WO2018136803A1 - Apoc-ii mimetic peptides - Google Patents
Apoc-ii mimetic peptides Download PDFInfo
- Publication number
- WO2018136803A1 WO2018136803A1 PCT/US2018/014532 US2018014532W WO2018136803A1 WO 2018136803 A1 WO2018136803 A1 WO 2018136803A1 US 2018014532 W US2018014532 W US 2018014532W WO 2018136803 A1 WO2018136803 A1 WO 2018136803A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- peptide
- apoc
- helix
- amino acid
- fatty acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/775—Apolipopeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- A61K38/1722—Plasma globulins, lactoglobulins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/53—Hinge
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/41—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a Myc-tag
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/40—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation
- C07K2319/42—Fusion polypeptide containing a tag for immunodetection, or an epitope for immunisation containing a HA(hemagglutinin)-tag
Definitions
- the amino acid substitution is at position 56.
- the serine at position 56 is substituted by a phenylalanine.
- the serine at position 56 is substituted by a lysine.
- the serine at position 56 is substituted by an alanine.
- the serine at position 56 is substituted by an aminoisobutyric acid.
- the amino acid substitution is at position 57. In some of these embodiments, the threonine at position 57 is substituted by a phenylalanine.
- the helix 3 of apoC-II is elongated by 4 amino acids at the C-terminus.
- the helix 3 of apoC- ⁇ is elongated by amino acids lysine, glycine, glutamic acid, and glutamic acid from N-terminus to C-terminus.
- the variant of helix 3 of apoC- ⁇ comprises at least one chemical modification.
- the chemical modification is a covalent linkage of a fatty acid.
- the fatty acid comprises 4 to 26 carbons.
- the fatty acid comprises 10 carbons.
- the fatty acid comprises 12 carbons.
- the fatty acid comprises 14 carbons.
- the fatty acid comprises 16 carbons.
- the fatty acid comprises 18 carbons.
- the fatty acid comprises 20 carbons.
- the fatty acid is saturated. In some other embodiments, the fatty acid is unsaturated.
- FIG. 2A and FIG. 2B present helical wheel plots of amino acid residues 40-57 of native apoC- ⁇ and a variant Delta4', with FIG. 2A representing the native apoC-II and FIG. 2B representing the variant, Delta4'.
- the size and color of balls indicate the degree of charge and hydrophobicity.
- the first number in the center of the helical wheel indicates hydrophobic moment.
- the second number in the center of the helical wheel and the arrow indicate the angle of hydrophobic moment.
- FIG. 3A and FIG. 3B present helical wheel plots of amino acid residues 40-57 of native apoC- ⁇ and a variant Delta5', with FIG. 3 A representing the native apoC-II and FIG. 3B representing the variant, Delta5' .
- FIG. 5 shows examples of chemical modification of the variant Delta4' .
- Mono-acyl- Delta4' includes a stearic acid modified N-terminus.
- Di-acyl-Delta4' includes a stearic acid modified N-terminus and a stearic acid modified leucine residue at position 49.
- LPL lipoprotein lipase
- GenBank NCBI accession number for human LPL protein is NP 000228.
- the term "pharmaceutically acceptable carrier” refers to any of the standard pharmaceutical carriers including, but not limited to, phosphate buffered saline solution, water, emulsions (e.g., such as an oil/water or water/oil emulsions), glycerol, liquid polyethylene glycols, aprotic solvents such as dimethylsufoxide, N-methtylpyrrolidone and mixtures thereof, and various types of wetting agents, solubilizing agents, anti -oxidants, bulking agents, protein carriers such as albumins, any and all solvents, dispersion media, coatings, sodium lauryl sulfate, isotonic and absorption delaying agents, disintegrants (e.g., potato starch or sodium starch glycolate), and the like.
- phosphate buffered saline solution water
- emulsions e.g., such as an oil/water or water/oil emulsions
- glycerol liquid
- the variant of helix 2 of apoC- ⁇ comprises an aspartic acid at position 40, a tyrosine at position 41, a leucine at position 42, a lysine at position 43, and an alanine at position 44.
- the amino acid substitution is at position 50.
- the arginine at position 50 is substituted by a lysine.
- the amino acid substitution is at position 54.
- the serine at position 54 is substituted by a glutamic acid.
- the amino acid substitution is at position 57.
- the threonine at position 57 is substituted by a phenylalanine.
