WO2018183821A1 - Alt-803 in combination with anti-cd38 antibody for cancer therapies - Google Patents

Alt-803 in combination with anti-cd38 antibody for cancer therapies Download PDF

Info

Publication number
WO2018183821A1
WO2018183821A1 PCT/US2018/025366 US2018025366W WO2018183821A1 WO 2018183821 A1 WO2018183821 A1 WO 2018183821A1 US 2018025366 W US2018025366 W US 2018025366W WO 2018183821 A1 WO2018183821 A1 WO 2018183821A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
cells
complex
alt
molecule
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2018/025366
Other languages
English (en)
French (fr)
Inventor
Niraj SHRESTHA
Bai LIU
Peter Rhode
Hing C. Wong
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Altor Bioscience LLC
Original Assignee
Altor Bioscience LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=63678335&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2018183821(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by Altor Bioscience LLC filed Critical Altor Bioscience LLC
Priority to CA3058427A priority Critical patent/CA3058427C/en
Priority to KR1020197032255A priority patent/KR102748188B1/ko
Priority to AU2018243550A priority patent/AU2018243550B2/en
Priority to CN201880022531.7A priority patent/CN110494449B/zh
Priority to EP18776459.2A priority patent/EP3601363B1/en
Priority to JP2019553224A priority patent/JP2020512361A/ja
Publication of WO2018183821A1 publication Critical patent/WO2018183821A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2086IL-13 to IL-16
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/715Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons
    • C07K14/7155Receptors; Cell surface antigens; Cell surface determinants for cytokines; for lymphokines; for interferons for interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2300/00Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • This invention relates generally to the field of therapies for treatment of cancer and autoimmune and inflammatory diseases.
  • the invention is based, at least in part, on the surprising discovery that an anti-CD38 antibody in combination with ALT-803, a complex of an interleukin-15 (IL-15) superagonist mutant and a dimeric IL-15 receptor a/Fc fusion protein, is useful for enhancing an immune response against a neoplasia (e.g., hematological cancer, B-cell neoplasm, multiple myeloma (MM), chronic lymphocytic leukemia (CLL), B and T acute lymphocytic leukemia, acute myeloid leukemia, chronic myeloid leukemia, hairy cell leukemia, Waldenstrom's macroglobulinemia, primary systemic amyloidosis, mantle cell lymphoma, NK cell leukemia, NK or T-cell lymphoma, plasma cell leukemia, B-cell lymphoma, non-Hodgkin's lymphoma, Burkitt's lymphoma, Hodgkin's
  • Methods for treating a neoplasia or an autoimmune or inflammatory disease in a subj ect are carried out by administering to the subject an effective amount of an anti-CD38 antibody (or antibody-like molecule) and an effective amount of a pharmaceutical composition comprising an IL-15N72D:IL-15RaSu/Fc complex (ALT-803), wherein the ALT-803 comprises a dimeric IL-15RaSu/Fc and two IL-15N72D molecules.
  • the IL-15N72D molecule comprises SEQ ID NO: 3.
  • An exemplary IL-15RaSu/Fc comprises SEQ ID NO: 6.
  • the subject is preferably a mammal in need of such treatment, e.g., a subj ect that has been diagnosed with a neoplasia or autoimmune or inflammatory disease or a predisposition thereto.
  • the mammal is any mammal, e.g., a human, a primate, a mouse, a rat, a dog, a cat, a horse, as well as livestock or animals grown for food consumption, e.g., cattle, sheep, pigs, chickens, and goats.
  • the mammal is a human.
  • Suitable neoplasias for treatment with the methods described herein include hematological cancer, B-cell neoplasm, multiple myeloma (MM), chronic lymphocytic leukemia (CLL), B and T acute lymphocytic leukemia, acute myeloid leukemia, chronic myeloid leukemia, hairy cell leukemia, Waldenstrom's macroglobulinemia, primary systemic amyloidosis, mantle cell lymphoma, , NK cell leukemia, NK or T-cell lymphoma, plasma cell leukemia, B-cell lymphoma, non-Hodgkin's lymphoma, Burkitt's lymphoma, Hodgkin's lymphoma, and solid tumors.
  • An exemplary autoimmune/inflammatory diseases for treatment using the methods described herein include systemic lupus erythematosus (SLE), vasculitis, autoimmune cytopenias, rheumatoid arthritis, inflammatory bowel disease, ulcerative colitis, graft-versus-host disease, severe allergic reactions and asthma (van de Donk, et al. 2016. Immunol Rev. 270: 95-112).
  • SLE systemic lupus erythematosus
  • vasculitis autoimmune cytopenias
  • rheumatoid arthritis inflammatory bowel disease
  • ulcerative colitis graft-versus-host disease
  • severe allergic reactions and asthma van de Donk, et al. 2016. Immunol Rev. 270: 95-112).
  • compositions described herein also prevents future recurrence of neoplasia or autoimmune/inflammatory disease after treatment of the disease.
  • the therapeutic approaches described herein could also be combined with other agents that have been shown to be effective at treating MM including but not limited to dexamethasone, bortezomib, lenalidomide, thalidomide, bortezomib/doxil, carfilzomib, pomalidomide, panobinostat, elotuzumab, ixazomib, and glycosylated melphalan.
  • the treatment approach of the invention could also be combined with any of the following therapies: radiation, chemotherapy, surgery, therapeutic antibodies, immunomodulatory agents, proteasome inhibitors, pan-DAC inhibitors, H-DAC inhibitors, checkpoint inhibitors, adoptive cell therapies include CAR T and NK cell therapy and vaccines. Additionally, these therapies could be used in treatment naive patients or those who have relapsed or refractory disease. Additionally, pre- and post-medication strategies with steroids (i.e., corticosteroids, antipyretics and antihistamine) are typically be used in conjunction with ALT-803 plus anti- CD38 Ab therapy. Administration of anti-CD38 Ab often result in significant infusion reactions that may delay or terminate treatment and cause pain and discomfort to the patient. Steroids are used to reduce these effects but also may suppress immune responses necessary for therapeutic benefit. Surprisingly, ALT-803 plus anti-CD38 Ab therapy was found to be equally effective in animal tumor models in presence and absence of pre-treatment with steroids.
  • steroids i.e., corticosteroids
  • Exemplary effective doses of ALT-803 include between 0.1 ⁇ g/kg and 100 mg/kg body weight, e.g., 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, 500, 600, 700, 800, or 900 ⁇ g/kg body weight or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100 mg/kg body weight.
  • the ALT-803 is administered daily, e.g., every 24 hours.
  • the ALT- 803 is administered continuously or several times per day, e.g., every 1 hour, every 2 hours, every 3 hours, every 4 hours, every 5 hours, every 6 hours, every 7 hours, every 8 hours, every 9 hours, every 10 hours, every 11 hours, or every 12 hours.
  • Exemplary effective daily doses of ALT-803 include between 0.1 ⁇ g/kg and 100 ⁇ g/kg body weight, e.g., 0.1, 0.3, 0.5, 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 99 ⁇ g/kg body weight.
  • the ALT-803 is administered about once per week, e.g., about once every 7 days.
  • the ALT-803 is administered twice per week, three times per week, four times per week, five times per week, six times per week, or seven times per week.
  • Exemplary effective weekly doses of ALT-803 include between 0.0001 mg/kg and 4 mg/kg body weight, e.g., 0.001, 0.003, 0.005, 0.01. 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 2, 3, or 4 mg/kg body weight.
  • an effective weekly dose of ALT-803 is between 0.1 ⁇ g/kg body weight and 400 ⁇ g/kg body weight.
  • ALT-803 is administered at a fixed dose or based on body surface area (i.e., per m 2 ).
  • compositions described herein are administered systemically, intravenously, subcutaneously, intramuscularly, intraperitoneally, intravesically, or by instillation.
  • the antibody and ALT-803 may be administered simultaneously or sequentially.
  • the antibody (Ab) of the invention specifically binds to one or more epitopes on the CD38 protein (cyclic ADP ribose hydrolase).
  • Preferred antibodies are composed of heavy and light chain immunoglobulin (Ig) proteins, which may include rodent, human, chimeric and humanized forms.
  • Ig immunoglobulin
  • the method described herein could utilize antibody-like molecules, such as molecules comprising an antigen binding domain (e.g., single chain antibody, Fab, Fv, T-cell receptor binding domain, ligand binding domain or receptor binding domain). In some cases, these domains are preferably linked to an Fc domain.
  • the Ig may be of any of the known isotypes (e.g., IgA, IgD, IgE, IgG, IgGl, IgG2, IgG3, IgG4, IgG2a, IgG2b, and IgM).
  • the Ab or antibody -like molecule
  • the Ab contains a heavy chain or Fc domain capable of interacting with Fc receptors to mediate antibody-dependent cell-mediated cytotoxicity (ADCC) and/or antibody dependent cellular phagocytosis (ADCP).
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • ADCP antibody dependent cellular phagocytosis
  • antibodies conjugated to effector molecules may be used.
  • the preferred Ab or antibody-like molecule contains a heavy chain or Fc domain (e.g., IgG4 Fc) that is incapable of effectively mediating ADCC or ADCP.
  • the anti- CD38 antibodies include but are not limited to daratumumab (DARZALEX®), isatuximab (SAR650984), MOR202, Ab79, AB19, and MT-4019.
  • ALT-803 in vitro or in vivo increases cytotoxicity of immune cells against diseased or disease-associated cells.
  • ALT-803 is capable of stimulating immune cells to augment ADCC or ADCP activity against tumor or autoimmune disease-associated cells mediated by a CD38-specific antibody (or antibody-like molecule).
  • treatment of immune cells with ALT-803 increases ADCC or ADCP activity against diseased of disease-associated cells mediated by an anti-CD38 antibody by at least 5%, e.g., at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100%.
  • immune cells are treated with ALT-803 and used to kill tumor cells via ADCC or ADCP mediated by an anti-CD38 antibody, wherein the level of tumor cell death is at least 5% greater, e.g., at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% greater than that seen with immune cells that were not treated with ALT-803.
  • the level of tumor cell death is at least 5% greater, e.g., at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or
  • tumor-specific ADCC or ADCP in the subject is augmented by at least 5%, e.g., at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% following the ALT-803 and antibody administration.
  • NK cell-based ADCC activity is augmented by ALT-803 treatment.
  • ALT-803 stimulates CD4 + and CD8 + T cells to kill diseased or disease- associated cells, e.g., tumor cells or infected cells.
  • ALT-803 treatment stimulates immune cell cytolytic activity and anti-CD38 antibodies target disease cells, such that in combination these treatments provide highly effective and/or durable activity against the tumor or autoimmune-associated immune cells.
  • ALT-803 increases serum levels of interferon gamma (IFN- ⁇ ) and/or IL-6, stimulates NK and T cell proliferation and upregulated NK and T cell expression of activation markers including CD25, CD69, perforin and granzyme. Induction of these markers may enhance the responsiveness or cytolytic activity of the immune cells against diseased cells.
  • the methods described herein stimulate NK cells to kill tumor or autoimmune-associated immune cells.
  • ALT-803 directly or indirectly induces the activity and/or level of other innate immune cells including neutrophils or monocytic cells.
  • innate immune cells including neutrophils or monocytic cells.
  • Such cells are known to mediate ADCC and ADCP of therapeutic antibodies against diseased cells, e.g., tumor cells (Golay, et al. Blood. 2013 122:3482-91, Richards, et al, Mol Cancer Ther 2008 7:2517- 27).
  • combination therapy of ALT-803 and anti-CD38 antibodies provides improve clinical responses in patients with cancer or autoimmune/inflammatory disease through a mechanism that is mediated, at least in part, by innate immune cells.
  • the methods described herein stimulate neutrophils or monocytic cells to kill tumor or autoimmune/inflammatory-associated immune cells.
  • ALT-803 is capable of stimulating NK cells which produce cytokine or other agent that activate macrophage responses, including ADCP, thereby provide more effective tumor cell killing mediated by the anti-CD38 Ab.
  • the methods described herein result in a reduced/decreased number of tumor or autoimmune/inflammatory -associated immune cells compared to the number of tumor or autoimmune/inflammatory -associated immune cells prior to administration of the compositions herein.
  • the methods described herein result in a decreased disease progression of the neoplasia or autoimmune/inflammatory disease.
  • the methods described herein result in prolonged survival of a subject compared to untreated subjects.
  • kits for the treatment of a neoplasia comprising an effective amount of ALT-803, an antibody, and directions for the use of the kit for the treatment of a neoplasia.
  • ALT-803 comprises an effective amount of ALT-803, an antibody, and directions for the
  • kit for the treatment of an autoimmune or inflammatory disease.
  • the IL-15 polypeptide is an IL-15 variant having a different amino acid sequence than native IL-15 polypeptide.
  • the human IL-15 polypeptide is referred to herein as huIL-15, hIL-15, huIL15, hIL15, IL-15 wild type (wt), and variants thereof are referred to using the native amino acid, its position in the mature sequence and the variant amino acid.
  • huIL15N72D refers to human IL-15 comprising a substitution of N to D at position 72.
  • the IL-15 variant functions as an IL-15 agonist as demonstrated, e.g., by increased binding activity for the IL-15R yC receptors compared to the native IL-15 polypeptide.
  • the IL-15 variant functions as an IL-15 antagonist as demonstrated by e.g., decreased binding activity for the IL-15R
  • Methods for killing a target cell are carried out by contacting a plurality of cells with an antibody and ALT-803, wherein the plurality of cells further include immune cells bearing the IL-15R chains recognized by the IL-15 domain, or immune cells bearing Fc receptor chains recognized by the Fc domain, and the target cells bearing CD38 antigen recognized by an anti-CD38 antibody, and killing the target cells.
  • the target cells are tumor cells or immune cells associated with autoimmune or inflammatory disease.
  • a method for killing diseased cells expressing CD38 antigen is carried out by treating immune cells with an effective amount of an IL-15N72D:IL-15RaSu/Fc complex (ALT-803), mixing the ALT-803-treated immune cells with an anti-CD38 antibody and diseased cells expressing CD38 antigen, and killing the diseased cells via ADCC or ADCP mediated by the ALT-803-treated immune cells and CD38-specific antibody.
  • the ALT-803-treated immune cells i.e., NK cells
  • the level of diseased cell killing is increased by at least 5%, e.g., at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% compared to that mediated by immune cells that were not treated with ALT-803.
  • the invention also provides methods for preventing or treating disease in a patient in which the diseased cells express a CD38 antigen, the method including the steps of:
  • combination therapy with ALT-803 and an anti-CD38 antibody can decrease disease progression and/or prolong patient survival.
  • the invention provides methods of stimulating immune responses in a mammal by administering to the mammal an effective amount of an anti-CD38 antibody and an effective amount of ALT-803.
  • methods for treating a neoplasia or an autoimmune or inflammatory disease in a subject are carried out by administering to the subject an effective amount of an anti-CD38 antibody (or antibody-like molecule) and an effective amount of a pharmaceutical composition comprising an IL-15N72D:IL-15RaSu/Fc complex (ALT-803), wherein the ALT-803 comprises a dimeric IL-15RaSu/Fc and two IL-15N72D molecules, thereby treating the neoplasia or autoimmune or inflammatory disease.
  • an anti-CD38 antibody or antibody-like molecule
  • a pharmaceutical composition comprising an IL-15N72D:IL-15RaSu/Fc complex (ALT-803), wherein the ALT-803 comprises a dimeric IL-15RaSu/Fc and two IL-15N72D molecules
  • the method further comprises treatment with a steroid before, during or after administration of said antibody or said ALT-803, wherein the steroid is selected from the group comprising corticosteroids, antipyretics and antihistamines.
  • the IL-15N72D molecule comprises SEQ ID NO: 3.
  • the IL-15RaSu/Fc comprises SEQ ID NO: 6.
  • the neoplasia is selected from the group consisting of a hematological cancer, B-cell neoplasm, multiple myeloma (MM), chronic lymphocytic leukemia (CLL), B and T acute lymphocytic leukemia, acute myeloid leukemia, chronic myeloid leukemia, hairy cell leukemia, Waldenstrom's macroglobulinemia, primary systemic amyloidosis, mantle cell lymphoma, NK cell leukemia, NK/T-cell lymphoma, plasma cell leukemia, B-cell lymphoma, non-Hodgkin's lymphoma, Burkitt's lymphoma, Hodgkin's lymphoma, and solid tumor.
  • MM multiple myeloma
  • CLL chronic lymphocytic leukemia
  • B and T acute lymphocytic leukemia acute myeloid leukemia
  • chronic myeloid leukemia chronic myeloid leukemia
  • the effective amount of the ALT-803 is administered daily or once or twice per week.
  • the effective amount of said ALT-803 is between 0.1 ⁇ g/kg and 100 mg/kg.
  • the pharmaceutical composition is administered systemically, intravenously, subcutaneous, intramuscularly, intraperitoneally, intravesically, or by instillation.
  • Exemplary anti-CD38 antibodies include daratumumab, isatuximab
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • ADCP antibody dependent cellular phagocytosis
  • autoimmune/inflammati on-associated immune cells in the subject is augmented by at least 5% following the administration, e.g., at least 5%, at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, or at least 100%.
  • the antibody and the ALT-803 increases levels of blood NK cell, T cell, neutrophil, macrophage, dendritic cell or monocyte counts or activity.
  • the antibody and the ALT-803 stimulate CD4 + or CD8 + T cells to kill tumor or
  • the antibody and the ALT-803 stimulate NK cells to kill tumor or autoimmune/inflammation-associated immune cells.
