WO2018126259A1 - Anti-lair1 antibodies and their uses - Google Patents
Anti-lair1 antibodies and their uses Download PDFInfo
- Publication number
- WO2018126259A1 WO2018126259A1 PCT/US2018/012040 US2018012040W WO2018126259A1 WO 2018126259 A1 WO2018126259 A1 WO 2018126259A1 US 2018012040 W US2018012040 W US 2018012040W WO 2018126259 A1 WO2018126259 A1 WO 2018126259A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- binding fragment
- lairl
- cancer
- monoclonal antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/10—Cells modified by introduction of foreign genetic material
- C12N5/12—Fused cells, e.g. hybridomas
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56966—Animal cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/75—Agonist effect on antigen
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/85—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
- C12N15/8509—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic
- C12N2015/8518—Vectors or expression systems specially adapted for eukaryotic hosts for animal cells for producing genetically modified animals, e.g. transgenic expressing industrially exogenous proteins, e.g. for pharmaceutical use, human insulin, blood factors, immunoglobulins, pseudoparticles
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/705—Assays involving receptors, cell surface antigens or cell surface determinants
- G01N2333/70503—Immunoglobulin superfamily, e.g. VCAMs, PECAM, LFA-3
Definitions
- the present disclosure relates generally to the fields of medicine, oncology, and immunology.
- the disclosure relates to anti-LAIRl antibodies and uses thereof in treatment of cancer, inflammation and autoimmune diseases.
- LAIRl Human leukocyte-associated immunoglobulin-like receptor 1
- ITIMs 2 cytoplasmic immunoreceptor tyrosine-based inhibitory motifs
- LAIRl is structurally related to several other inhibitory Ig superfamily members, including LILRBs, localized to the leukocyte receptor complex (LRC) on human
- LAIRl consists of 10 exons.
- LAIRl is expressed in T cells, B cells, natural killer (NK) cells, macrophages, and dendritic cells, as well as hematopoietic progenitors including human CD34+ cells. It has been demonstrated that LAIRl is expressed on acute myeloid leukemia (AML) stem cells and differentiated AML and acute lymphocytic leukemia (ALL) cells where LAIRl is essential for AML development by activating SHP-1/CAMK/CREB pathway.
- AML acute myeloid leukemia
- ALL acute lymphocytic leukemia
- the present disclosure provides an isolated monoclonal antibody or an antigen-binding fragment thereof that binds specifically to LAIRl .
- the antibody or antigen-binding fragment when bound to LAIRl, modulates the activity of LAIRl .
- the antibody or antigen-binding fragment, when bound to LAIRl activates LAIRl.
- the antibody or antigen- binding fragment, when bound to LAIRl suppresses activation of LAIRl .
- the antibody or antigen-binding fragment, when bound to LAIRl specifically blocks binding of collagen I to LAIRl.
- the monoclonal antibody or antigen-binding fragment thereof can specifically bind to the Ig domain of LAIRl (amino acid residues 25-121). In some embodiments, the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope contained within the Ig domain of LAIRl . In some embodiments, the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl contained within the amino acid residues 25-47, 53-81, 88-96 and/or 102-119.
- the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl contained within the amino acid residues 30-34, 45-47 and/or 88-89. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl contained within the amino acid residues 37-41, 116-119, 98-105, 59-63 and/or 66-71.
- the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 30-34, 37-41, 45-47, 59-63, 66- 71, 88-89, 98-105, 108-110 or 116-119. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 35-36, 44, 53-56, 64-65, 73-81, 89-96, 106-107 or 111-115.
- the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 25, 35, 56, 65-68, 73, 75-77, 80, 89, 93, 106, 107 or 109. In some embodiments, the monoclonal antibody or an antigen- binding fragment thereof can specifically bind to an epitope of LAIRl contained within amino acid residues 59-69 and/or 100-112. In some embodiments, the monoclonal antibody or an antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 59, 61, 65, 67, 68, 69, 100, 102, 109, 111 or 112.
- the monoclonal antibody or an antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 59, 61 and 109. In some embodiments, the monoclonal antibody or an antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 61 or 62 of LAIRl . In some embodiments, the monoclonal antibody or an antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 68 or 69 of LAIRl .