- the hinge region comprises a natural amino acid. In some embodiments, the hinge region comprises an unnatural amino acid. In some embodiments, the hinge region comprises an amino acid analog.
- the helix 3 of apoC- ⁇ is elongated by 3 amino acids at the C-terminus. In certain embodiments, the helix 3 of apoC- ⁇ is elongated by 4 amino acids at the C-terminus. In certain embodiments, the helix 3 of apoC- ⁇ is elongated by 5 amino acids at the C-terminus. In certain embodiments, the helix 3 of apoC- II is elongated by 6 amino acids at the C-terminus. In certain embodiments, the helix 3 of apoC-II is elongated by 7 amino acids at the C-terminus. In certain embodiments, the helix 3 of apoC-II is elongated by 8 amino acids at the C-terminus. In certain embodiments, the helix 3 of apoC-II is elongated by the helix
- the second domain is modified by replacement of one or more side groups with other side groups such as alkyl, lower alkyl, cyclic 4-, 5-, 6-, to 7-membered alkyl, amide, amide lower alkyl, amide di(lower alkyl), lower alkoxy, hydroxy, carboxy and the lower ester derivatives thereof, and with 4-, 5-, 6-, to 7- membered heterocyclics.
- side groups such as alkyl, lower alkyl, cyclic 4-, 5-, 6-, to 7-membered alkyl, amide, amide lower alkyl, amide di(lower alkyl), lower alkoxy, hydroxy, carboxy and the lower ester derivatives thereof, and with 4-, 5-, 6-, to 7- membered heterocyclics.
- proline analogs can be made in which the ring size of the proline residue is changed from a 5-membered ring to a 4-, 6-, or 7-membered ring.
- Cyclic groups can be saturated or
- the variant of helix 3 of apoC- ⁇ is no more than 40 amino acids, such as no more than 30 amino acids, or no more than 20 amino acids.
- the variant of helix 3 of apoC- ⁇ comprises modifications of the native helix 3 of apoC-II.
- the modifications include elongations, truncations, mutations, and chemical modifications. 1.1.4.1. Elongation of Helix 3 of ApoC-II
- the helix 3 of apoC- ⁇ is elongated by 8 amino acids at the C-terminus. In certain embodiments, the helix 3 of apoC- ⁇ is elongated by 9 amino acids at the C-terminus. In certain embodiments, the helix 3 of apoC- ⁇ is elongated by 10 amino acids at the C-terminus.
- the isolated apoC- ⁇ mimetic peptide comprises a stearic acid covalently linked to the side group of the lysine residue.
- the isolated apoC- ⁇ mimetic peptide comprises a lysine at position 60
- the stearic acid is covalently linked to the lysine residue.
- the isolated apoC-II mimetic peptide comprises a lysine at position 76
- the stearic acid is covalently linked to the lysine residue.
- the isolated apoC- ⁇ mimetic peptide is produced recombinantly, for example using bacterial, yeast, or eukaryotic expression systems.
- Bodanszky M. and Bodanszky, A., The Practice of Peptide Synthesis, Springer Verlag, New York, 1994; and by Jones, J., Amino Acid and Peptide Synthesis, 2nd ed., Oxford University Press, 2002.
- the Bodanszky and Jones references detail the parameters and techniques for activating and coupling amino acids and amino acid derivatives. Moreover, the references teach how to select, use and remove various useful functional and protecting groups.
- the isolated apoC- ⁇ mimetic peptide further comprises a purification tag.
- the purification tag is a polyhistidine-tag, a myc-tag, or an HA-tag.
- the LPL deficiency is caused by a mutation is the LPL gene.
- the mutation leads to reduced LPL enzyme activity.
- the mutation leads to absent LPL enzyme activity.
- the treatment can consist of a single dose or a plurality of doses over a period of time.
- Tyloxapol is a nonionic detergent that inhibits LPL and hence clearance of
- the mature form of human apoC-II consists of 79 amino acid residues.
- the secondary structure of apoC-II has been determined by various measures, with residues 17-38 designated as helix 1, residues 45-57 designated as helix 2, and residues 65-74/75 designated as helix 3 (Zdunek et al., Biochemistry 42: 1872-1889, 2003).
- the C-terminal one-third of apoC-II, which is needed for activation of LPL, is more conserved between different species than the N-terminal two thirds of apoC- ⁇ , which is needed for lipid binding (Shen et al., Gene 254: 189-198, 2000).