  • the antibody and the ALT-803 stimulate neutrophils or monocytic cells to kill tumor or autoimmune/inflammation-associated immune cells.
  • the administration of the antibody and the ALT-803 results in a decrease in the number of tumor or autoimmune/inflammation- associated immune cells.
  • administration of the antibody and the ALT-803 results in a decrease in disease progression of the neoplasia or autoimmune or inflammatory disease.
  • the administration of the antibody and the ALT-803 results in prolonged survival of the subjects compared to untreated subjects.
  • the subject is a human.
  • the antibody and the ALT-803 are administered simultaneously. In another aspect, the antibody and the ALT-803 are administered sequentially. Preferably, the administration prevents future recurrence of the neoplasia or autoimmune or inflammatory disease.
  • kits for the treatment of a neoplasia comprising an effective amount of ALT-803, an anti-CD38 antibody, and directions for the use of the kit for the treatment of a neoplasia.
  • kit for the treatment of an autoimmune or inflammatory disease the kit comprising an effective amount of ALT-803, an anti-CD38 antibody, and directions for the use of the kit for the treatment of an autoimmune or inflammatory disease.
  • Methods for killing diseased cells or disease-associated cells expressing CD38 antigen are carried out by treating immune cells with an effective amount of an IL-15N72D:IL- 15RaSu/Fc complex (ALT-803), mixing the ALT-803-treated immune cells with an anti- CD38 antibody and diseased cells or disease-associated cells expressing CD38 antigen, and killing the diseased cells or disease-associated cells.
  • the level of diseased cell killing is increased by at least 5% compared to that mediated by immune cells that were not treated with ALT-803, e.g., 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100%.
  • ALT-803-treated immune cells directly kill the diseased cells or disease-associated cells.
  • ALT-803-treated immune cells stimulated other immune cells to kill the diseased cells or disease-associated cells.
  • killing of the diseased cells or disease-associated cells is mediated by ADCC or ADCP via the ALT-803- treated immune cells and the anti-CD38 antibody.
  • Exemplary disease-associated cells include tumor cells.
  • the disease-associated cells are associated with an autoimmune or inflammatory disease.
  • agent is meant a peptide, nucleic acid molecule, or small compound.
  • An exemplary therapeutic agent is ALT-803.
  • ALT-803 is meant a complex comprising IL-15N72D noncovalently associated with a dimeric IL-15RaSu/Fc fusion protein and having immune stimulating activity.
  • the IL-15N72D and/or IL-15RaSu/Fc fusion protein comprises one, two, three, four or more amino acid variations relative to a reference sequence.
  • An exemplary IL- 15N72D amino acid sequence is provided below.
  • ameliorate decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease.
  • an analog is meant a molecule that is not identical, but has analogous functional or structural features.
  • a polypeptide analog retains the biological activity of a corresponding naturally-occurring polypeptide, while having certain biochemical modifications that enhance the analog's function relative to a naturally occurring polypeptide. Such biochemical modifications could increase the analog's protease resistance, membrane permeability, or half-life, without altering, for example, ligand binding.
  • An analog may include an unnatural amino acid.
  • the invention includes antibodies or fragments of such antibodies, so long as they exhibit the desired biological activity. Also included in the invention are chimeric antibodies, such as humanized antibodies. Generally, a humanized antibody has one or more amino acid residues introduced into it from a source that is non-human. Humanization can be performed, for example, using methods described in the art, by substituting at least a portion of a rodent complementarity-determining region for the corresponding regions of a human antibody.
  • antibody as used herein includes monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g. , bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity.
  • immunoglobulin Ig is used interchangeably with “antibody” herein.
  • antibody -like molecule a molecule with a similar structure and/or a similar function as compared to that of an antibody.
  • exemplary antibody-like molecules include molecules comprising an antigen binding domain (e.g., single chain antibody, Fab, Fv, T-cell receptor binding domain, ligand binding domain or receptor binding domain).
  • an “isolated antibody” is one that has been separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
  • the antibody is purified: (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight; (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator; or (3) to homogeneity by SDS-PAGE under reducing or non-reducing conditions using Coomassie blue or, preferably, silver stain.
  • Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
  • the basic four-chain antibody unit is a heterotetrameric glycoprotein composed of two identical light (L) chains and two identical heavy (H) chains.
  • An IgM antibody consists of 5 of the basic heterotetramer unit along with an additional polypeptide called J chain, and therefore contains 10 antigen binding sites, while secreted IgA antibodies can polymerize to form polyvalent assemblages comprising 2-5 of the basic 4-chain units along with J chain.
  • the 4-chain unit is generally about 150,000 daltons.
  • Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype.
  • Each H and L chain also has regularly spaced intrachain disulfide bridges.
  • Each H chain has at the N-terminus, a variable domain (VH) followed by three constant domains (CH) for each of the a and ⁇ chains and four CH domains for ⁇ and ⁇ isotypes.
  • Each L chain has at the N-terminus, a variable domain (VL) followed by a constant domain (CL) at its other end.
  • the VL is aligned with the VH and the CL is aligned with the first constant domain of the heavy chain (CHI).
  • Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
  • the pairing of a VH and VL together forms a single antigen-binding site.
  • immunoglobulins can be assigned to different classes or isotypes. There are five classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, having heavy chains designated alpha (a), delta ( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ) and mu ( ⁇ ), respectively.
  • the ⁇ and a classes are further divided into subclasses on the basis of relatively minor differences in CH sequence and function, e.g., humans express the following subclasses: IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2.
  • variable refers to the fact that certain segments of the V domains differ extensively in sequence among antibodies.
  • the V domain mediates antigen binding and defines specificity of a particular antibody for its particular antigen.
  • variability is not evenly distributed across the 110-amino acid span of the variable domains.
  • the V regions consist of relatively invariant stretches called framework regions (FRs) of 15-30 amino acids separated by shorter regions of extreme variability called “hypervariable regions” that are each 9-12 amino acids long.
  • FRs framework regions
  • hypervariable regions that are each 9-12 amino acids long.
  • the variable domains of native heavy and light chains each comprise four FRs, largely adopting a ⁇ -sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
  • the hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al. , Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
  • the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
  • hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen binding.
  • the hypervariable region generally comprises amino acid residues from a "complementarity determining region" or "CDR" (e.g. , around about residues 24-34 (LI), 50-56 (L2) and 89-97 (L3) in the VL, and around about 31- 35 (HI), 50-65 (H2) and 95-102 (H3) in the VH when numbered in accordance with the Kabat numbering system; Kabat et al , Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md.
  • CDR complementarity determining region
  • residues from a "hypervariable loop” e.g. , residues 24-34 (LI), 50-56 (L2) and 89-97 (L3) in the V L , and 26-32 (HI), 52-56 (H2) and 95-101 (H3) in the V H when numbered in accordance with the Chothia numbering system; Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)); and/or those residues from a "hypervariable loop'VCDR (e.g.
  • the antibody has symmetrical insertions at one or more of the following points 28, 36 (LI), 63, 74-75 (L2) and 123 (L3) in the VL, and 28, 36 (HI), 63, 74-75 (H2) and 123 (H3) in the V H when numbered in accordance with AHo; Honneger, A. and Plunkthun, A. J. Mol. Biol. 309:657-670 (2001)).
  • the term "monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. , the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations that include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. The modifier "monoclonal" is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies useful in the present invention may be prepared by the hybridoma methodology first described by Kohler et al, Nature, 256:495 (1975), or may be made using recombinant DNA methods in bacterial, eukaryotic animal or plant cells (see, e.g., U.S. Pat. No.
  • the "monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et a/. , Nature, 352:624-628 (1991) and Marks et al , J. Mol. Biol., 222:581-597 (1991), for example.
  • Monoclonal antibodies include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (see U.S. Pat. No. 4,816,567; and Morrison et al , Proc. Natl. Acad. Sci. USA, 81 :6851-6855 (1984)). Also provided are variable domain antigen-binding sequences derived from human antibodies.
  • chimeric antibodies of primary interest herein include antibodies having one or more human antigen binding sequences (e.g. , CDRs) and containing one or more sequences derived from a non-human antibody, e.g. , an FR or C region sequence.
  • chimeric antibodies of primary interest herein include those comprising a human variable domain antigen binding sequence of one antibody class or subclass and another sequence, e.g., FR or C region sequence, derived from another antibody class or subclass.
  • Chimeric antibodies of interest herein also include those containing variable domain antigen- binding sequences related to those described herein or derived from a different species, such as a non-human primate (e.g. , Old World Monkey, Ape, etc.).
  • Chimeric antibodies also include primatized and humanized antibodies.
  • chimeric antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. For further details, see Jones et al , Nature 321 :522-525 (1986);
  • a “humanized antibody” is generally considered to be a human antibody that has one or more amino acid residues introduced into it from a source that is non-human. These non- human amino acid residues are often referred to as "import” residues, which are typically taken from an "import” variable domain. Humanization is traditionally performed following the method of Winter and co-workers (Jones et al. , Nature, 321 :522-525 (1986); Reichmann et al , Nature, 332:323-327 (1988); Verhoeyen et al, Science, 239: 1534-1536 (1988)), by substituting import hypervariable region sequences for the corresponding sequences of a human antibody. Accordingly, such "humanized” antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
  • human antibody is an antibody containing only sequences present in an antibody naturally produced by a human. However, as used herein, human antibodies may comprise residues or modifications not found in a naturally occurring human antibody, including those modifications and variant sequences described herein. These are typically made to further refine or enhance antibody performance.
  • an “intact” antibody is one that comprises an antigen-binding site as well as a CL and at least heavy chain constant domains, CH 1, CH 2 and CH 3.
  • the constant domains may be native sequence constant domains (e.g. , human native sequence constant domains) or amino acid sequence variant thereof.
  • the intact antibody has one or more effector functions.
  • antibody fragment comprises a portion of an intact antibody, preferably the antigen binding or variable region of the intact antibody.
  • antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (see U.S. Pat. No.
  • a functional fragment or analog of an antibody is a compound having qualitative biological activity in common with a full-length antibody.
  • a functional fragment or analog of an anti-IgE antibody is one that can bind to an IgE immunoglobulin in such a manner so as to prevent or substantially reduce the ability of such molecule from having the ability to bind to the high affinity receptor, Fc e RI.
  • Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, and a residual "Fc” fragment, a designation reflecting the ability to crystallize readily.
  • the Fab fragment consists of an entire L chain along with the variable region domain of the H chain (VH), and the first constant domain of one heavy chain (CH 1).
  • VH variable region domain of the H chain
  • CH first constant domain of one heavy chain
  • Each Fab fragment is monovalent with respect to antigen binding, i.e. , it has a single antigen- binding site.
  • Pepsin treatment of an antibody yields a single large F(ab')2 fragment that roughly corresponds to two disulfide linked Fab fragments having divalent antigen-binding activity and is still capable of cross-linking antigen.
  • Fab' fragments differ from Fab fragments by having additional few residues at the carboxy terminus of the CHT domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
  • F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments that have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • the "Fc” fragment comprises the carboxy -terminal portions of both H chains held together by disulfides.
  • the effector functions of antibodies are determined by sequences in the Fc region, which region is also the part recognized by Fc receptors (FcR) found on certain types of cells.
  • Fv is the minimum antibody fragment that contains a complete antigen-recognition and -binding site. This fragment consists of a dimer of one heavy- and one light-chain variable region domain in tight, non-covalent association. From the folding of these two domains emanate six hypervariable loops (three loops each from the H and L chain) that contribute the amino acid residues for antigen binding and confer antigen binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three CDRs specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
  • Single-chain Fv also abbreviated as “sFv” or “scFv” are antibody fragments that comprise the VH and VL antibody domains connected into a single polypeptide chain.
  • the sFv polypeptide further comprises a polypeptide linker between the VH and VL domains that enables the sFv to form the desired structure for antigen binding.
  • a polypeptide linker between the VH and VL domains that enables the sFv to form the desired structure for antigen binding.
  • diabodies refers to small antibody fragments prepared by constructing sFv fragments (see preceding paragraph) with short linkers (about 5-10 residues) between the VH and VL domains such that inter-chain but not intra-chain pairing of the V domains is achieved, resulting in a bivalent fragment, i.e., fragment having two antigen-binding sites.
  • Bispecific diabodies are heterodimers of two "crossover" sFv fragments in which the VH and VL domains of the two antibodies are present on different polypeptide chains.
  • Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al , Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
  • an antibody that "internalizes" is one that is taken up by (i.e. , enters) the cell upon binding to an antigen on a mammalian cell (e.g. , a cell surface polypeptide or receptor).
  • the internalizing antibody will of course include antibody fragments, human or chimeric antibody, and antibody conjugates. For certain therapeutic applications, internalization in vivo is contemplated. The number of antibody molecules internalized will be sufficient or adequate to kill a cell or inhibit its growth, especially an infected cell.
  • the uptake of a single antibody molecule into the cell is sufficient to kill the target cell to which the antibody binds.
  • certain toxins are highly potent in killing such that internalization of one molecule of the toxin conjugated to the antibody is sufficient to kill the infected cell.
  • an antibody is said to be “immunospecific,” “specific for” or to “specifically bind” an antigen if it reacts at a detectable level with the antigen, preferably with an affinity constant, K A of greater than or equal to about 10 ⁇ M ⁇ l, or greater than or equal to about 10 ⁇ M ⁇ l, greater than or equal to about lO ⁇ M ⁇ l, greater than or equal to about lO ⁇ M ⁇ l, or greater than or equal to 10 ⁇ M "1 .
  • HuM2e antibody specifically binds to M2e if it binds with a KD of less than or equal to 10 " 4 M, less than or equal to about 10 " ⁇ M, less than or equal to about 10 " 6 M, less than or equal to
  • Binding properties of an antibody to antigens, cells or tissues thereof may generally be determined and assessed using immunodetection methods including, for example, immunofluorescence-based assays, such as immuno-histochemistry (IHC) and/or
  • FACS fluorescence-activated cell sorting
  • an antibody having a "biological characteristic" of a designated antibody is one that possesses one or more of the biological characteristics of that antibody which distinguish it from other antibodies.
  • an antibody with a biological characteristic of a designated antibody will bind the same epitope as that bound by the designated antibody and/or have a common effector function as the designated antibody.
  • the term "antagonist" antibody is used in the broadest sense, and includes an antibody that partially or fully blocks, inhibits, or neutralizes a biological activity of an epitope, polypeptide, or cell that it specifically binds.
  • Methods for identifying antagonist antibodies may comprise contacting a polypeptide or cell specifically bound by a candidate antagonist antibody with the candidate antagonist antibody and measuring a detectable change in one or more biological activities normally associated with the polypeptide or cell.
  • Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: Clq binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g. , B cell receptor); and B cell activation.
