02 |
| SMT202400437T1 (it) | 2024-11-15 |
| PT3638243T (pt) | 2024-10-31 |
| HUE068733T2 (hu) | 2025-01-28 |
| EP4454707A2 (en) | 2024-10-30 |
| LT3638243T (lt) | 2024-11-11 |
| HRP20241477T1 (hr) | 2025-01-03 |
| SI3638243T1 (sl) | 2025-03-31 |
| PL3638243T3 (pl) | 2025-02-10 |
| DK3638243T3 (da) | 2024-10-28 |
| WO2018231905A8 (en) | 2020-01-30 |
| CN111050770A (zh) | 2020-04-21 |
| EP3638243A4 (en) | 2021-03-17 |
| FI3638243T3 (fi) | 2024-10-29 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| EP3638243B1 (en) | Methods for treating myeloproliferative neoplasm-associated myelofibrosis and anemia | |
| AU2015358469B2 (en) | Activin-ActRII antagonists and uses for treating anemia | |
| US20210355191A1 (en) | Activin-actrii antagonists and uses for increasing red blood cell levels | |
| JP6976859B2 (ja) | ActRIIリガンドトラップを用いたβ−サラセミアの治療 | |
| EP2303917B1 (en) | Antagonists of actriib and uses for increasing red blood cell levels | |
| EP3415161A1 (en) | The use of an actriib antagonist for the treatment of anemia | |
| US20230142386A1 (en) | Activin-actrii antagonists and uses for treating anemia | |
| HK1245397B (en) | Activin-actrii antagonists and uses for treating myelodysplastic syndrome | |
| HK1226958A1 (en) | Activin-actrii antagonists and uses for increasing red blood cell levels | |
| HK1224923A1 (en) | Activin-actrii antagonists and uses for increasing red blood cell levels | |
| HK1156057A (en) | Antagonists of actriib and uses for increasing red blood cell levels | |
| HK1156057B (en) | Antagonists of actriib and uses for increasing red blood cell levels |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18816685 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2019569312 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018816685 Country of ref document: EP Effective date: 20200114 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: P-2024/1154 Country of ref document: RS |
|
| WWG | Wipo information: grant in national office |
Ref document number: P-2024/1154 Country of ref document: RS |