- the homology of amino acid residues 40-58 of mature human apoC-II protein across various species is shown on FIG. 1.
- LPL assay using Intralipid as substrate confirmed that all apoC- ⁇ mimetic peptide tested were capable of promoting TG hydrolysis in the presence of LPL.
- the apoC- ⁇ mimetic peptides Delta4 and Delta5 worked more efficiently than the native apoC-II protein at concentrations of between about 1 nM to about 10 ⁇ (FIG. 7).
- C2thirdhelixStearylposl7 comprise a stearic acid modification of C2thirdhelix at different amino acid residues.
- Delta6 peptide and its variants Delta6L, Delta6PV, and Delta6PL activated LPL in vitro when hypertriglyceridemia patient sera were used as substrate.
- the triglyceride concentrations of the patient sera ranged from about 1000 mg/dL to about 1700 mg/dL.
- DKVKEFLSEYWEKAKEFAPAVSTYTGIFTDOVLSVLKGEE (SEQ ID NO: 55), with the amino acid substitutions to helix 1 of apoC-II underlined.
- the Deltal3-31-PV peptide promoted TG hydrolysis in vitro in a dose-dependent manner (FIG. 52).
- ApoC-II is a cofactor for lipoprotein lipase, an enzyme that hydrolyzes triglycerides.
- ApoC- ⁇ deficiency results in hypertriglyceridemia in human subjects.
- Sakurai et al. J Pharmacol Exp Ther 356:341-353, 2016, we created apoC- ⁇ knockout mice that had high plasma TG.
- Post-prandial hypertriglyceridemia is an important cardiovascular disease (CVD) risk factor.
- CVD cardiovascular disease
- apoC-II-a apoC- ⁇ mimetic peptide
- LPL lipid-binding protein
- serum TG serum TG in apoC-II-KO mice.
- apoC-II-a apoC-II-a as a therapy for postprandial hypertriglyceridemia, we investigated its effect on several mouse models after a fat challenge test.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Diabetes (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Zoology (AREA)
- Hematology (AREA)
- Obesity (AREA)
- Molecular Biology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Biochemistry (AREA)
- Toxicology (AREA)
- Epidemiology (AREA)
- Immunology (AREA)
- Marine Sciences & Fisheries (AREA)
- Heart & Thoracic Surgery (AREA)
- Child & Adolescent Psychology (AREA)
- Cardiology (AREA)
- Emergency Medicine (AREA)
- Endocrinology (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EA201991491A EA201991491A1 (ru) | 2017-03-24 | 2018-01-19 | Миметические пептиды apoc-ii |
| IL268093A IL268093B2 (en) | 2017-01-19 | 2018-01-19 | Apoc-ii mimetic peptides |
| KR1020197024024A KR102700862B1 (ko) | 2017-01-19 | 2018-01-19 | apoC-II 모방 펩타이드 |
| EP18742118.5A EP3571216A4 (en) | 2017-01-19 | 2018-01-19 | APOC-II MIMETIC PEPTIDES |
| CA3050106A CA3050106A1 (en) | 2017-01-19 | 2018-01-19 | Apoc-ii mimetic peptides |
| SG11201906422VA SG11201906422VA (en) | 2017-01-19 | 2018-01-19 | Apoc-ii mimetic peptides |
| US16/479,183 US11136372B2 (en) | 2017-01-19 | 2018-01-19 | ApoC-II mimetic peptides |
| MX2019008529A MX2019008529A (es) | 2017-01-19 | 2018-01-19 | Peptidos mimeticos de apolipoproteina c-ii (apoc-ii). |
| CN201880019604.7A CN110831957B (zh) | 2017-01-19 | 2018-01-19 | Apoc-ii模拟肽 |
| NZ755599A NZ755599A (en) | 2017-01-19 | 2018-01-19 | Apoc-ii mimetic peptides |
| AU2018210404A AU2018210404B2 (en) | 2017-01-19 | 2018-01-19 | ApoC-II mimetic peptides |
| BR112019014707A BR112019014707A2 (pt) | 2017-01-19 | 2018-01-19 | peptídeo mimético apoc-ii isolado, composição farmacêutica, e, métodos para tratar hipertrigliceridemia e para fabricar o peptídeo. |