  • binding to a molecule is meant having a physicochemical affinity for that molecule.
  • control or “reference” is meant a standard of comparison.
  • “changed as compared to a control” sample or subject is understood as having a level that is statistically different than a sample from a normal, untreated, or control sample.
  • Control samples include, for example, cells in culture, one or more laboratory test animals, or one or more human subjects. Methods to select and test control samples are within the ability of those in the art.
  • An analyte can be a naturally occurring substance that is characteristically expressed or produced by the cell or organism (e.g., an antibody, a protein) or a substance produced by a reporter construct (e.g, ⁇ -galactosidase or luciferase). Depending on the method used for detection, the amount and measurement of the change can vary.
  • Detect refers to identifying the presence, absence or amount of the analyte to be detected.
  • disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
  • diseases include neoplasias and autoimmune and inflammatory diseases.
  • an effective amount is meant an amount of a compound, alone or in a combination, required to ameliorate the symptoms of a disease relative to an untreated patient.
  • the effective amount of active compound(s) used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen. Such amount is referred to as an "effective" amount.
  • fragment is meant a portion of a polypeptide or nucleic acid molecule.
  • This portion contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide.
  • a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
  • the invention also comprises polypeptides and nucleic acid fragments, so long as they exhibit the desired biological activity of the full length polypeptides and nucleic acid, respectively. A nucleic acid fragment of almost any length is employed.
  • illustrative polynucleotide segments with total lengths of about 10,000, about 5000, about 3000, about 2,000, about 1,000, about 500, about 200, about 100, about 50 base pairs in length (including all intermediate lengths) are included in many implementations of this invention.
  • a polypeptide fragment of almost any length is employed.
  • illustrative polypeptide segments with total lengths of about 10,000, about 5,000, about 3,000, about 2,000, about 1,000, about 5,000, about 1,000, about 500, about 200, about 100, or about 50 amino acids in length (including all intermediate lengths) are included in many implementations of this invention.
  • isolated refers to material that is free to varying degrees from components which normally accompany it as found in its native state.
  • Isolate denotes a degree of separation from original source or surroundings.
  • Purify denotes a degree of separation that is higher than isolation.
  • a “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography. The term “purified” can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
  • substantially pure is meant a nucleotide or polypeptide that has been separated from the components that naturally accompany it.
  • the nucleotides and polypeptides are substantially pure when they are at least 60%, 70%, 80%, 90%, 95%, or even 99%, by weight, free from the proteins and naturally-occurring organic molecules with they are naturally associated.
  • isolated nucleic acid is meant a nucleic acid that is free of the genes which flank it in the naturally-occurring genome of the organism from which the nucleic acid is derived.
  • the term covers, for example: (a) a DNA which is part of a naturally occurring genomic DNA molecule, but is not flanked by both of the nucleic acid sequences that flank that part of the molecule in the genome of the organism in which it naturally occurs; (b) a nucleic acid incorporated into a vector or into the genomic DNA of a prokaryote or eukaryote in a manner, such that the resulting molecule is not identical to any naturally occurring vector or genomic DNA; (c) a separate molecule such as a cDNA, a genomic fragment, a fragment produced by polymerase chain reaction (PCR), or a restriction fragment; and (d) a recombinant nucleotide sequence that is part of a hybrid gene, i.e., a gene encoding a fusion protein
  • Isolated nucleic acid molecules according to the present invention further include molecules produced synthetically, as well as any nucleic acids that have been altered chemically and/or that have modified backbones.
  • the isolated nucleic acid is a purified cDNA or RNA polynucleotide.
  • Isolated nucleic acid molecules also include messenger ribonucleic acid (mRNA) molecules.
  • an “isolated polypeptide” is meant a polypeptide of the invention that has been separated from components that naturally accompany it.
  • the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
  • the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention.
  • An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein. Purity can be measured by any appropriate method, for example, column chromatography, polyacrylamide gel electrophoresis, or by HPLC analysis.
  • marker any protein or polynucleotide having an alteration in expression level or activity that is associated with a disease or disorder.
  • neoplasia a disease or disorder characterized by excess proliferation or reduced apoptosis.
  • Illustrative neoplasms for which the invention can be used include, but are not limited to leukemias (e.g., acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloblastic leukemia, acute promyelocytic leukemia, acute myelomonocytic leukemia, acute monocytic leukemia, acute erythroleukemia, chronic leukemia, chronic myelocytic leukemia, chronic lymphocytic leukemia), polycythemia vera, lymphoma (Hodgkin's disease, non-Hodgkin's disease), Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors such as sarcomas and carcinomas (e.g., fibrosarcoma, myxosarcoma, liposarcoma,
  • the neoplasia is multiple myeloma, beta-cell lymphoma, urothelial/bladder carcinoma or melanoma.
  • "obtaining” as in “obtaining an agent” includes synthesizing, purchasing, or otherwise acquiring the agent.
  • reduces is meant a negative alteration of at least 5%, 10%, 25%, 50%, 75%, or
  • a “reference sequence” is a defined sequence used as a basis for sequence comparison.
  • a reference sequence may be a subset of or the entirety of a specified sequence; for example, a segment of a full-length cDNA or gene sequence, or the complete cDNA or gene sequence.
  • the length of the reference polypeptide sequence will generally be at least about 16 amino acids, preferably at least about 20 amino acids, more preferably at least about 25 amino acids, and even more preferably about 35 amino acids, about 50 amino acids, or about 100 amino acids.
  • the length of the reference nucleic acid sequence will generally be at least about 50 nucleotides, preferably at least about 60 nucleotides, more preferably at least about 75 nucleotides, and even more preferably about 100 nucleotides or about 300 nucleotides or any integer thereabout or therebetween.
  • telomere binding By “specifically binds” is meant a compound or antibody that recognizes and binds a polypeptide of the invention, but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the invention.
  • Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity.
  • Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule.
  • hybridize is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
  • complementary polynucleotide sequences e.g., a gene described herein
  • stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
  • Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
  • Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C.
  • Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
  • concentration of detergent e.g., sodium dodecyl sulfate (SDS)
  • SDS sodium dodecyl sulfate
  • Various levels of stringency are accomplished by combining these various conditions as needed.
  • hybridization will occur at 30° C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS.
  • hybridization will occur at 37° C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 .mu.g/ml denatured salmon sperm DNA (ssDNA).
  • hybridization will occur at 42° C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 ⁇ g/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
  • wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature.
  • stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
  • Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C.
  • wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42 C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68° C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS.
  • Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196: 180, 1977); Grunstein and Hogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
  • substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein).
  • a reference amino acid sequence for example, any one of the amino acid sequences described herein
  • nucleic acid sequence for example, any one of the nucleic acid sequences described herein.
  • such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
  • Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e "3 and e "100 indicating a closely related sequence.
  • sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology
  • subject is meant a mammal, including, but not limited to, a human or non- human mammal, such as a bovine, equine, canine, ovine, or feline.
  • the subject is preferably a mammal in need of such treatment, e.g., a subject that has been diagnosed with B cell lymphoma or a predisposition thereto.
  • the mammal is any mammal, e.g., a human, a primate, a mouse, a rat, a dog, a cat, a horse, as well as livestock or animals grown for food consumption, e.g., cattle, sheep, pigs, chickens, and goats.
  • the mammal is a human.
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, or 50.
  • treating and “treatment” as used herein refer to the administration of an agent or formulation to a clinically symptomatic individual afflicted with an adverse condition, disorder, or disease, so as to effect a reduction in severity and/or frequency of symptoms, eliminate the symptoms and/or their underlying cause, and/or facilitate improvement or remediation of damage. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated.
  • Treatment of patients with neoplasia may include any of the following: Adjuvant therapy (also called adjunct therapy or adjunctive therapy) to destroy residual tumor cells that may be present after the known tumor is removed by the initial therapy (e.g. surgery), thereby preventing possible cancer reoccurrence; neoadjuvant therapy given prior to the surgical procedure to shrink the cancer; induction therapy to cause a remission, typically for acute leukemia; consolidation therapy (also called intensification therapy) given once a remission is achieved to sustain the remission; maintenance therapy given in lower or less frequent doses to assist in prolonging a remission; first line therapy (also called standard therapy); second (or 3rd, 4th, etc.) line therapy (also called salvage therapy) is given if a disease has not responded or reoccurred after first line therapy; and palliative therapy (also called supportive therapy) to address symptom management without expecting to significantly reduce the cancer.
  • Adjuvant therapy also called adjunct therapy or adjunctive therapy
  • induction therapy to cause a remission
  • preventing and prevention refer to the administration of an agent or composition to a clinically asymptomatic individual who is susceptible or predisposed to a particular adverse condition, disorder, or disease, and thus relates to the prevention of the occurrence of symptoms and/or their underlying cause.
  • the term "about” is understood as within a range of normal tolerance in the art, for example within 2 standard deviations of the mean. About can be understood as within 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.5%, 0.1 %, 0.05%, or 0.01 % of the stated value. Unless otherwise clear from context, all numerical values provided herein are modified by the term about.
  • compositions or methods provided herein can be combined with one or more of any of the other compositions and methods provided herein.
  • FIG. 1 is a bar graph demonstrating the effects of ALT-803 on human peripheral blood mononuclear cell (PBMC) antibody-dependent cell-mediated cytotoxicity (ADCC) directed anti-CD38 Ab against hematologic tumor cells.
  • Human PBMC were used as effector cells and CellTrace Violet labeled Daudi cells were targets (E:T ratio 5: 1) with no stimulation (Untreated), ALT-803 (10 nM), anti-CD38 Ab (10 nM) or ALT-803 (10 nM) plus anti-CD38 Ab (10 nM).
  • Daudi cell death positive staining with propidium iodide
  • the bars represent the mean ⁇ SEM for PMBCs from 4 independent donors.
  • FIG. 2A is a bar graph demonstrating the concentration dependent effects of ALT-803 on human PBMC ADCC directed anti-CD38 Ab against hematologic tumor cells. Freshly isolated PBMCs were incubated with different concentrations of ALT-803 with and without 10 nM anti-CD38 Ab. After 2 days, ADCC activity against Daudi tumor target cells (E:T ratio 2: 1) was determined as described in FIG. 1. The bars represent the mean ⁇ SEM for PMBCs from 4 independent donors.
  • FIG. 2B shows line graphs demonstrating the concentration dependent effects of anti-CD38 Ab with or without 10 nM ALT-803 on human PBMC ADCC directed against Daudi cells using the method described in FIG 2A. Results from 2 different donors are shown, FIG.
  • 2C is a bar graph demonstrating the concentration dependent effects of ALT-803 on human natural killer (NK) cell ADCC directed anti-CD38 Ab against hematologic tumor cells.
  • Freshly purified human NK cells (>90% CD56 + CD3 " ) were incubated with different concentrations of ALT-803 with and without 10 nM anti-CD38 Ab.
  • ADCC activity against Daudi tumor target cells (E:T ratio 2: 1) was determined as described in FIG. 1. The bars represent the mean ⁇ SEM for NK cells from 4 independent donors.
  • FIG. 3 is a bar graph showing the efficacy of ALT-803 plus anti-CD38 Ab treatment in reducing tumor burden in the bone marrow of mice bearing Daudi cell tumors.
  • Severe combined immunodeficiency (SCID) mice were injected (i.v.) on day 0 with 1 x 10 7 Daudi cells.
  • Tumor-bearing mice (6 mice in each group) were treated i.v. with PBS (vehicle, i.v.), anti-CD38 Ab (10 mg/kg, i.v.), ALT-803 (0.2 mg/kg, subcutaneously), or anti-CD38 Ab (10 mg/kg) plus ALT-803 (0.2 mg/kg, subcutaneously).
  • Anti-CD38 Ab (Dara) was administered on day 5 post tumor cell inoculation and ALT-803 was administered on day 17 post tumor cell inoculation. Some mice were also treated with steroid (0.2 ⁇ g hydrocortisone /dose i.p.) on day 15 as indicated. Percentage of Daudi cells (human HLA-DR + ) in the bone marrow (BM) at day 22 post-injection was quantified by flow cytometer. *, P ⁇ 0.05; **** P O.0001.
  • FIG. 4 is a line graph demonstrating that the combination of ALT-803 and anti-CD38 Ab is capable of prolonging survival of mice bearing Daudi cell tumors.
  • SCID mice were injected (i.v.) on day 0 with 1 x 10 7 Daudi cells.
  • Tumor-bearing mice (6 mice in each group) were treated i.v. with phosphate-buffered saline (PBS) (vehicle, i.v.), anti-CD38 Ab (10 mg/kg, i.v.), ALT-803 (0.2 mg/kg, subcutaneously), or anti-CD38 Ab (10 mg/kg) plus ALT- 803 (0.2 mg/kg, subcutaneously).
  • PBS phosphate-buffered saline
  • mice received steroid (0.2 mg/mouse, intraperitoneal) to reduce pre-infusion reaction except PBS group mice.
  • Anti-CD38 Ab DARA
  • ALT-803 was administered on day 17 post tumor cell inoculation.
  • the groups received a second treatment of PBS (vehicle, i.v.), anti-CD38 Ab (10 mg/kg, i.v.), ALT-803 (0.2 mg/kg, subcutaneously), or anti- CD38 Ab (10 mg/kg) plus ALT-803 (0.2 mg/kg, subcutaneously).
  • mice were not treated with steroid on day 22. Mouse survival was monitored and Kaplan-Meier analysis is shown. **** P O.0001.
  • FIG. 5 shows a series of flow cytometry plots demonstrating the effects of ALT-803 in combination with anti-CD38 Ab on macrophage-mediated phagocytosis of Daudi tumor cells in vivo.
  • PKH67-labeled human THP-1 macrophage cells and CellTrace Violet-labeled Daudi cells were co-cultured (E:T ratio of 1: 1) with PBS (US), 10 nM anti-CD38 Ab and/or 10 nM ALT-803 in presence or absence of NK-92 cells (aNK cells). After 24 hours, the percentage of phagocytosed Daudi tumor cells (represented by PKH67 + CellTrace Violet + THP-1 cells in upper right quadrant) was measured by flow cytometry.
  • the invention is based, at least in part, on the surprising discovery that an antibody in combination with ALT-803, a complex of an interleukin-15 (IL-15) superagonist mutant and a dimeric IL-15 receptor a Fc fusion protein, is useful for enhancing an immune response against a neoplasia (e.g., a glioblastoma, prostate cancer, hematological cancer, B-cell neoplasms, multiple myeloma, B-cell lymphoma, Hodgkin's lymphoma, acute myeloid leukemia, chronic lymphocytic leukemia, cutaneous T-cell lymphoma, T-cell lymphoma, a solid tumor, urothelial/bladder carcinoma, melanoma, lung cancer, renal cell carcinoma, breast cancer, head and neck cancer, colorectal cancer, and ovarian cancer) or an autoimmune or inflammatory disease.
  • a neoplasia e.g., a
  • ALT-803 comprises an IL-15 mutant with increased ability to bind ⁇ -2 ⁇ ⁇ and enhanced biological activity (U.S. Patent No. 8,507, 222, incorporated herein by reference). This super agonist mutant of IL-15 was described in a publication (J Immunol 2009
  • IL-15 super agonist complex (IL- 15N72D:IL-15RaSu/Fc) is referred to as ALT-803.
  • ALT-803 exhibits impressive anti-tumor activity against aggressive solid and hematological tumor models in immunocompetent mice. It can be administered as a monotherapy using a twice weekly or weekly i.v. dose regimen or as combinatorial therapy with an antibody.
  • the ALT- 803 anti-tumor response is also durable.
  • Tumor-bearing mice that were cured after ALT-803 treatment were also highly resistant to re-challenge with the same tumor cells indicating that ALT-803 induces effective immunological memory responses against the re-introduced tumor cells.
  • Interleukin-15 is an important cytokine for the development, proliferation, and activation of effector NK cells and CD8 + memory T cells.
  • IL-15 binds to the IL-15 receptor a (IL-15Ra) and is presented in trans to the IL-2/IL-15 receptor ⁇ - common ⁇ chain (IL- 15R Y c ) complex on effector cells.
  • IL-15 and IL-2 share binding to the IL-15R Y c , and signal through STAT3 and STAT5 pathways.