| JP2019539809A JP7353973B2 (ja) | 2017-01-19 | 2018-01-19 | Apoc-ii模倣ペプチド |
| IL279831A IL279831A (en) | 2017-01-19 | 2020-12-29 | APOC-II mimic peptides |
| US17/195,766 US11827690B2 (en) | 2017-01-19 | 2021-03-09 | ApoC-II mimetic peptides |
| JP2023100171A JP2023116739A (ja) | 2017-01-19 | 2023-06-19 | Apoc-ii模倣ペプチド |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762448358P | 2017-01-19 | 2017-01-19 | |
| US62/448,358 | 2017-01-19 | ||
| US201762476535P | 2017-03-24 | 2017-03-24 | |
| US201762476531P | 2017-03-24 | 2017-03-24 | |
| US62/476,531 | 2017-03-24 | ||
| US62/476,535 | 2017-03-24 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/479,183 A-371-Of-International US11136372B2 (en) | 2017-01-19 | 2018-01-19 | ApoC-II mimetic peptides |
| US17/195,766 Continuation US11827690B2 (en) | 2017-01-19 | 2021-03-09 | ApoC-II mimetic peptides |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2018136803A1 true WO2018136803A1 (en) | 2018-07-26 |
| WO2018136803A8 WO2018136803A8 (en) | 2019-08-01 |
Family
ID=62908746
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/014532 Ceased WO2018136803A1 (en) | 2017-01-19 | 2018-01-19 | Apoc-ii mimetic peptides |
Country Status (14)
| Country | Link |
|---|---|
| US (2) | US11136372B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3571216A4 (cg-RX-API-DMAC7.html) |
| JP (2) | JP7353973B2 (cg-RX-API-DMAC7.html) |
| KR (1) | KR102700862B1 (cg-RX-API-DMAC7.html) |
| CN (1) | CN110831957B (cg-RX-API-DMAC7.html) |
| AU (1) | AU2018210404B2 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112019014707A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3050106A1 (cg-RX-API-DMAC7.html) |
| IL (2) | IL268093B2 (cg-RX-API-DMAC7.html) |
| MX (1) | MX2019008529A (cg-RX-API-DMAC7.html) |
| NZ (1) | NZ755599A (cg-RX-API-DMAC7.html) |
| SG (2) | SG10201911974UA (cg-RX-API-DMAC7.html) |
| TW (2) | TW202130652A (cg-RX-API-DMAC7.html) |
| WO (1) | WO2018136803A1 (cg-RX-API-DMAC7.html) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022271814A3 (en) * | 2021-06-23 | 2023-01-26 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Short apoc-ii mimetic peptides and methods of use |
| WO2023215838A1 (en) * | 2022-05-05 | 2023-11-09 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Short apolipoprotein e mimetic peptides and methods of use |
| US20240043499A1 (en) * | 2022-08-07 | 2024-02-08 | Protean Bio, Inc. | Peptides for beta-cell survival and insulin production |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| TW202130652A (zh) | 2017-01-19 | 2021-08-16 | 美國衛生與公眾服務部 | Apoc-ii擬肽 |
Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US20100016173A1 (en) * | 2008-01-30 | 2010-01-21 | Proteogenix, Inc. | Maternal serum biomarkers for detection of pre-eclampsia |
| US20110033518A1 (en) * | 2008-04-15 | 2011-02-10 | Remaley Alan T | Peptides promoting lipid efflux via abca1 and activating a lipoprotein lipase |
| US8119590B2 (en) * | 2001-09-28 | 2012-02-21 | Cedars-Sinai Medical Center | Prevention and treatment of restenosis by local administration of drug |
Family Cites Families (12)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6156727A (en) * | 1996-09-05 | 2000-12-05 | Uab Research Foundation | Anti-atherosclerotic peptides and a transgenic mouse model of antherosclerosis |