  • IL-2 also supports maintenance of CD4 + CD25 + FoxP3 + regulatory T (Treg) cells and induces cell death of activated CD8 + T cells. These effects may limit the therapeutic activity of IL-2 against tumors.
  • IL-15 does not share these immunosuppressive activities with IL-2.
  • IL-15 is the only cytokine known to provide anti-apoptotic signaling to effector CD8 + T cells.
  • IL-15 either
  • an IL-15 mutant (IL-15N72D) with increased biological activity compared to IL-15 was identified (Zhu et al, J Immunol, 183: 3598-3607, 2009).
  • the pharmacokinetics and biological activity of this IL-15 super-agonist (IL-15N72D) was further improved by the creation of IL- 15N72D:IL-15RaSu/Fc fusion complex (ALT-803), such that the super agonist complex has at least 25-times the activity of the native cytokine in vivo (Han et al, Cytokine, 56: 804-810, 2011).
  • an IL-15:IL-15Ra fusion protein complex can refer to a complex having IL-15 non-covalently bound to the soluble IL-15Ra domain of the native IL-15Ra.
  • the soluble IL-15Ra is covalently linked to a biologically active polypeptide and/or to an IgG Fc domain.
  • the IL-15 can be either IL-15 or IL-15 covalently linked to a second biologically active polypeptide.
  • the crystal structure of the IL-15:IL-15Ra protein complex is shown in Chirifu et al, 2007 Nat Immunol 8, 1001-1007, incorporated herein by reference.
  • the IL-15Ra fusion protein comprises soluble IL-15Ra, e.g., IL-15Ra covalently linked to a biologically active polypeptide (e.g., the heavy chain constant domain of IgG, an Fc domain of the heavy chain constant domain of IgG, or a cytokine).
  • IL-15 comprises IL-15, e.g., IL-15 covalently linked to a second biologically active polypeptide, e.g., a cytokine.
  • purifying the IL-15:IL-15Ra fusion protein complex from the host cell or media involves capturing the IL-15:IL-15Ra fusion protein complex on an affinity reagent that specifically binds the IL-15:IL-15Ra fusion protein complex.
  • the IL- 15Ra fusion protein contains an IL-15Ra/Fc fusion protein and the affinity reagent specifically binds the Fc domain.
  • the affinity reagent is Protein A or Protein G.
  • the affinity reagent is an antibody.
  • purifying the IL-15:IL-15Ra fusion protein complex from the host cell or media comprises ion exchange chromatography.
  • purifying the IL-15:IL-15Ra fusion protein complex from the host cell or media comprises size exclusion chromatography.
  • the IL-15Ra comprises IL-15RaSushi (IL-15RaSu).
  • the IL-15 is a variant IL-15 (e.g., IL-15N72D).
  • the IL- 15 binding sites of the IL-15:IL-15Ra fusion protein complex are fully occupied.
  • both IL-15 binding sites of the IL-15:IL-15RaSu/Fc fusion protein complex are fully occupied.
  • the IL-15:IL-15Ra fusion protein complex is purified based on the fusion protein complex charge or size properties.
  • the fully occupied IL-15N72D:IL-15RaSu/Fc fusion protein complex is purified by anion exchange chromatography based on the fusion protein complex charge properties.
  • the fully occupied IL-15N72D:IL-15RaSu/Fc fusion protein complex is purified using a quaternary amine-based resin with binding conditions employing low ionic strength neutral pH buffers and elution conditions employing buffers of increasing ionic strength.
  • the IL-15 polypeptide is an IL-15 variant having a different amino acid sequence than native IL- 15 polypeptide.
  • the human IL-15 polypeptide is referred to herein as huIL-15, hIL-15, huIL15, hIL15, IL-15 wild type (wt) and variants thereof are referred to using the native amino acid, its position in the mature sequence and the variant amino acid.
  • huIL15N72D refers to human IL-15 comprising a substitution of N to D at position 72.
  • the IL-15 variant functions as an IL-15 agonist as demonstrated, e.g., by increased binding activity for the IL-15R yC receptors compared to the native IL-15 polypeptide.
  • the IL-15 variant functions as an IL-15 antagonist as demonstrated by e.g., decreased binding activity for the IL-15R yC receptors compared to the native IL-15 polypeptide.
  • the IL-15 variant has increased binding affinity or a decreased binding activity for the IL-15R yC receptors compared to the native IL-15 polypeptide.
  • the sequence of the IL-15 variant has at least one (i.e., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more) amino acid change compared to the native IL-15 sequence.
  • the amino acid change can include one or more of an amino acid substitution or deletion in the domain of IL-15 that interacts with IL-15R and/or IL-15RyC.
  • the amino acid change is one or more amino acid substitutions or deletions at position 8, 61, 65, 72, 92, 101, 108, or 111 of the mature human IL-15 sequence.
  • the amino acid change is the substitution of D to N or A at position 8, D to A at position 61, N to A at position 65, N to R at position 72 or Q to A at position 108 of the mature human IL-15 sequence, or any combination of these substitutions.
  • the amino acid change is the substitution of N to D at position 72 of the mature human IL-15 sequence.
  • ALT-803 comprises an IL-15N72D:IL-15RaSu/Fc fusion complex.
  • Fusion proteins that combine the Fc regions of IgG with the domains of another protein, such as various cytokines and soluble receptors have been reported (see, for example, Capon et al., Nature, 337:525-531, 1989; Chamow et al., Trends Biotechnol, 14:52-60, 1996); U. S. Pat. Nos. 5,116,964 and 5,541,087).
  • the prototype fusion protein is a homodimeric protein linked through cysteine residues in the hinge region of IgG Fc, resulting in a molecule similar to an IgG molecule without the heavy chain variable and CHI domains and light chains.
  • fusion proteins comprising the Fc domain may be advantageous in providing higher order interactions (i.e. bivalent or bispecific binding) with other molecules. Due to the structural homology, Fc fusion proteins exhibit an in vivo pharmacokinetic profile comparable to that of human IgG with a similar isotype. Immunoglobulins of the IgG class are among the most abundant proteins in human blood, and their circulation half-lives can reach as long as 21 days.
  • fusion protein complexes containing the IL- 15 domain non-covalently bound to IL-15RaSu covalently linked to the Fc portion of the human heavy chain IgG protein have been made (e.g., ALT-803).
  • Fc refers to a non-antigen-binding fragment of an antibody. Such an “Fc” can be in monomelic or multimeric form.
  • the original immunoglobulin source of the native Fc is preferably of human origin and may be any of the immunoglobulins, although IgG 1 and IgG2 are preferred.
  • Native Fc's are made up of monomelic polypeptides that may be linked into dimeric or multimeric forms by covalent (i.e., disulfide bonds) and non-covalent association.
  • the number of intermolecular disulfide bonds between monomelic subunits of native Fc molecules ranges from 1 to 4 depending on class (e.g., IgG, IgA, IgE) or subclass (e.g., IgGl, IgG2, IgG3, IgAl, IgGA2).
  • class e.g., IgG, IgA, IgE
  • subclass e.g., IgGl, IgG2, IgG3, IgAl, IgGA2
  • One example of a native Fc is a disulfide-bonded dimer resulting from papain digestion of an IgG (see Ellison et al. (1982), Nucleic Acids Res. 10: 4071-9).
  • native Fc as used herein is generic to the monomeric, dimeric, and multimeric forms. Fc domains containing binding sites for Protein A, Protein G, various Fc receptors and complement proteins.
  • the term "Fc variant” refers to a molecule or sequence that is modified from a native Fc, but still comprises a binding site for the salvage receptor, FcRn.
  • International applications WO 97/34631 (published Sep. 25, 1997) and WO 96/32478 describe exemplary Fc variants, as well as interaction with the salvage receptor, and are hereby incorporated by reference.
  • the term “Fc variant” comprises a molecule or sequence that is humanized from a non-human native Fc.
  • a native Fc comprises sites that may be removed because they provide structural features or biological activity that are not required for the fusion molecules of the present invention.
  • the term "Fc variant” comprises a molecule or sequence that lacks one or more native Fc sites or residues that affect or are involved in (1) disulfide bond formation, (2) incompatibility with a selected host cell (3) N-terminal heterogeneity upon expression in a selected host cell, (4) glycosylation, (5) interaction with complement, (6) binding to an Fc receptor other than a salvage receptor, (7) antibody-dependent cell-mediated cytotoxicity (ADCC), or (8) antibody dependent cellular phagocytosis (ADCP).
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • ADCP antibody dependent cellular phagocytosis
  • Fc domain encompasses native Fc and Fc variant molecules and sequences as defined above. As with Fc variants and native Fc's, the term “Fc domain” includes molecules in monomeric or multimeric form, whether digested from whole antibody or produced by recombinant gene expression or by other means.
  • the fusion protein complexes of the invention also include a flexible linker sequence interposed between the IL-15 or IL-15Ra domains.
  • the linker sequence should allow effective positioning of the polypeptide with respect to the IL-15 or IL-15Ra domains to allow functional activity of both domains.
  • the soluble fusion protein complex has a linker wherein the first polypeptide is covalently linked to IL-15 (or functional fragment thereof) by a polypeptide linker sequence.
  • the soluble fusion protein complex as described herein has a linker wherein the second polypeptide is covalently linked to IL-15Ra polypeptide (or functional fragment thereof) by polypeptide linker sequence.
  • the linker sequence is preferably encoded by a nucleotide sequence resulting in a peptide that can effectively position the binding groove of a TCR molecule for recognition of a presenting antigen or the binding domain of an antibody molecule for recognition of an antigen.
  • the phrase "effective positioning of the biologically active polypeptide with respect to the IL-15 or IL-15Ra domains", or other similar phrase is intended to mean the biologically active polypeptide linked to the IL-15 or IL-15Ra domains is positioned so that the IL-15 or IL-15Ra domains are capable of interacting with each other to form a protein complex.
  • the IL-15 or IL-15Ra domains are effectively positioned to allow interactions with immune cells to initiate or inhibit an immune reaction, or to inhibit or stimulate cell development.
  • the fusion protein complexes of the invention preferably also include a flexible linker sequence interposed between the IL-15 or IL-15 Roc domains and the immunoglobulin Fc domain.
  • the linker sequence should allow effective positioning of the Fc domain, biologically active polypeptide and IL-15 or IL-15Ra domains to allow functional activity of each domain.
  • the Fc domains are effectively positioned to allow proper fusion protein complex formation and/or interactions with Fc receptors on immune cells or proteins of the complement system to stimulate Fc-mediated effects including opsonization, cell lysis, degranulation of mast cells, basophils, and eosinophils, and other Fc receptor-dependent processes; activation of the complement pathway; and enhanced in vivo half-life of the fusion protein complex.
  • Linker sequences can also be used to link two or more polypeptides of the biologically active polypeptide to generate a single-chain molecule with the desired functional activity.
  • the linker sequence comprises from about 7 to 20 amino acids, more preferably from about 10 to 20 amino acids.
  • the linker sequence is preferably flexible so as not hold the biologically active polypeptide or effector molecule in a single undesired conformation.
  • the linker sequence can be used, e.g., to space the recognition site from the fused molecule.
  • the peptide linker sequence can be positioned between the biologically active polypeptide and the effector molecule, e.g., to chemically cross-link same and to provide molecular flexibility.
  • the linker preferably predominantly comprises amino acids with small side chains, such as glycine, alanine and serine, to provide for flexibility.
  • about 80 or 90 percent or greater of the linker sequence comprises glycine, alanine or serine residues, particularly glycine and serine residues.
  • ALT-803 which is a protein complex between IL-15N72D and IL-15RaSu/Fc.
  • the ALT-803 polypeptides could serve as a scaffold for fusion to other protein domains.
  • a first fusion protein comprises a first biologically active polypeptide covalently linked to interleukin-15 (IL-15) or functional fragment thereof; and the second fusion protein comprises a second biologically active polypeptide covalently linked to soluble interleukin-15 receptor alpha (IL- 15Ra) polypeptide or functional fragment thereof, where the IL-15 domain of a first fusion protein binds to the soluble IL-15Ra domain of the second fusion protein to form a soluble fusion protein complex.
  • IL-15 interleukin-15
  • IL- 15Ra soluble interleukin-15 receptor alpha
  • Fusion protein complexes of the invention also comprise immunoglobulin Fc domain or a functional fragment thereof linked to one or both of the first and second fusion proteins.
  • the Fc domains linked to the first and second fusion proteins interact to form a fusion protein complex.
  • Such a complex may be stabilized by disulfide bond formation between the immunoglobulin Fc domains.
  • the soluble fusion protein complexes of the invention include an IL-15 polypeptide, IL-15 variant or a functional fragment thereof and a soluble IL-15Ra polypeptide or a functional fragment thereof, wherein one or both of the IL-15 and IL-15Ra polypeptides further include an immunoglobulin Fc domain or a functional fragment thereof.
  • one or both of the first and second biologically active polypeptides comprises an antibody or functional fragment thereof.
  • the antigen for the antibody domain comprises a cell surface receptor or ligand.
  • the antigen comprises a CD antigen, cytokine or chemokine receptor or ligand, growth factor receptor or ligand, tissue factor, cell adhesion molecule, MHC/MHC-like molecules, Fc receptor, Toll-like receptor, NK receptor, TCR, BCR, positive/negative co-stimulatory receptor or ligand, death receptor or ligand, tumor associated antigen, or virus encoded antigen.
  • biologically active polypeptide or "effector molecule” is meant an amino acid sequence such as a protein, polypeptide or peptide; a sugar or polysaccharide; a lipid or a glycolipid, glycoprotein, or lipoprotein that can produce the desired effects as discussed herein. Effector molecules also include chemical agents. Also contemplated are effector molecule nucleic acids encoding a biologically active or effector protein, polypeptide, or peptide. Thus, suitable molecules include regulatory factors, enzymes, antibodies, or drugs as well as DNA, RNA, and oligonucleotides.
  • the biologically active polypeptides or effector molecule can be naturally-occurring or it can be synthesized from known components, e.g., by recombinant or chemical synthesis and can include heterologous components.
  • a biologically active polypeptides or effector molecule is generally between about 0.1 to 100 KD or greater up to about 1000 KD, preferably between about 0. 1, 0.2, 0.5, 1, 2, 5, 10, 20, 30 and 50 KD as judged by standard molecule sizing techniques such as centrifugation or SDS-polyacrylamide gel electrophoresis. Desired effects of the invention include, but are not limited to, for example, forming a fusion protein complex of the invention with increased binding activity, killing a target cell, e.g.
  • an assay could be used, for example an assay that includes sequential steps of culturing cells to proliferate same.
  • Fusion protein complexes of the invention can be produced that contain a single effector molecule, including such a peptide of known structure. Additionally, a wide variety of effector molecules can be produced in similar DNA vectors. That is, a library of different effector molecules can be linked to the fusion protein complexes for recognition of infected or diseased cells. Further, for therapeutic applications, rather than administration of a the fusion protein complex of the invention to a subj ect, a DNA expression vector coding for the fusion protein complex can be administered for in vivo expression of the fusion protein complex. Such an approach avoids costly purification steps typically associated with preparation of recombinant proteins and avoids the complexities of antigen uptake and processing associated with conventional approaches.
  • components of the fusion proteins and antibodies disclosed herein e.g., effector molecule conjugates such as cytokines, chemokines, growth factors, protein toxins, immunoglobulin domains or other bioactive molecules and any peptide linkers, can be organized in nearly any fashion provided that the fusion protein or antibody has the function for which it was intended.
  • each component of the fusion protein can be spaced from another component by at least one suitable peptide linker sequence if desired.
  • the fusion proteins may include tags, e.g., to facilitate modification, identification and/or purification of the fusion protein.
  • ALT-803 for use as a therapeutic.
  • ALT-803 is administered systemically, for example, formulated in a pharmaceutically-acceptable buffer such as physiological saline.
  • a pharmaceutically-acceptable buffer such as physiological saline.
  • routes of administration include, for example, instillation into the bladder, subcutaneous, intravenous, intraperitoneal, intramuscular, or intradermal inj ections that provide continuous, sustained levels of the composition in the patient.
  • Treatment of human patients or other animals is carried out using a therapeutically effective amount of a therapeutic identified herein in a physiologically-acceptable carrier. Suitable carriers and their formulation are described, for example, in Remington's Pharmaceutical Sciences by E. W. Martin.
  • the amount of the therapeutic agent to be administered varies depending upon the manner of administration, the age and body weight of the patient, and with the clinical symptoms of the neoplasia or autoimmune or inflammatory disease. Generally, amounts will be in the range of those used for other agents used in the treatment of other diseases associated with neoplasia or autoimmune or inflammatory disease, although in certain instances lower amounts will be needed because of the increased specificity of the compound.
  • a compound is administered at a dosage that enhances an immune response of a subject, or that reduces the proliferation, survival, or invasiveness of a neoplastic cell as determined by a method known to one skilled in the art. Alternatively, the compound is administered at a dosage that reduces autoimmune or inflammatory disease caused by disease-associated immune responses.
  • ALT-803 may be contained in any appropriate amount in any suitable carrier substance, and is generally present in an amount of 1-95% by weight of the total weight of the composition.
  • the composition may be provided in a dosage form that is suitable for parenteral (e.g., subcutaneously, intravenously, intramuscularly, intravesicularly or intraperitoneally) administration route.
  • parenteral e.g., subcutaneously, intravenously, intramuscularly, intravesicularly or intraperitoneally
  • compositions may be formulated according to conventional pharmaceutical practice (see, e.g., Remington: The Science and Practice of Pharmacy (20th ed.), ed. A. R. Gennaro, Lippincott Williams & Wilkins, 2000 and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York).
  • Human dosage amounts can initially be determined by extrapolating from the amount of compound used in mice or nonhuman primates, as a skilled artisan recognizes it is routine in the art to modify the dosage for humans compared to animal models. In certain embodiments it is envisioned that the dosage may vary from between about 0.1 ⁇ g compound/kg body weight to about 5000 ⁇ g compound/kg body weight; or from about 1 ⁇ g/kg body weight to about 4000 ⁇ g/kg body weight or from about 10 ⁇ g/kg body weight to about 3000 ⁇ g/kg body weight.
  • this dose may be about 0.1, 0.3, 0.5, 1, 3, 5, 10, 25, 50, 75, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1 100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1600, 1700, 1800, 1900, 2000, 2500, 3000, 3500, 4000, 4500, or 5000 ⁇ g/kg body weight. In other embodiments, it is envisaged that doses may be in the range of about 0.5 ⁇ g compound/kg body weight to about 20 ⁇ g compound/kg body weight.
  • the doses may be about 0.5, 1, 3, 6, 10, or 20 mg/kg body weight.
  • this dosage amount may be adjusted upward or downward, as is routinely done in such treatment protocols, depending on the results of the initial clinical trials and the needs of a particular patient.
  • ALT-803 are formulated in an excipient suitable for parenteral administration.
  • ALT-803 is administered at 0.5 ⁇ g/kg- about 15 (e.g., 0.5, 1, 3, 5, 10, or 15 ⁇ ).
  • ALT-803 is administered by instillation into the bladder.
  • the ALT-803 dosage for instillation may vary from between about 5 and 1000 ⁇ g/dose.
  • compositions are formulated with appropriate excipients into a pharmaceutical composition that, upon administration, releases the therapeutic in a controlled manner.
  • suitable excipients include single or multiple unit tablet or capsule compositions, oil solutions, suspensions, emulsions, microcapsules, microspheres, molecular complexes, nanoparticles, patches, and liposomes.
  • the pharmaceutical composition comprising ALT-803 may be administered parenterally by inj ection, infusion or implantation (subcutaneous, intravenous, intramuscular, intravesicularly, intraperitoneal, or the like) in dosage forms, formulations, or via suitable delivery devices or implants containing conventional, non-toxic pharmaceutically acceptable carriers and adjuvants.
  • inj ection, infusion or implantation subcutaneous, intravenous, intramuscular, intravesicularly, intraperitoneal, or the like
  • suitable delivery devices or implants containing conventional, non-toxic pharmaceutically acceptable carriers and adjuvants.
  • Formulations can be found in Remington: The Science and Practice of Pharmacy, supra.
  • compositions comprising ALT-803 for parenteral use may be provided in unit dosage forms (e.g., in single-dose ampoules, syringes or bags), or in vials containing several doses and in which a suitable preservative may be added (see below).
  • the composition may be in the form of a solution, a suspension, an emulsion, an infusion device, or a delivery device for implantation, or it may be presented as a dry powder to be reconstituted with water or another suitable vehicle before use.
  • the composition may include suitable parenterally acceptable carriers and/or excipients.
  • the active therapeutic agent(s) may be incorporated into microspheres, microcapsules, nanoparticles, liposomes, or the like for controlled release.
  • the composition may include suspending, solubilizing, stabilizing, pH-adjusting agents, tonicity adjusting agents, and/or dispersing, agents.
  • the pharmaceutical compositions comprising ALT-803 may be in a form suitable for sterile injection.
  • the suitable active antineoplastic/anti -infective therapeutic(s) are dissolved or suspended in a parenterally acceptable liquid vehicle.
  • acceptable vehicles and solvents that may be employed are water, water adjusted to a suitable pH by addition of an appropriate amount of hydrochloric acid, sodium hydroxide or a suitable buffer, 1,3-butanediol, Ringer's solution, and isotonic sodium chloride solution and dextrose solution.
  • the aqueous formulation may also contain one or more preservatives (e.g., methyl, ethyl or n-propyl p-hydroxybenzoate).
  • a dissolution enhancing or solubilizing agent can be added, or the solvent may include 10-60% w/w of propylene glycol or the like.
  • the present invention provides methods of treating neoplastic or infectious disease and/or disorders or symptoms thereof which comprise administering a therapeutically effective amount of a pharmaceutical composition comprising a compound of the formulae herein to a subject (e.g., a mammal such as a human).
  • a subject e.g., a mammal such as a human.
  • one embodiment is a method of treating a subject suffering from or susceptible to a neoplastic or infectious disease or disorder or symptom thereof.
  • the method includes the step of administering to the mammal a therapeutic amount of an amount of a compound herein sufficient to treat the disease or disorder or symptom thereof, under conditions such that the disease or disorder is treated.
  • the methods herein include administering to the subject (including a subject identified as in need of such treatment) an effective amount of a compound described herein, or a composition described herein to produce such effect. Identifying a subject in need of such treatment can be in the judgment of a subject or a health care professional and can be subjective (e.g. opinion) or objective (e.g. measurable by a test or diagnostic method).
  • the therapeutic methods of the invention (which include prophylactic treatment) in general comprise administration of a therapeutically effective amount of the compounds herein, such as a compound of the formulae herein to a subject (e.g., animal, human) in need thereof, including a mammal, particularly a human.
  • Such treatment will be suitably administered to subjects, particularly humans, suffering from, having, susceptible to, or at risk for a neoplastic or infectious disease, disorder, or symptom thereof. Determination of those subjects "at risk” can be made by any objective or subjective determination by a diagnostic test or opinion of a subject or health care provider (e.g., genetic test, enzyme or protein marker, Marker (as defined herein), family history, and the like). ALT-803 may be used in the treatment of any other disorders in which an increase in an immune response is desired.
  • a diagnostic test or opinion of a subject or health care provider e.g., genetic test, enzyme or protein marker, Marker (as defined herein), family history, and the like.
  • ALT-803 may be used in the treatment of any other disorders in which an increase in an immune response is desired.
  • the invention provides a method of monitoring treatment progress.
  • the method includes the step of determining a level of diagnostic marker (Marker) (e.g., any target delineated herein modulated by a compound herein, a protein or indicator thereof, etc.) or diagnostic measurement (e.g., screen, assay) in a subj ect suffering from or susceptible to a disorder or symptoms thereof associated with neoplasia or autoimmune or inflammatory disease in which the subject has been administered a therapeutic amount of a compound herein sufficient to treat the disease or symptoms thereof.
  • the level of Marker determined in the method can be compared to known levels of Marker in either healthy normal controls or in other afflicted patients to establish the subject's disease status.
  • a second level of Marker in the subject is determined at a time point later than the determination of the first level, and the two levels are compared to monitor the course of disease or the efficacy of the therapy.
  • a pre- treatment level of Marker in the subject is determined prior to beginning treatment according to this invention; this pre-treatment level of Marker can then be compared to the level of Marker in the subject after the treatment commences, to determine the efficacy of the treatment.
  • ALT-803 is administered in combination with an anti-neoplasia or antiinflammatory therapeutic such as an antibody, e.g., a tumor-specific antibody or an immune- checkpoint inhibitor.
  • an antibody e.g., a tumor-specific antibody or an immune- checkpoint inhibitor.
  • the antibody and ALT-803 may be administered simultaneously or sequentially.
  • the antibody treatment is an established therapy for the disease indication and addition of ALT-803 treatment to the antibody regimen improves the therapeutic benefit to the patients. Such improvement could be measured as increased responses on a per patient basis or increased responses in the patient population.
  • Combination therapy could also provide improved responses at lower or less frequent doses of antibody resulting in a better tolerated treatment regimen.
  • the combined therapy of ALT-803 and an antibody could provide enhances clinical activity through various mechanisms, including augmented ADCC, ADCP, and/or NK cell, T-cell, neutrophil or monocytic cell levels or immune responses.
  • ALT-803 is administered in combination with any conventional therapy, including but not limited to, surgery, radiation therapy, chemotherapy, protein-based therapy or biological therapy.
  • Chemotherapeutic drugs include alkylating agents (e.g., platinum- based drugs, tetrazines, aziridines, nitrosoureas, nitrogen mustards), anti -metabolites (e.g., anti-folates, fluoropyrimidines, deoxynucleoside analogues, thiopurines), anti-microtubule agents (e.g., vinca alkaloids, taxanes), topoisomerase inhibitors (e.g., topoisomerase I and II inhibitors), cytotoxic antibiotics (e.g., anthracyclines) and immunomodulatory drugs (e.g., thalidomide and analogs).
  • alkylating agents e.g., platinum- based drugs, tetrazines, aziridines, nitrosoureas, nitrogen mustards
  • kits or pharmaceutical systems for use in treating a neoplasia or autoimmune or inflammatory disease.
  • Kits or pharmaceutical systems according to this aspect of the invention comprise a carrier means, such as a box, carton, tube, having in close confinement therein one or more container means, such as vials, tubes, ampoules, bottles, syringes, or bags.
  • the kits or pharmaceutical systems of the invention may also comprise associated instructions for using ALT-803.
  • preparation of the fusion protein complexes of the invention can be accomplished by procedures disclosed herein and by recognized recombinant DNA techniques.
  • recombinant polypeptides are produced by transformation of a suitable host cell with all or part of a polypeptide-encoding nucleic acid molecule or fragment thereof in a suitable expression vehicle.
  • suitable host cell any of a wide variety of expression systems may be used to provide the recombinant protein.
  • the precise host cell used is not critical to the invention.
  • recombinant polypeptide may be produced in virtually any eukaryotic host (e.g.,
  • Saccharomyces cerevisiae insect cells, e.g., Sf21 cells, or mammalian cells, e.g., NIH 3T3, HeLa, COS or preferably CHO cells).
  • Such cells are available from a wide range of sources (e.g., the American Type Culture Collection, Rockland, Md. ; also, see, e.g., Ausubel et al., Current Protocol in Molecular Biology, New York: John Wiley and Sons, 1997).
  • the method of transfection and the choice of expression vehicle will depend on the host system selected. Transformation methods are described, e.g., in Ausubel et al. (supra); expression vehicles may be chosen from those provided, e.g., in Cloning Vectors: A Laboratory Manual (P. H. Pouwels et al., 1985, Supp. 1987).
  • Expression vectors useful for producing such polypeptides include, without limitation, chromosomal, episomal, and virus-derived vectors, e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retroviruses, and vectors derived from combinations thereof.
  • virus-derived vectors e.g., vectors derived from bacterial plasmids, from bacteriophage, from transposons, from yeast episomes, from insertion elements, from yeast chromosomal elements, from viruses such as baculoviruses, papova viruses, such as SV40, vaccinia viruses, adenoviruses, fowl pox viruses, pseudorabies viruses and retrovirus
  • the recombinant polypeptide is expressed, it is isolated, e.g., using affinity chromatography.
  • an antibody e.g., produced as described herein
  • an antibody raised against the polypeptide may be attached to a column and used to isolate the recombinant polypeptide. Lysis and fractionation of polypeptide-harboring cells prior to affinity chromatography may be performed by standard methods (see, e.g., Ausubel et al, supra).
  • the recombinant protein can, if desired, be further purified, e.g., by high performance liquid chromatography (see, e.g., Fisher, Laboratory Techniques In
  • biologically active polypeptides or effector molecules of the invention may include factors such as cytokines, chemokines, growth factors, protein toxins, immunoglobulin domains or other bioactive proteins such as enzymes. Also biologically active polypeptides may include conjugates to other compounds such as non-protein toxins, cytotoxic agents, chemotherapeutic agents, detectable labels, radioactive materials and such.
  • Cytokines of the invention are defined by any factor produced by cells that affect other cells and are responsible for any of a number of multiple effects of cellular immunity.
  • cytokines include but are not limited to the IL-2 family, interferon (IFN), IL-10, IL-1 , IL-17, TGF and TNF cytokine families, and to IL-1 through IL-35, IFN-a, IFN- ⁇ , IFNy, TGF- ⁇ , TNF-a, and ⁇ .
  • the first fusion protein comprises a first biologically active polypeptide covalently linked to interleukin-15 (IL-15) domain or a functional fragment thereof.
  • IL-15 is a cytokine that affects T-cell activation and proliferation.
  • IL-15 activity in affecting immune cell activation and proliferation is similar in some respects to IL- 2, although fundamental differences have been well characterized (Waldmann, T A, 2006, Nature Rev. Immunol. 6:595-601).
  • the first fusion protein comprises an interleukin-15 (IL-15) domain that is an IL-15 variant (also referred to herein as IL-15 mutant).
  • the IL-15 variant preferably comprises a different amino acid sequence that the native (or wild type) IL- 15 protein.
  • the IL-15 variant preferably binds the IL-15Ra polypeptide and functions as an IL-15 agonist or antagonist.
  • IL-15 variants with agonist activity have super agonist activity.
  • the IL-15 variant can function as an IL-15 agonist or antagonist independent of its association with IL-15Ra.
  • IL-15 agonists are exemplified by comparable or increased biological activity compared to wild type IL-15.
  • IL-15 antagonists are exemplified by decreased biological activity compared to wild type IL-15 or by the ability to inhibit IL-15-mediated responses.
  • the IL-15 variant binds with increased or decreased activity to the IL-15R yC receptors.
  • the sequence of the IL-15 variant has at least one amino acid change, e.g. substitution or deletion, compared to the native IL-15 sequence, such changes resulting in IL-15 agonist or antagonist activity.
  • the amino acid substitutions/deletions are in the domains of IL-15 that interact with IL-15R and/or yC. More preferably, the amino acid substitutions/deletions do not affect binding to the IL-15Ra polypeptide or the ability to produce the IL-15 variant.
  • Suitable amino acid substitutions/deletions to generate IL-15 variants can be identified based on putative or known IL-15 structures, comparisons of IL-15 with homologous molecules such as IL-2 with known structure, through rational or random mutagenesis and functional assays, as provided herein, or other empirical methods. Additionally suitable amino acid substitutions can be conservative or non-conservative changes and insertions of additional amino acids.
  • IL-15 variants of the invention contain one or more than one amino acid substitutions/deletions at position 6, 8, 10, 61, 65, 72, 92, 101, 104, 105, 108, 109, 111, or 112 of the mature human IL-15 sequence; particularly, D8N ("D8" refers to the amino acid and residue position in the native mature human IL-15 sequence and "N” refers to the substituted amino acid residue at that position in the IL-15 variant), I6S, D8A, D61A, N65A, N72R, V104P or Q108A substitutions result in IL-15 variants with antagonist activity and N72D substitutions result in IL-15 variants with agonist activity.
  • D8N refers to the amino acid and residue position in the native mature human IL-15 sequence and “N” refers to the substituted amino acid residue at that position in the IL-15 variant
  • I6S, D8A, D61A, N65A, N72R, V104P or Q108A substitutions result in IL-15
  • Chemokines similar to cytokines, are defined as any chemical factor or molecule which when exposed to other cells are responsible for any of a number of multiple effects of cellular immunity. Suitable chemokines may include but are not limited to the CXC, CC, C, and CX.sub.3C chemokine families and to CCL-1 through CCL-28, CXC-1 through CXC-17, XCL-1, XCL-2, CX3CL1, MIP-lb, IL-8, MCP-1, and Rantes.
  • Growth factors include any molecules which when exposed to a particular cell induce proliferation and/or differentiation of the affected cell. Growth factors include proteins and chemical molecules, some of which include: GM-CSF, G-CSF, human growth factor and stem cell growth factor. Additional growth factors may also be suitable for uses described herein.