| US7220576B2 (en) * | 2002-01-07 | 2007-05-22 | Lifesensors, Inc. | Methods and compositions for protein expression and purification |
| AU2004207444B2 (en) * | 2003-01-17 | 2008-07-31 | Merck & Co., Inc. | N-cyclohexylaminocarbonyl benzenesulfonamide derivatives |
| CA2549529A1 (en) * | 2003-12-15 | 2005-06-30 | The Regents Of The University Of California | Helical synthetic peptides that stimulate cellular cholesterol efflux |
| CN100567270C (zh) * | 2004-02-19 | 2009-12-09 | 万有制药株式会社 | 磺酰胺衍生物 |
| KR101185609B1 (ko) * | 2004-07-16 | 2012-09-24 | 트러스티즈 오브 터프츠 칼리지 | 아포리포단백질 a1 미메틱 및 이의 용도 |
| AU2006263332B2 (en) * | 2005-06-29 | 2012-02-23 | Hadasit Medical Research Services & Development Ltd. | Protein kinase C inhibitors for prevention of insulin resistance and type 2 diabetes |
| WO2008039843A2 (en) * | 2006-09-26 | 2008-04-03 | Lipid Sciences, Inc. | Novel peptides that promote lipid efflux |
| US20120270771A1 (en) | 2009-09-30 | 2012-10-25 | Snu R&Db Foundation | Apolipoprotein a-1 mimic peptides, and therapeutic agent for treating hyperlipidemia and diseases related to hyperlipidemia comprising same |
| ES2859559T3 (es) * | 2012-11-06 | 2021-10-04 | Les Hopitaux Univ De Geneve | Péptidos miméticos |
| TW202130652A (zh) | 2017-01-19 | 2021-08-16 | 美國衛生與公眾服務部 | Apoc-ii擬肽 |
| EA201991491A1 (ru) | 2017-03-24 | 2019-12-30 | Дзе Юнайтед Стейтс Оф Америка, Эз Репрезентед Бай Дзе Секретари, Департмент Оф Хелс Энд Хьюман Сервисис | Миметические пептиды apoc-ii |
-
2018
- 2018-01-19 TW TW109138699A patent/TW202130652A/zh unknown
- 2018-01-19 TW TW107102123A patent/TWI788323B/zh active
- 2018-01-19 SG SG10201911974UA patent/SG10201911974UA/en unknown
- 2018-01-19 MX MX2019008529A patent/MX2019008529A/es unknown
- 2018-01-19 KR KR1020197024024A patent/KR102700862B1/ko active Active
- 2018-01-19 IL IL268093A patent/IL268093B2/en unknown
- 2018-01-19 US US16/479,183 patent/US11136372B2/en active Active
- 2018-01-19 AU AU2018210404A patent/AU2018210404B2/en active Active
- 2018-01-19 CN CN201880019604.7A patent/CN110831957B/zh active Active
- 2018-01-19 NZ NZ755599A patent/NZ755599A/en unknown
- 2018-01-19 CA CA3050106A patent/CA3050106A1/en active Pending
- 2018-01-19 JP JP2019539809A patent/JP7353973B2/ja active Active
- 2018-01-19 SG SG11201906422VA patent/SG11201906422VA/en unknown
- 2018-01-19 WO PCT/US2018/014532 patent/WO2018136803A1/en not_active Ceased
- 2018-01-19 BR BR112019014707A patent/BR112019014707A2/pt unknown
- 2018-01-19 EP EP18742118.5A patent/EP3571216A4/en active Pending
-
2020
- 2020-12-29 IL IL279831A patent/IL279831A/en unknown
-
2021
- 2021-03-09 US US17/195,766 patent/US11827690B2/en active Active
-
2023
- 2023-06-19 JP JP2023100171A patent/JP2023116739A/ja active Pending
Patent Citations (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4301144A (en) | 1979-07-11 | 1981-11-17 | Ajinomoto Company, Incorporated | Blood substitute containing modified hemoglobin |
| US4640835A (en) | 1981-10-30 | 1987-02-03 | Nippon Chemiphar Company, Ltd. | Plasminogen activator derivatives |
| US4496689A (en) | 1983-12-27 | 1985-01-29 | Miles Laboratories, Inc. | Covalently attached complex of alpha-1-proteinase inhibitor with a water soluble polymer |
| US4670417A (en) | 1985-06-19 | 1987-06-02 | Ajinomoto Co., Inc. | Hemoglobin combined with a poly(alkylene oxide) |
| US4791192A (en) | 1986-06-26 | 1988-12-13 | Takeda Chemical Industries, Ltd. | Chemically modified protein with polyethyleneglycol |
| US8119590B2 (en) * | 2001-09-28 | 2012-02-21 | Cedars-Sinai Medical Center | Prevention and treatment of restenosis by local administration of drug |
| US20100016173A1 (en) * | 2008-01-30 | 2010-01-21 | Proteogenix, Inc. | Maternal serum biomarkers for detection of pre-eclampsia |
| US20110033518A1 (en) * | 2008-04-15 | 2011-02-10 | Remaley Alan T | Peptides promoting lipid efflux via abca1 and activating a lipoprotein lipase |
Non-Patent Citations (42)
| Title |
|---|
| "NCBI", Database accession no. NP 000228 |
| ABE C. ET AL., J. NUTR., vol. 137, 2007, pages 345 - 350 |
| ANDERSON ET AL., PANCREATOLOGY, vol. 9, 2009, pages 252 - 257 |
| BACA ET AL., J. AM. CHEM. SOC., vol. 117, 1995, pages 1881 - 1887 |
| BERGLUND ET AL., J. CLIN. ENDOCRINOL. METAB., vol. 97, 2012, pages 2969 - 2989 |
| BODANSZKY, M.BODANSZKY, A.: "The Practice of Peptide Synthesis", 1994, SPRINGER VERLAG |
| BRECKENRIDGE ET AL., N ENGL J MED., vol. 298, 1978, pages 1265 - 1273 |
| BROUILLETTE ET AL., BIOCHEM. BIOPHYS. ACTA, vol. 1256, 1995, pages 103 - 129 |
| BUDOFF, AM J CARDIOL, vol. 118, 2016, pages 138 - 45 |
| DOMINGUEZ-MUNOZ ET AL., INT. J. PANCREATOL., vol. 10, 1991, pages 261 - 267 |
| EISENBERG ET AL., FARADAY SYMP. CHEM. SOC., vol. 17, 1982, pages 109 - 120 |
| EISENBERG ET AL., J. MAL. BIOL., vol. 179, 1984, pages 125 - 142 |
| EISENBERG ET AL., PNAS, vol. 81, 1984, pages 140 - 144 |
| FOJO ET AL., J. INTERN. MED., vol. 231, 1992, pages 669 - 677 |
| JONES, J.: "Amino Acid and Peptide Synthesis", 2002, OXFORD UNIVERSITY PRESS |
| KRITCHEVSKY, NUTRITIONAL BIOCHEMISTRY, vol. 6, 1995, pages 172 - 178 |
| KUSMINSKI C. ET AL., NATURE MEDICINE., vol. 18, 2012, pages 1539 - 1549 |
| KUSMINSKI ET AL., NATURE MEDICINE, vol. 18, 2012, pages 1539 - 1549 |
| LIU ET AL., TETRAHEDRON LETT., vol. 37, 1996, pages 933 - 936 |
| LIUTAM, J. AM. CHEM. SOC., vol. 116, 1994, pages 4149 - 4153 |
| LIUTAM, PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 6584 - 6588 |
| MAHADERO ET AL., AMERICAN J SURGERY, vol. 164, 1992, pages 45 - 50 |
| MAHADERO G. ET AL., AMERICAN J SURGERY., vol. 164, 1992, pages 45 - 50 |
| MARTIN: "Remington's Pharmaceutical Sciences", 2005, MACK PUBL. CO. |
| MISHRA ET AL., J. BIOL. CHEM., vol. 269, 1994, pages 7185 - 7191 |
| MISHRA ET AL., J. BIOL. CHEM., vol. 270, 1995, pages 1602 - 1611 |
| NAKAGAWA ET AL., J. AM. CHEM. SOC., vol. 107, 1985, pages 7087 - 7092 |
| QU ET AL., J. LIPID RES., vol. 48, 2007, pages 1476 - 1487 |
| RASOULI M. ET AL., J CLIN. DIAGN. RESEARCH., vol. 10, 2016, pages BF01 - BF05 |
| SAKURAI ET AL., J PHARMACOL EXP THER, vol. 356, 2016, pages 341 - 353 |
| SCHNOLZERKENT, SCIENCE, vol. 256, 1992, pages 221 - 225 |
| See also references of EP3571216A4 |
| SHEN ET AL., GENE, vol. 254, 2000, pages 189 - 198 |
| TAM ET AL., INT. J. PEPTIDE PROTEIN RES., vol. 45, 1995, pages 209 - 216 |
| TUZCU ET AL., DRUG CHEM TOXICOL, vol. 37, 2014, pages 261 - 267 |
| TUZCU K. ET AL., DRUG CHEM TOXICOL., vol. 37, 2014, pages 261 - 267 |
| VENKATACHALAPATHI ET AL., PROTEIN: STRUCTURE, FUNCTION AND GENETICS, vol. 15, 1993, pages 349 - 359 |
| VILJOENWIERZBICKI, EXPERT REV CARDIOVASC THER, vol. 10, 2012, pages 505 - 514 |
| YAMASHIROLI, INT. J. PEPTIDE PROTEIN RES., vol. 31, 1988, pages 322 - 334 |
| YANCEY ET AL., BIOCHEM., vol. 34, 1995, pages 7955 - 7965 |