  • Toxins or cytotoxic agents include any substance that has a lethal effect or an inhibitory effect on growth when exposed to cells. More specifically, the effector molecule can be a cell toxin of, e.g., plant or bacterial origin such as, e.g., diphtheria toxin (DT), shiga toxin, abrin, cholera toxin, ricin, saporin, pseudomonas exotoxin (PE), pokeweed antiviral protein, or gelonin. Biologically active fragments of such toxins are well known in the art and include, e.g., DT A chain and ricin A chain. Additionally, the toxin can be an agent active at the cell surface such as, e.g., phospholipase enzymes (e.g., phospholipase C).
  • the effector molecule can be a chemotherapeutic drug such as, e.g., vindesine, vincristine, vinblastin, methotrexate, adriamycin, bleomycin, or cisplatin.
  • chemotherapeutic drug such as, e.g., vindesine, vincristine, vinblastin, methotrexate, adriamycin, bleomycin, or cisplatin.
  • the effector molecule can be a detectably-labeled molecule suitable for diagnostic or imaging studies.
  • labels include biotin or streptavidin/avidin, a detectable nanoparticles or crystal, an enzyme or catalytically active fragment thereof, a fluorescent label such as green fluorescent protein, FITC, phycoerythrin, cychome, Texas red or quantum dots; a radionuclide e.g., iodine-131, yttrium-90, rhenium-188 or bismuth-212; a
  • phosphorescent or chemiluminescent molecules or a label detectable by PET, ultrasound or MRI such as Gd- or paramagnetic metal ion-based contrast agents See e.g., Moskaug, et al. J. Biol. Chem. 264, 15709 (1989); Pastan, I. et al. Cell 47, 641, 1986; Pastan et al.,
  • a protein fusion or conjugate complex that includes a covalently linked IL-15 and IL- 15Ra domains has several important uses. Cells or tissue susceptible to being damaged or killed can be readily assayed by the methods disclosed herein.
  • the IL-15 and IL-15Ra polypeptides of the invention suitably correspond in amino acid sequence to naturally occurring IL-15 and IL-15Ra molecules, e.g. IL-15 and IL-15Ra molecule of a human, mouse or other rodent, or other mammal.
  • the protein fusion or conjugate complexes of the present invention can be polyvalent, e.g., to increase the valency of the sc-TCR or sc- antibody.
  • interactions between the IL-15 and IL-15Ra domains of the fusion protein complex provide a means of generating polyvalent complexes.
  • the polyvalent fusion protein can made by covalently or non-covalently linking together between one and four proteins (the same or different) by using e.g., standard biotin-streptavidin labeling techniques, or by conjugation to suitable solid supports such as latex beads.
  • Chemically cross-linked proteins are also suitable polyvalent species.
  • the protein can be modified by including sequences encoding tag sequences that can be modified such as the biotinylation BirA tag or amino acid residues with chemically reactive side chains such as Cys or His.
  • Such amino acid tags or chemically reactive amino acids may be positioned in a variety of positions in the fusion protein or antibody, preferably distal to the active site of the biologically active polypeptide or effector molecule.
  • the C-terminus of a soluble fusion protein can be covalently linked to a tag or other fused protein which includes such a reactive amino acid(s).
  • Suitable side chains can be included to chemically link two or more fusion proteins to a suitable nanoparticle to give a multivalent molecule.
  • Exemplary nanoparticles include dendrimers, liposomes, core-shell particles or PLGA-based particles.
  • one or both of the polypeptides of the fusion protein complex comprises an immunoglobulin domain.
  • the protein binding domain-IL-15 fusion protein can be further linked to an immunoglobulin domain.
  • the preferred immunoglobulin domains comprise regions that allow interaction with other immunoglobulin domains to form multichain proteins as provided above.
  • the immunoglobulin heavy chain regions such as the IgGl CH2-CH3, are capable of stably interacting to create the Fc region.
  • Preferred immunoglobulin domains including Fc domains also comprise regions with effector functions, including Fc receptor or complement protein binding activity, and/or with glycosylation sites.
  • the immunoglobulin domains of the fusion protein complex contain mutations that reduce or augment Fc receptor or complement binding activity or glycosylation, thereby affecting the biological activity of the resulting protein.
  • immunoglobulin domains containing mutations that reduce binding to Fc receptors could be used to generate fusion protein complex of the invention with lower binding activity to Fc receptor-bearing cells, which may be
  • the invention further provides nucleic acid sequences and particularly DNA sequences that encode the present proteins (e.g., components of ALT-803).
  • the DNA sequence is carried by a vector suited for extrachromosomal replication such as a phage, virus, plasmid, phagemid, cosmid, YAC, or episome.
  • a DNA vector that encodes a desired fusion protein can be used to facilitate preparative methods described herein and to obtain significant quantities of the fusion protein.
  • the DNA sequence can be inserted into an appropriate expression vector, i.e., a vector that contains the necessary elements for the transcription and translation of the inserted protein-coding sequence.
  • a variety of host-vector systems may be utilized to express the protein-coding sequence.
  • mammalian cell systems infected with virus e.g., vaccinia virus, adenovirus, etc.
  • insect cell systems infected with virus e.g., baculovirus
  • microorganisms such as yeast containing yeast vectors, or bacteria transformed with bacteriophage DNA, plasmid DNA or cosmid DNA.
  • any one of a number of suitable transcription and translation elements may be used. See, Sambrook et al, supra and Ausubel et al. supra.
  • soluble fusion protein complex comprising introducing into a host cell a DNA vector as described herein encoding the first and second fusion proteins, culturing the host cell in media under conditions sufficient to express the fusion proteins in the cell or the media and allow association between IL-15 domain of a first fusion protein and the soluble IL-15Ra domain of a second fusion protein to form the soluble fusion protein complex, purifying the soluble fusion protein complex from the host cells or media.
  • a preferred DNA vector according to the invention comprises a nucleotide sequence linked by phosphodiester bonds comprising, in a 5' to 3' direction a first cloning site for introduction of a first nucleotide sequence encoding a biologically active polypeptide, operatively linked to a sequence encoding an effector molecule.
  • the fusion protein components encoded by the DNA vector can be provided in a cassette format.
  • cassette is meant that each component can be readily substituted for another component by standard recombinant methods.
  • a DNA vector configured in a cassette format is particularly desirable when the encoded fusion complex is to be used against pathogens that may have or have capacity to develop serotypes.
  • the sequence coding for the biologically active polypeptide is linked to a sequence coding for the effector peptide by use of suitable ligases.
  • DNA coding for the presenting peptide can be obtained by isolating DNA from natural sources such as from a suitable cell line or by known synthetic methods, e.g. the phosphate triester method. See, e.g., Oligonucleotide Synthesis, IRL Press (M. J. Gait, ed., 1984). Synthetic oligonucleotides also may be prepared using commercially available automated oligonucleotide synthesizers.
  • the gene coding for the biologically active polypeptide can be amplified by the polymerase chain reaction (PCR) or other means known in the art.
  • PCR polymerase chain reaction
  • Suitable PCR primers to amplify the biologically active polypeptide gene may add restriction sites to the PCR product.
  • the PCR product preferably includes splice sites for the effector peptide and leader sequences necessary for proper expression and secretion of the biologically active polypeptide -effector fusion complex.
  • the PCR product also preferably includes a sequence coding for the linker sequence, or a restriction enzyme site for ligation of such a sequence.
  • the fusion proteins described herein are preferably produced by standard recombinant DNA techniques. For example, once a DNA molecule encoding the biologically active polypeptide is isolated, sequence can be ligated to another DNA molecule encoding the effector polypeptide.
  • the nucleotide sequence coding for a biologically active polypeptide may be directly joined to a DNA sequence coding for the effector peptide or, more typically, a DNA sequence coding for the linker sequence as discussed herein may be interposed between the sequence coding for the biologically active polypeptide and the sequence coding for the effector peptide and joined using suitable ligases.
  • the resultant hybrid DNA molecule can be expressed in a suitable host cell to produce the fusion protein complex.
  • the DNA molecules are ligated to each other in a 5' to 3' orientation such that, after ligation, the translational frame of the encoded polypeptides is not altered (i.e., the DNA molecules are ligated to each other in-frame).
  • the resulting DNA molecules encode an in-frame fusion protein.
  • nucleotide sequences also can be included in the gene construct.
  • a promoter sequence which controls expression of the sequence coding for the biologically active polypeptide fused to the effector peptide, or a leader sequence, which directs the fusion protein to the cell surface or the culture medium, can be included in the construct or present in the expression vector into which the construct is inserted.
  • An immunoglobulin or CMV promoter is particularly preferred.
  • polypeptides may be modified by certain amino acid substitutions, additions, deletions, and post-translational modifications, without loss or reduction of biological activity.
  • conservative amino acid substitutions that is, substitution of one amino acid for another amino acid of similar size, charge, polarity and conformation, are unlikely to significantly alter protein function.
  • the 20 standard amino acids that are the constituents of proteins can be broadly categorized into four groups of conservative amino acids as follows: the nonpolar (hydrophobic) group includes alanine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan and valine; the polar (uncharged, neutral) group includes asparagine, cysteine, glutamine, glycine, serine, threonine and tyrosine; the positively charged (basic) group contains arginine, histidine and lysine; and the negatively charged (acidic) group contains aspartic acid and glutamic acid.
  • the nonpolar (hydrophobic) group includes alanine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan and valine
  • the polar (uncharged, neutral) group includes asparagine, cysteine, glutamine, glycine, serine, threonine and
  • Homology between nucleotide sequences can be determined by DNA hybridization analysis, wherein the stability of the double-stranded DNA hybrid is dependent on the extent of base pairing that occurs. Conditions of high temperature and/or low salt content reduce the stability of the hybrid, and can be varied to prevent annealing of sequences having less than a selected degree of homology.
  • hybridization and wash conditions 40-50 °C, 6 x SSC (sodium chloride/sodium citrate buffer) and 0.1% SDS (sodium dodecyl sulfate) indicate about 60-70% homology
  • hybridization and wash conditions of 50-65 °C, 1 x SSC and 0.1% SDS indicate about 82- 97% homology
  • hybridization and wash conditions of 52 °C, 0.1 x SSC and 0.1% SDS indicate about 99-100% homology.
  • the components of the fusion protein can be organized in nearly any order provided each is capable of performing its intended function.
  • the biologically active polypeptide is situated at the C or N terminal end of the effector molecule.
  • effector molecules of the invention will have sizes conducive to the function for which those domains are intended.
  • the effector molecules of the invention can be made and fused to the biologically active polypeptide by a variety of methods including well- known chemical cross-linking methods. See, e.g., Means, G. E. and Feeney, R. E. (1974) in Chemical Modification of Proteins, Holden-Day. See also, S. S. Wong (1991) in Chemistry of Protein Conjugation and Cross -Linking, CRC Press. However it is generally preferred to use recombinant manipulations to make the in-frame fusion protein.
  • a fusion molecule or a conjugate molecule in accord with the invention can be organized in several ways.
  • the C-terminus of the biologically active polypeptide is operatively linked to the N-terminus of the effector molecule. That linkage can be achieved by recombinant methods if desired.
  • the N-terminus of the biologically active polypeptide is linked to the C-terminus of the effector molecule.
  • one or more additional effector molecules can be inserted into the biologically active polypeptide or conjugate complexes as needed.
  • a construct encoding ALT-803 can be incorporated into a suitable vector using restriction enzymes to make cuts in the vector for insertion of the construct followed by ligation.
  • the vector containing the gene construct is then introduced into a suitable host for expression of the fusion protein. See, generally, Sambrook et al, supra. Selection of suitable vectors can be made empirically based on factors relating to the cloning protocol. For example, the vector should be compatible with, and have the proper replicon for the host that is being employed. The vector must be able to accommodate the DNA sequence coding for the fusion protein complex that is to be expressed.
  • Suitable host cells include eukaryotic and prokaryotic cells, preferably those cells that can be easily transformed and exhibit rapid growth in culture medium.
  • Specifically preferred hosts cells include prokaryotes such as E. coli, Bacillus subtillus, etc. and eukaryotes such as animal cells and yeast strains, e.g., S. cerevisiae.
  • Mammalian cells are generally preferred, particularly J558, NSO, SP2-0 or CHO.
  • Other suitable hosts include, e.g., insect cells such as Sf9. Conventional culturing conditions are employed. See, Sambrook, supra. Stable transformed or transfected cell lines can then be selected.
  • Cells expressing a fusion protein complex of the invention can be determined by known procedures. For example, expression of a fusion protein complex linked to an immunoglobulin can be determined by an ELISA specific for the linked immunoglobulin and/or by immunoblotting. Other methods for detecting expression of fusion proteins comprising biologically active polypeptides linked to IL-15 or IL-15Ra domains are disclosed in the Examples.
  • a host cell can be used for preparative purposes to propagate nucleic acid encoding a desired fusion protein.
  • a host cell can include a prokaryotic or eukaryotic cell in which production of the fusion protein is specifically intended.
  • host cells specifically include yeast, fly, worm, plant, frog, mammalian cells and organs that are capable of propagating nucleic acid encoding the fusion.
  • mammalian cell lines which can be used include CHO dhfr-cells (Urlaub and Chasm, Proc. Natl. Acad. Sci. USA, 77:4216 (1980)), 293 cells (Graham et ah, J Gen. Virol., 36:59 (1977)) or myeloma cells like SP2 or NSO (Galfre and Milstein, Meth. Enzymol., 73(B):3 (1981)).
  • Host cells capable of propagating nucleic acid encoding a desired fusion protein complexes encompass non-mammalian eukaryotic cells as well, including insect (e.g., Sp. irugiperdd), yeast (e.g., S. cerevisiae, S. pombe, P. pastoris., K. lactis, H. polymorpha; as generally reviewed by Fleer, R., Current Opinion in Biotechnology, 3(5):486496 (1992)), fungal and plant cells. Also contemplated are certain prokaryotes such as E. coli and Bacillus.
  • Nucleic acid encoding a desired fusion protein can be introduced into a host cell by standard techniques for transfecting cells.
  • transfecting or “transfection” is intended to encompass all conventional techniques for introducing nucleic acid into host cells, including calcium phosphate co-precipitation, DEAE-dextran-mediated transfection, lipofection, electroporation, microinjection, viral transduction and/or integration. Suitable methods for transfecting host cells can be found in Sambrook et al. supra, and other laboratory textbooks.
  • promoters transcriptional initiation regulatory region
  • the selection of the appropriate promoter is dependent upon the proposed expression host. Promoters from heterologous sources may be used as long as they are functional in the chosen host.
  • Promoter selection is also dependent upon the desired efficiency and level of peptide or protein production.
  • Inducible promoters such as tac are often employed in order to dramatically increase the level of protein expression in E. coli. Overexpression of proteins may be harmful to the host cells. Consequently, host cell growth may be limited.
  • the use of inducible promoter systems allows the host cells to be cultivated to acceptable densities prior to induction of gene expression, thereby facilitating higher product yields.
  • signal sequences may be used according to the invention.
  • a signal sequence which is homologous to the biologically active polypeptide coding sequence may be used.
  • a signal sequence which has been selected or designed for efficient secretion and processing in the expression host may also be used.
  • suitable signal sequence/host cell pairs include the B. subtilis sacB signal sequence for secretion in B.
  • the signal sequence may be joined directly through the sequence encoding the signal peptidase cleavage site to the protein coding sequence, or through a short nucleotide bridge consisting of usually fewer than ten codons, where the bridge ensures correct reading frame of the downstream protein sequence.
  • Elements for enhancing transcription and translation have been identified for eukaryotic protein expression systems. For example, positioning the cauliflower mosaic virus (CaMV) promoter 1000 bp on either side of a heterologous promoter may elevate transcriptional levels by 10- to 400-fold in plant cells.
  • the expression construct should also include the appropriate translational initiation sequences. Modification of the expression construct to include a Kozak consensus sequence for proper translational initiation may increase the level of translation by 10 fold.
  • a selective marker is often employed, which may be part of the expression construct or separate from it (e.g., carried by the expression vector), so that the marker may integrate at a site different from the gene of interest.
  • markers that confer resistance to antibiotics (e.g., bla confers resistance to ampicillin for ?, coli host cells, nptll confers kanamycin resistance to a wide variety of prokaryotic and eukaryotic cells) or that permit the host to grow on minimal medium (e.g., HIS4 enables P. pastoris or His S. cerevisiae to grow in the absence of histidine).
  • the selectable marker has its own transcriptional and translational initiation and termination regulatory regions to allow for independent expression of the marker. If antibiotic resistance is employed as a marker, the concentration of the antibiotic for selection will vary depending upon the antibiotic, generally ranging from 10 to 600 ⁇ g of the antibiotic/mL of medium.
  • the expression construct is assembled by employing known recombinant DNA techniques (Sambrook et al, 1989; Ausubel et al, 1999). Restriction enzyme digestion and ligation are the basic steps employed to join two fragments of DNA. The ends of the DNA fragment may require modification prior to ligation, and this may be accomplished by filling in overhangs, deleting terminal portions of the fragment(s) with nucleases (e.g., ExoIII), site directed mutagenesis, or by adding new base pairs by PCR. Polylinkers and adaptors may be employed to facilitate j oining of selected fragments.
  • the expression construct is typically assembled in stages employing rounds of restriction, ligation, and transformation of E. coli.
  • cloning vectors suitable for construction of the expression construct are known in the art ( ⁇ and pBLUESCRIPT SK-1 , Stratagene, La Jolla, CA, pET, Novagen Inc., Madison, WI, cited in Ausubel et al., 1999) and the particular choice is not critical to the invention.
  • the selection of cloning vector will be influenced by the gene transfer system selected for introduction of the expression construct into the host cell. At the end of each stage, the resulting construct may be analyzed by restriction, DNA sequence, hybridization and PCR analyses.
  • the expression construct may be transformed into the host as the cloning vector construct, either linear or circular, or may be removed from the cloning vector and used as is or introduced onto a delivery vector.
  • the delivery vector facilitates the introduction and maintenance of the expression construct in the selected host cell type.
  • the expression construct is introduced into the host cells by any of a number of known gene transfer systems (e.g., natural competence, chemically mediated transformation, protoplast transformation, electroporation, biolistic transformation, transfection, or conjugation) (Ausubel et al., 1999; Sambrook et al., 1989). The gene transfer system selected depends upon the host cells and vector systems used.
  • the expression construct can be introduced into S. cerevisiae cells by protoplast transformation or electroporation. Electroporation of S. cerevisiae is readily accomplished, and yields transformation efficiencies comparable to spheroplast
  • the present invention further provides a production process for isolating a fusion protein of interest.
  • a host cell e.g., a yeast, fungus, insect, bacterial or animal cell
  • a nucleic acid encoding the protein of the interest operatively linked to a regulatory sequence
  • the fusion protein of interest is isolated from harvested host cells or from the culture medium.
  • Standard protein purification techniques can be used to isolate the protein of interest from the medium or from the harvested cells.
  • the purification techniques can be used to express and purify a desired fusion protein on a large-scale (i.e. in at least milligram quantities) from a variety of implementations including roller bottles, spinner flasks, tissue culture plates, bioreactor, or a fermenter.
  • An expressed protein fusion complex can be isolated and purified by known methods. Typically the culture medium is centrifuged or filtered and then the supernatant is purified by affinity or immunoaffinity chromatography, e.g. Protein- A or Protein-G affinity
  • the fusion proteins of the present invention can be separated and purified by appropriate combination of known techniques. These methods include, for example, methods utilizing solubility such as salt precipitation and solvent precipitation, methods utilizing the difference in molecular weight such as dialysis, ultrafiltration, gel -filtration, and SDS-polyacrylamide gel electrophoresis, methods utilizing a difference in electrical charge such as ion-exchange column chromatography, methods utilizing specific affinity such as affinity chromatography, methods utilizing a difference in hydrophobicity such as reverse-phase high performance liquid chromatography and methods utilizing a difference in isoelectric point, such as isoelectric focusing electrophoresis, metal affinity columns such as Ni-NTA. See generally Sambrook et al. and Ausubel et al. supra for disclosure relating to these methods.
  • the fusion proteins of the present invention be substantially pure. That is, the fusion proteins have been isolated from cell substituents that naturally accompany it so that the fusion proteins are present preferably in at least 80% or 90% to 95%
  • homogeneity (w/w). Fusion proteins having at least 98 to 99% homogeneity (w/w) are most preferred for many pharmaceutical, clinical and research applications.
  • the fusion protein should be substantially free of contaminants for therapeutic applications.
  • the soluble fusion proteins can be used therapeutically, or in performing in vitro or in vivo assays as disclosed herein.
  • Substantial purity can be determined by a variety of standard techniques such as
  • the present fusion protein complexes are suitable for in vitro or in vivo use with a variety of cells that are cancerous or are infected or that may become infected by one or more diseases.
  • Human interleukin-15 (hIL-15) is trans-presented to immune effector cells by the human IL-15 receptor a chain (hIL-15Ra) expressed on antigen presenting cells.
  • IL-15Ra binds hIL-15 with high affinity (38 pM) primarily through the extracellular sushi domain (IL- 15RaSu).
  • the IL-15 and IL-15RaSu domains can be used to generate a soluble complex (e.g., ALT-803) or as a scaffold to construct multi-domain fusion complexes.
  • etanercept is a dimer of soluble human p75 tumor necrosis factor-a (TNF-a) receptor (sTNFR) linked to the Fc domain of human IgGl.
  • TNF-a tumor necrosis factor-a
  • sTNFR tumor necrosis factor-a receptor
  • the Fc fragment In addition to its dimerization activity, the Fc fragment also provides cytotoxic effector functions through the complement activation and interaction with Fey receptors displayed on natural killer (NK) cells, neutrophils, monocyte cells, phagocytes and dendritic cells.
  • NK natural killer
  • these activities likely play an important role in efficacy observed in animal tumor models and in cancer patients.
  • these cytotoxic effector responses may not be sufficient in a number of therapeutic applications.
  • hIL-15 human IL-15
  • IL-15Ra hIL-15 receptor a-chain
  • KD Equilibrium dissociation constant
  • hIL-15 and hlL- 15Ra are co-produced in dendritic cells to form complexes intracellularly that are subsequently secreted and displayed as heterodimeric molecules on cell surfaces.
  • hIL-15 and hIL-15Ra interactions suggest that these inter chain binding domains could serve as a human-derived immunostimulatory complex and as a scaffold to make soluble dimeric molecules capable of target-specific binding.
  • Described herein is the enhancement of anti -tumor activities of an anti-CD38 antibody using ALT-803, an IL-15 super-agonist, in in vitro and an experimental animal tumor models.
  • Daratumumab is an anti-CD38 antibody that has recently been approved by FDA for treatment of patients with relapsed or refractory multiple myeloma.
  • Daratumumab has been shown to reduce the tumor burden by targeting CD38 expressing tumor cells.
  • anti-CD38 Abs such as isatuximab (SAR650984), MOR202, Ab79, AB19, and MT-4019
  • isatuximab SAR650984
  • MOR202 MOR202
  • Ab79 AB19
  • MT-4019 MT-4019
  • ADCC anti-CD38antibody dependent cellular cytotoxicity
  • ALT-803 As described in the examples below, purified human NK cells, which were activated by ALT-803, enhanced daratumumab-mediated ADCC activity against primary human B-lymphoma cells.
  • the in vivo effects of ALT-803 on daratumumab-mediated antitumor activity against Daudi cells were also examined in the SCID xenograft model. It was observed that both ALT-803 and daratumumab alone were capable of reducing Daudi tumor burden in tumor-bearing mice. However, the combination of ALT-803 with daratumumab increased antitumor activity which significantly reduced Daudi cells in the bone marrow.
  • ALT-803 also augments the Antibody Dependent Cytotoxicity of Phagocytosis of daratumumab against tumor cells.
  • the correlative studies also show that ALT-803 augments the ADCC activity of daratumumab against Daudi cells. This also demonstrates that ALT-803 possesses synergistic antitumor activities with tumor-specific antibodies in vivo.
  • Example 1 Induction of cell-mediated cytotoxicity by ALT-803 in combination with anti- CD38 antibodies
  • ALT-803 is meant a complex comprising IL-15N72D
  • the IL-15N72D and/or IL-15RaSu/Fc fusion protein comprises one, two, three, four or more amino acid variations relative to a reference sequence.
  • An exemplary IL-15N72D amino acid sequence is provided below. (See, e.g., U.S. S.N. 13/769,179, incorporated herein by reference).
  • IL-15N72D nucleic acid sequence is provided below (with leader peptide) (SEQ ID NO: 1):
  • IL-15N72D amino acid sequence is provided below (with leader peptide) (SEQ ID NO: 2):
  • the leader peptide is cleaved from the mature IL-15N72D polypeptide (SEQ ID NO: 3):
  • IL-15RaSu/Fc nucleic acid sequence (with leader peptide) is provided below (SEQ ID NO: 4):
  • IL-15RaSu/Fc amino acid sequence (with leader peptide) is provided below (SEQ ID NO: 5):
  • the mature IL-15RaSu/Fc protein lacks the leader sequence (SEQ ID NO: 1]
  • KTMWYVDGVEVHNAKT ⁇ REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL
  • ALT-803 in combination with anti-CD38 Ab can affected cell- mediated cytotoxicity against cancer cells.
  • isolated human PBMCs from blood buffy coats were used as effector cells.
  • Daudi human B-cell lymphoma cells were used as target cells and were labeled with CellTraceTM Violet at 5 ⁇ in RPMI-10 (RPMI-1640, 2-mercaptoethanol, penicillin-streptomycin-glutamine, non-essential amino acids, sodium pyruvate, and 10% fetal bovine serum) at 37°C for 20 minutes as described by the manufacturer.
  • the effector cells were mixed with the violet-labeled target tumor cells at a ratio of 5: 1 and incubated at 37°C with 5% C0 2 in RPMI-10 with and without ALT-803 or with combination with anti- CD38 Ab (daratumumab) for two days. The mixture was then harvested by centrifugation and resuspended in RPMI-10 containing 2 mg/ml propidium iodide. Cytotoxicity of the effector cells against the target cells was evaluated by flow cytometry by determining the percentage of dead violet-labeled target cells after propidium iodide staining. As shown in Figure 1, fresh human PBMCs had weak cytotoxicity against Daudi cells in the absence of ALT-803.
  • PBMCs had strong cytotoxicity against Daudi tumor target cells in the presence of ALT-803 at 10 nM.
  • Daudi tumor cells express CD38 molecules, which can be recognized by anti-CD38 Ab (daratumumab).
  • Human PBMCs are capable of lysing Daudi cells by antibody-dependent cellular cytotoxicity (ADCC) mediated by anti-CD38 Ab alone ( Figure 1).
  • ADCC antibody-dependent cellular cytotoxicity
  • ALT-803 was capable of significantly augmenting anti-CD38 Ab mediated ADCC activity of human PBMCs against Daudi tumor cells.
  • ALT-803 concentration dependent induction of human PBMC cytotoxicity against Daudi cells was investigated. Fresh human PBMCs were mixed with CellTrace Violet labeled Daudi cells in RPMI-10 medium with various concentrations (from 1 nM to 25 nM) of ALT- 803 and a fixed concentration of anti-CD38 Ab (10 nM) followed by incubation for 2 days. The cytotoxicity of the human PBMCs against the target cells was evaluated by flow cytometry as described above. Consistent with the results in Figure 1, ALT-803 was capable of augmenting anti-CD38 Ab-mediated cytotoxicity of human PBMCs against Daudi cells at as low as 1 nM ( Figure 2A).
  • NK cells were isolated from human PBMCs by MACS and used as the effector cells in the ADCC assay described above. Similarly, to results with total human PBMC, NK cells were capable of killing Daudi tumor cells via anti-CD38 Ab-mediated ADCC activity that was enhanced by addition of ALT-803 ( Figure 2C). Compare to total PBMCs, greater cytotoxicity against tumor targets was observed with NK cell incubated with ALT-803 plus anti-CD38 Ab.
  • Example 2 Antitumor activity of ALT-803 plus anti-CD38 Ab treatment in mice bearing hematologic tumors
  • ALT-803 The ability of ALT-803 to augment the antitumor efficacy of anti-CD38 Ab was further evaluated in SCID mice bearing Daudi tumors. In addition, effect of the combination of ALT-803 plus anti-CD38 Ab was assessed in tumor-bearing mice following pretreatment with steroids. Steroids are commonly used in conjunction with anti-CD38 Ab therapy as antiinflammatory agents to reduce infusion reactions. However, there is also concern that the immunosuppressive effects of these steroids may also limit the immune-mediated efficacy of the anti-CD38 Ab therapy.
  • mice Fox Chase SCID female mice (Harlan, C.B- 17/IcrHsd-Prkdc-scid: 6 weeks-old) were inoculated intravenously (i.v.) with Daudi cells (10 x 10 6 per mouse) (6 mice/group). These mice have functional NK cells which likely mediate ADCC responses against tumors.
  • tumor-bearing mice were also treated on day 15 (post tumor inoculation) with steroid (hydrocortisone, 0.2 mg/mouse, intra-peritoneal) one hour prior to i.v. treatment with PBS or anti-CD38 Ab (10 mg/kg).
  • mice were further treated with ALT-803 (0.2 mg/kg, subcutaneously). Seven days after anti-CD38 Ab treatment the mice were sacrificed and the levels of the Daudi cells in bone marrow were determined. The percentage of Daudi cells of femur bone marrow cells was assessed following staining with PE-conjugated anti-human HLA-DR antibody (BioLegend) and flow cytometry analysis. As shown in Figure 3, ALT-803 and anti-CD38 Ab monotherapies are capable of reducing the percentage of Daudi cells in the bone marrow of tumor-bearing mice.
  • ALT-803 plus anti-CD38 Ab provided the greatest antitumor activity reducing bone marrow Daudi cells from 62% in control mice to 10% in ALT-803 + anti-CD38 Ab treated mice. This enhance efficacy was also observed in tumor-bearing mice treated with steroids prior to ALT-803 plus anti-CD38 Ab therapy. In fact, similar antitumor activity was seen in ALT-803 plus anti-CD38 Ab treated mice with or without pre-treatment with steroids.
  • ALT-803 plus anti-CD38 Ab to prolong survival of mice bearing Daudi cell tumors was also evaluated.
  • Fox Chase SCID female mice were inoculated intravenously (i.v.) with Daudi cells (10 x 10 6 per mouse). Fifteen days later, the tumor- bearing mice were treated with either PBS or and anti-CD38 Ab (10 mg/kg, i.v.). All mice were pre-treated with steroid (hydrocortisone, 0.2 mg/mouse, intra-peritoneal) to reduce infusion reaction, except the PBS treated mice. On day 17 ALT-803 and ALT-803 combination with anti-CD38 Ab groups mice were treated with ALT-803 (0.2 mg/kg, subcutaneously).
  • ALT-803, anti-CD38 Ab and ALT-803 with combination with anti-CD38 Ab groups were treated similar as on day 15 and day 17. Survival (including morbidity based on hind leg paralysis) of the mice was monitored. As shown in Figure 4, tumor bearing mice treated with PBS, ALT-803 and anti-CD38 Ab monotherapy groups showed median survival of 31- 41 days whereas all tumor-bearing mice treated with anti- CD38 Ab survived greater than 45 days, indicating combined therapy significantly prolongs survival of mice bearing B cell lymphomas. Together, these results confirm the synergistic antitumor effects of ALT-803 in combination with anti-CD38 Ab in vivo. These results were observed in the presence of steroid pretreatment.
  • ALT-803-stimulated NK cells enhance anti-CD38 mediated macrophage activity against tumor cells
  • Therapeutic antibodies may mediate antitumor activity in part through antibody-dependent cellular phagocytic (ADCP) activity of macrophages against tumor cells.
  • ADCP antibody-dependent cellular phagocytic
  • Macrophage activity in rum can be stimulated by cytokines and other agents release by other immune effector cells.
  • cytokines and other agents release by other immune effector cells.
  • a flow cytometric based phagocytosis assay using human macrophage cell line THP-1 as primary effector cells, human NK-92 cell line (NK cell line) as secondary effector cells and Daudi cells as target tumor cells.
  • a TranswellTM system was used to separate NK-92 cells (aNK cells) from THP-1 and Daudi cells.
  • NK-92 cells (1 x 10 5 ) were cultured in top wells of TranswellTM insert (Corning) whereas THP-1 cells (1 x 10 5 ) (labeled with PKH67 as per manufactured protocol-Sigma) and Daudi cells (1 x 10 5 ) (labeled with CellTrace Violet as per manufactured protocol-Molecular Probes) in bottom wells of 24 wells plate. Cells were either treated with media alone or media containing 10 nM ALT-803, 10 nM anti-CD38 Ab, or 10 nM ALT-803 plus 10 nM anti-CD38 Ab in 1 ml total volume in each well.
  • THP-1 and Daudi cells were harvested by centrifugation and resuspended in flow-cytometer buffer for assessed the phagocytosis by determining the percentage of cells labeled with PKH67 and CellTrace Violet (representative flow cytometry plots shown in Fig. 5).
  • Such double positive cells represent the PKH67-labeled THP-1 macrophage that have phagocytosed CellTrace Violet-labeled Daudi cells.
  • the combination of ALT-803 plus anti-CD38 Ab increased macrophage-mediated phagocytosis of tumor cells, as shown by an increase in the percentage of PKH67 + CellTrace Violet + cells (Fig.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Transplantation (AREA)
  • Cell Biology (AREA)
  • Endocrinology (AREA)
  • Biomedical Technology (AREA)
  • Oncology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicinal Preparation (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Peptides Or Proteins (AREA)
PCT/US2018/025366 2017-03-31 2018-03-30 Alt-803 in combination with anti-cd38 antibody for cancer therapies Ceased WO2018183821A1 (en)