| ZDUNEK ET AL., BIOCHEMISTRY, vol. 42, 2003, pages 1872 - 1889 |
| ZHANG Y.L. ET AL., JBIOL CHEM., vol. 279, 2004, pages 19362 - 19374 |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2022271814A3 (en) * | 2021-06-23 | 2023-01-26 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Short apoc-ii mimetic peptides and methods of use |
| WO2023215838A1 (en) * | 2022-05-05 | 2023-11-09 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Short apolipoprotein e mimetic peptides and methods of use |
| US20240043499A1 (en) * | 2022-08-07 | 2024-02-08 | Protean Bio, Inc. | Peptides for beta-cell survival and insulin production |
| WO2024036145A1 (en) * | 2022-08-07 | 2024-02-15 | Protean Bio, Inc. | Peptides for beta-cell survival and insulin production |
Also Published As
| Publication number | Publication date |
|---|---|
| IL268093B2 (en) | 2024-07-01 |
| IL268093A (en) | 2019-09-26 |
| BR112019014707A2 (pt) | 2020-04-07 |
| SG10201911974UA (en) | 2020-02-27 |
| US11136372B2 (en) | 2021-10-05 |
| CN110831957B (zh) | 2024-02-09 |
| JP2020511425A (ja) | 2020-04-16 |
| SG11201906422VA (en) | 2019-08-27 |
| TW201835097A (zh) | 2018-10-01 |
| IL268093B1 (en) | 2024-03-01 |
| US20210324043A1 (en) | 2021-10-21 |
| EP3571216A4 (en) | 2020-11-04 |
| JP7353973B2 (ja) | 2023-10-02 |
| CN110831957A (zh) | 2020-02-21 |
| AU2018210404A1 (en) | 2019-08-08 |
| US20200140522A1 (en) | 2020-05-07 |
| WO2018136803A8 (en) | 2019-08-01 |
| US11827690B2 (en) | 2023-11-28 |
| TWI788323B (zh) | 2023-01-01 |
| IL279831A (en) | 2021-03-01 |
| KR102700862B1 (ko) | 2024-08-30 |
| NZ755599A (en) | 2022-12-23 |
| CA3050106A1 (en) | 2018-07-26 |
| EP3571216A1 (en) | 2019-11-27 |
| MX2019008529A (es) | 2020-02-07 |
| JP2023116739A (ja) | 2023-08-22 |
| TW202130652A (zh) | 2021-08-16 |
| KR20190121305A (ko) | 2019-10-25 |
| AU2018210404B2 (en) | 2022-01-27 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11827690B2 (en) | ApoC-II mimetic peptides | |
| CN107074923B (zh) | Apoe模拟肽及对清除血浆胆固醇的较高效力 | |
| US10358465B2 (en) | SP-B and SP-C peptides, synthetic lung surfactants, and use thereof | |
| JP2019089834A (ja) | アポリポタンパク質模倣体及びその使用 | |
| JP2007534612A (ja) | 高コレステロール血症の治療のためのコレステロール逆輸送メディエータ | |
| KR19990022716A (ko) | 골 자극 인자 | |
| CN117580857A (zh) | Apoc-ii短模拟肽及使用方法 | |
| EA042134B1 (ru) | МИМЕТИЧЕСКИЕ ПЕПТИДЫ apoC-II | |
| EP2864353B1 (en) | Selective cartilage therapy | |
| US20170305981A1 (en) | Synthetic peptides | |
| HK1242718A1 (en) | Apoe mimetic peptides and higher potency to clear plasma cholesterol |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18742118 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3050106 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019539809 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 122021004216 Country of ref document: BR |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019014707 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2018210404 Country of ref document: AU Date of ref document: 20180119 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20197024024 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2018742118 Country of ref document: EP Effective date: 20190819 |
|
| ENP | Entry into the national phase |
Ref document number: 112019014707 Country of ref document: BR Kind code of ref document: A2 Effective date: 20190717 |