Priority Applications (6)

Application Number Priority Date Filing Date Title
CA3058427A CA3058427C (en) 2017-03-31 2018-03-30 Alt-803 in combination with anti-cd38 antibody for cancer therapies
KR1020197032255A KR102748188B1 (ko) 2017-03-31 2018-03-30 암 치료를 위해 항-cd38 항체와 조합되는 alt-803
AU2018243550A AU2018243550B2 (en) 2017-03-31 2018-03-30 ALT-803 in combination with anti-CD38 antibody for cancer therapies
CN201880022531.7A CN110494449B (zh) 2017-03-31 2018-03-30 Alt-803与抗cd38抗体组合用于癌症治疗
EP18776459.2A EP3601363B1 (en) 2017-03-31 2018-03-30 Alt-803 in combination with anti-cd38 antibody for cancer therapies
JP2019553224A JP2020512361A (ja) 2017-03-31 2018-03-30 癌治療のために抗cd38抗体と併用したalt−803

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201762480339P 2017-03-31 2017-03-31
US62/480,339 2017-03-31
US15/937,493 US20190048055A1 (en) 2017-03-31 2018-03-27 Alt-803 in combination with anti-cd38 antibody for cancer therapies
US15/937,493 2018-03-27

Publications (1)

Publication Number Publication Date
WO2018183821A1 true WO2018183821A1 (en) 2018-10-04

Family

ID=63678335

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2018/025366 Ceased WO2018183821A1 (en) 2017-03-31 2018-03-30 Alt-803 in combination with anti-cd38 antibody for cancer therapies

Country Status (9)

Country Link
US (1) US20190048055A1 (https=)
EP (1) EP3601363B1 (https=)
JP (1) JP2020512361A (https=)
KR (1) KR102748188B1 (https=)
CN (1) CN110494449B (https=)
AU (1) AU2018243550B2 (https=)
CA (1) CA3058427C (https=)
TW (1) TW201841651A (https=)
WO (1) WO2018183821A1 (https=)

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20230034677A1 (en) * 2019-11-21 2023-02-02 INSERM (Institut National de la Santé et la Recherche (Médicale) Novel immunotherapies targeting pd-1 with anti-pd-1/il-15 immunocytokines
US12104178B2 (en) 2017-03-03 2024-10-01 Obsidian Therapeutics, Inc. DHFR tunable protein regulation
US12111318B2 (en) 2020-11-17 2024-10-08 Korea University Research And Business Foundation Method for treating cancer based on expression levels of translationally controlled tumor protein (TCTP)
WO2025074090A1 (en) 2023-10-03 2025-04-10 Celleron Therapeutics Limited Combination of cxd101 and an il-15 superagonist to treat proliferative diseases such as cancer

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10865230B2 (en) 2016-05-27 2020-12-15 Altor Bioscience, Llc Construction and characterization of multimeric IL-15-based molecules with CD3 binding domains
KR102867975B1 (ko) 2017-03-06 2025-10-14 알토 바이오사이언스 엘엘씨 Il-12 및 il-18로의 il-15-기반 융합
CN113293191A (zh) * 2021-05-28 2021-08-24 山东大学齐鲁医院 Gfp转染肿瘤细胞的方法在检测肿瘤相关巨噬细胞吞噬功能中的应用
WO2023178253A2 (en) * 2022-03-18 2023-09-21 Igm Biosciences, Inc. Use of a multimeric anti-pd-l1 binding molecule in combination with a monoclonal antibody therapy

Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US222A (en) 1837-06-10 Truss for the retention and radical cure qe hernia
US1975A (en) 1841-02-12 Manner of constructing corn-shellers
US8507A (en) 1851-11-11 petess
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
US5116964A (en) 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
WO1994004689A1 (en) 1992-08-14 1994-03-03 The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services Recombinant toxin with increased half-life
WO1994029350A2 (en) 1993-06-14 1994-12-22 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Recombinant disulfide-stabilized polypeptide fragments having binding specificity
US5541087A (en) 1994-09-14 1996-07-30 Fuji Immunopharmaceuticals Corporation Expression and export technology of proteins as immunofusins
WO1996032478A1 (en) 1995-04-14 1996-10-17 Genentech, Inc. Altered polypeptides with increased half-life
US5620939A (en) 1995-09-22 1997-04-15 The Goodyear Tire & Rubber Company Initiative system
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
WO2005046449A2 (en) 2003-11-10 2005-05-26 Altor Bioscience Corporation Soluble tcr molecules and methods of use
US7213961B2 (en) 2003-07-11 2007-05-08 Hubbell Incorporated Low voltage luminaire assembly
US20090148449A1 (en) 2005-03-23 2009-06-11 Genmab A/S Antibodies against cd38 for treatment of multiple myeloma
US20140205560A1 (en) 2010-09-21 2014-07-24 Altor Bioscience Corporation Multimeric il-15 soluble fusion molecules and methods of making and using same
WO2016004060A2 (en) 2014-06-30 2016-01-07 Altor Bioscience Corporation Il-15-based molecules and methods of use thereof

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20060057651A1 (en) * 2000-12-08 2006-03-16 Bowdish Katherine S Polypeptides and antibodies derived from chronic lymphocytic leukemia cells and uses thereof
US20130302274A1 (en) * 2011-11-25 2013-11-14 Roche Glycart Ag Combination therapy
US9682143B2 (en) * 2012-08-14 2017-06-20 Ibc Pharmaceuticals, Inc. Combination therapy for inducing immune response to disease
CN104379169A (zh) * 2012-08-14 2015-02-25 Ibc药品公司 用于治疗疾病的t-细胞重定向双特异性抗体
US20150359853A1 (en) * 2012-10-24 2015-12-17 Admune Therapeutics Llc Il-15r alpha forms, cells expressing il-15r alpha forms, and therapeutic uses of il-15r alpha and il-15/il-15r alpha complexes
EP4245376A3 (en) * 2014-10-14 2023-12-13 Novartis AG Antibody molecules to pd-l1 and uses thereof
EP3359157A4 (en) * 2015-10-06 2019-05-15 The Wistar Institute Of Anatomy And Biology METHOD AND COMPOSITIONS FOR THE TREATMENT OF METASTASIVE AND REFRACTORY CANCER DISEASES AND TUMORS

Patent Citations (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US222A (en) 1837-06-10 Truss for the retention and radical cure qe hernia
US1975A (en) 1841-02-12 Manner of constructing corn-shellers
US8507A (en) 1851-11-11 petess
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US5116964A (en) 1989-02-23 1992-05-26 Genentech, Inc. Hybrid immunoglobulins
EP0404097A2 (de) 1989-06-22 1990-12-27 BEHRINGWERKE Aktiengesellschaft Bispezifische und oligospezifische, mono- und oligovalente Rezeptoren, ihre Herstellung und Verwendung
WO1993011161A1 (en) 1991-11-25 1993-06-10 Enzon, Inc. Multivalent antigen-binding proteins
WO1994004689A1 (en) 1992-08-14 1994-03-03 The Government Of The United States Of America, As Represented By The Secretary Of The Department Of Health And Human Services Recombinant toxin with increased half-life
WO1994029350A2 (en) 1993-06-14 1994-12-22 The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services Recombinant disulfide-stabilized polypeptide fragments having binding specificity
US5541087A (en) 1994-09-14 1996-07-30 Fuji Immunopharmaceuticals Corporation Expression and export technology of proteins as immunofusins
WO1996032478A1 (en) 1995-04-14 1996-10-17 Genentech, Inc. Altered polypeptides with increased half-life
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US5620939A (en) 1995-09-22 1997-04-15 The Goodyear Tire & Rubber Company Initiative system
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
US7213961B2 (en) 2003-07-11 2007-05-08 Hubbell Incorporated Low voltage luminaire assembly
WO2005046449A2 (en) 2003-11-10 2005-05-26 Altor Bioscience Corporation Soluble tcr molecules and methods of use
US20090148449A1 (en) 2005-03-23 2009-06-11 Genmab A/S Antibodies against cd38 for treatment of multiple myeloma
US20140205560A1 (en) 2010-09-21 2014-07-24 Altor Bioscience Corporation Multimeric il-15 soluble fusion molecules and methods of making and using same
WO2016004060A2 (en) 2014-06-30 2016-01-07 Altor Bioscience Corporation Il-15-based molecules and methods of use thereof

Non-Patent Citations (63)

* Cited by examiner, † Cited by third party
Title
"Chimeric Toxins", OLSNES AND PHIL, PHARMAC. THER., vol. 25, 1982, pages 355
"Encyclopedia of Pharmaceutical Technology", 1988, MARCEL DEKKER
AUSUBEL ET AL.: "Current Protocol in Molecular Biology", 1997, JOHN WILEY AND SONS
AUSUBEL, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, 1987
BENTONDAVIS, SCIENCE, vol. 196, 1977, pages 180
CAPON ET AL., NATURE, vol. 337, 1989, pages 525 - 531
CHAMOW ET AL., TRENDS BIOTECHNOL., vol. 14, 1996, pages 52 - 60
CHIRIFU ET AL., NAT IMMUNOL, vol. 8, 2007, pages 1001 - 1007
CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
COLIGAN, CURRENT PROTOCOLS IN IMMUNOLOGY, 1991
ELLISON ET AL., NUCLEIC ACIDS RES., vol. 10, 1982, pages 4071 - 9
FELICES M ET AL., GYNECOLOGIC ONCOLOGY, vol. 145, no. 3, 2017, pages 453 - 461
FELICES, M ET AL.: "IL -15 super-agonist (ALT-803) enhances natural killer (NK) cell function against ovarian cancer", GYNECOLOGIC ONCOLOGY, vol. 145, no. 3, 22 February 2017 (2017-02-22), pages 453 - 461, XP085039603 *
FRESHNEY, ANIMAL CELL CULTURE, 1987
GAIT, OLIGONUCLEOTIDE SYNTHESIS, 1984
GALFREMILSTEIN, METH. ENZYMOL., vol. 73, no. B, 1981, pages 3
GOLAY ET AL., BLOOD, vol. 122, 2013, pages 3482 - 91
GRAHAM ET AL., J GEN. VIROL., vol. 36, 1977, pages 59
GRUNSTEINHOGNESS, PROC. NATL. ACAD. SCI.
HALEMARHAM, THE HARPER COLLINS DICTIONARY OF BIOLOGY, 1991
HAN ET AL., CYTOKINE, vol. 56, 2011, pages 804 - 810
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HONNEGER, A.PLUNKTHUN, A., J. MOL. BIOL., vol. 309, 2001, pages 657 - 670
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
KIM PS ET AL., ONCOTARGET, vol. 7, no. 13, 2016, pages 16130 - 16145
KOHLER ET AL., NATURE, vol. 256, 1975, pages 495
LAWRENCIA ET AL., GENE THER, vol. 8, 2001, pages 760 - 8
LEFRANC, M.P. ET AL., NUCL. ACIDS RES., vol. 27, 1999, pages 209 - 212
LIU B ET AL., JOURNAL OF BIOLOGIC CHEMISTRY, vol. 291, no. 46, 2016, pages 23869 - 23881
LIU, B ET AL.: "A Novel Fusion of ALT-803 ( IL -15 Superagonist) with an Antibody Demonstrates Antigen-specific Antitumor Responses", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 291, no. 46, 20 September 2016 (2016-09-20), pages 23869 - 23881, XP055501329 *
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
MEANS, G. E.FEENEY, R. E., CHEMICAL MODIFICATION OF PROTEINS, 1974
MILLERCALOS, GENE TRANSFER VECTORS FOR MAMMALIAN CELLS, 1987
MORRISON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 81, 1984, pages 6851 - 6855
MOSKAUG ET AL., J. BIOL. CHEM., vol. 264, 1989, pages 15709
MULLIS, PCR: THE POLYMERASE CHAIN REACTION, vol. 113, 1994, pages 269 - 315
NG ET AL., METHODS ENZYMOL, vol. 391, 2005, pages 304 - 13
NOGAWA ET AL., J CLIN INVEST, vol. 115, 2005, pages 978 - 85
OCHOA MC ET AL., IMMUNOLOGY AND CELL BIOLOGY, vol. 95, no. 4, 2017, pages 347 - 355
P. H. POUWELS ET AL.: "Cloning Vectors: A Laboratory Manual", 1985
PASTAN ET AL.: "Recombinant Toxins as Novel Therapeutic Agents", ANN. REV. BIOCHEM., vol. 61, 1992, pages 331, XP000431273, DOI: 10.1146/annurev.bi.61.070192.001555
PASTAN, I. ET AL., CELL, vol. 47, 1986, pages 641
PRESTA, CURR. OP. STRUCT. BIOL., vol. 2, 1992, pages 593 - 596
REICHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327
REMINGTON: "The Science and Practice of Pharmacy", 2000, LIPPINCOTT WILLIAMS & WILKINS
RICHARDS ET AL., MOL CANCER THER, vol. 7, 2008, pages 2517 - 27
RUIZ, M., NUCL. ACIDS RES., vol. 28, 2000, pages 219 - 221
SAMBROOK: "Molecular Cloning: A Laboratory Manual", 1989
SCATCHARD ET AL., ANN. N. Y. ACAD. SCI. USA, vol. 51, 1949, pages 660
TREVISANI ET AL., J PHARMACOL EXP THER, vol. 309, 2004, pages 1167 - 73
TREVISANI ET AL., NAT NEUROSCI, vol. 5, 2002, pages 546 - 51
TYAGI ET AL., J UROL, vol. 171, 2004, pages 483 - 9
URLAUBCHASM, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536
WAHL, G. M.S. L. BERGER, METHODS ENZYMOL., vol. 152, 1987, pages 507
WALDMANN, T A, NATURE REV. IMMUNOL., vol. 6, 2006, pages 595 - 601
WEIR: "Handbook of Experimental Immunology", 1996, article "Methods in Enzymology"
WHITLOW, M. ET AL., METHODS: A COMPANION TO METHODS IN ENZYMOLOGY, vol. 2, 1991, pages 97 - 105
WONG ET AL., ONCOLMMUNOLOGY, vol. 2, 2013, pages e26442
XU ET AL., CANCER RES., vol. 73, 2013, pages 3075 - 86
ZAPATA ET AL., PROTEIN ENG, vol. 8, no. 10, 1995, pages 1057 - 1062
ZHU ET AL., J IMMUNOL, vol. 183, 2009, pages 3598 - 3607

Cited By (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12104178B2 (en) 2017-03-03 2024-10-01 Obsidian Therapeutics, Inc. DHFR tunable protein regulation
US20230034677A1 (en) * 2019-11-21 2023-02-02 INSERM (Institut National de la Santé et la Recherche (Médicale) Novel immunotherapies targeting pd-1 with anti-pd-1/il-15 immunocytokines
US12111318B2 (en) 2020-11-17 2024-10-08 Korea University Research And Business Foundation Method for treating cancer based on expression levels of translationally controlled tumor protein (TCTP)
WO2025074090A1 (en) 2023-10-03 2025-04-10 Celleron Therapeutics Limited Combination of cxd101 and an il-15 superagonist to treat proliferative diseases such as cancer

Also Published As

Publication number Publication date
EP3601363B1 (en) 2022-06-15
TW201841651A (zh) 2018-12-01
CN110494449B (zh) 2024-03-26
US20190048055A1 (en) 2019-02-14
CN110494449A (zh) 2019-11-22
KR20190135036A (ko) 2019-12-05
CA3058427C (en) 2023-01-24
KR102748188B1 (ko) 2025-01-03
EP3601363A4 (en) 2020-07-29
JP2020512361A (ja) 2020-04-23
AU2018243550A1 (en) 2019-10-17
CA3058427A1 (en) 2018-10-04
EP3601363A1 (en) 2020-02-05
AU2018243550B2 (en) 2020-09-03

Similar Documents

Publication Publication Date Title
US12371502B2 (en) Antibodies directed against CD127
US12268731B2 (en) Compositions comprising IL-15N72D-based molecules and bacillus calmette-guerin (BCG)
AU2018243550B2 (en) ALT-803 in combination with anti-CD38 antibody for cancer therapies
JP7492336B2 (ja) 多量体il-15に基づく分子
US20170088597A1 (en) Interleukin-15 superagonist significantly enhances graft-versus-tumor activity
OA20097A (en) Antibodies directed against CD127.

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18776459

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3058427

Country of ref document: CA

Ref document number: 2019553224

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018243550

Country of ref document: AU

Date of ref document: 20180330

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20197032255

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2018776459

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2018776459

Country of ref document: EP

Effective date: 20191031