- the monoclonal antibody or an antigen-binding fragment thereof can specifically bind to an epitope of LAIR1 comprising amino acid residues 61 or 62, 65 or 66, and 111 or 112 of LAIR1. In some embodiments, the monoclonal antibody or an antigen- binding fragment thereof can specifically bind to an epitope of LAIR1 comprising amino acid residues 111 or 112 of LAIR1.
- the isolated monoclonal antibody or an antigen-binding fragment thereof comprises (a) a heavy chain variable region comprising the following complementary determining regions (CDRs): a heavy chain CDR1 that is a CDR1 in SEQ ID NO: 1, 15, 29, 43, 57, 71, 85, 99, 113, 127, 141, 155, 169, 183, 197, 211, 225, 239, 253, 267, 281, 295, 309, 323, 337, 351, 365, 379, 393, 407, 421, 435, 449, 463, 477, 491, 505 or 519, a heavy chain CDR2 that is a CDR2 in SEQ ID NO: 1, 15, 29, 43, 57, 71, 85, 99, 113, 127, 141, 155, 169, 183, 197, 211, 225, 239, 253, 267, 281, 295, 309, 323, 337, 351, 365,
- CDRs complementary determining
- the heavy chain variable region comprises: a CDR1 comprising SEQ ID NO: 3, 17, 31, 45, 59, 73, 87, 101, 115, 129, 143, 157, 171, 185, 199, 213, 227, 241, 255, 269, 283, 297, 311, 325, 339, 353, 367, 381, 395, 409, 423, 437, 451, 465, 479, 493, 507 or 521, a CDR2 comprising SEQ ID NO: 4, 18, 32, 46, 60, 74, 88, 102, 116, 130, 144, 158, 172, 186, 200, 214, 228, 242, 256, 270, 284, 298, 312, 326, 340, 354, 368, 382, 396, 410, 424, 438, 452, 466, 480, 494, 508 or 522, and a CDR3 comprising SEQ ID NO: 5, 19, 33, 47,
- the light chain variable region comprises: a CDR1 comprising SEQ ID NO: 6, 20, 34, 48, 62, 76, 90, 104, 118, 132, 146, 160, 174, 188, 202, 216, 230, 244, 258, 272, 286, 300, 314, 328, 342, 356, 370, 384, 398, 412, 426, 440, 454, 468, 482, 496, 510 or 524, a CDR2 comprising amino acid sequence DAS, RAS, LAS, KAS, YAS, GAS, GPS, LSS, QAS, AAS, WTS, QSS, or AVS, and a CDR3 comprising SEQ ID NO: 7, 21, 35, 49, 63, 77, 91, 105, 119, 133, 147, 161, 175, 189, 203, 217, 231, 245, 259, 273, 287, 301, 315, 329, 343, 357, 371,
- the isolated monoclonal antibody or an antigen-binding fragment thereof comprises: (a) a heavy chain variable region having an amino acid sequence at least about 90% identical to SEQ ID NO: 1, 15, 29, 43, 57, 71, 85, 99, 113, 127, 141, 155, 169, 183, 197, 211, 225, 239, 253, 267, 281, 295, 309, 323, 337, 351, 365, 379, 393, 407, 421, 435, 449, 463, 477, 491, 505 or 519; and (b) a light chain variable region having an amino acid sequence at least about 90% identical to SEQ ID NO: 2, 16, 30, 44, 58, 72, 86, 100, 114, 128, 142, 156, 170, 184, 198, 212, 226, 240, 254, 268, 282, 296, 310, 324, 338, 352, 366, 380, 394, 408, 422, 436,
- the heavy chain variable region has an amino acid sequence of SEQ ID NO: 1, 15, 29, 43, 57, 71, 85, 99, 113, 127, 141, 155, 169, 183, 197, 211, 225, 239, 253, 267, 281, 295, 309, 323, 337, 351, 365, 379, 393, 407, 421, 435, 449, 463, 477, 491, 505 or 519, and wherein the light chain variable region has an amino acid sequence of SEQ ID NO: 2, 16, 30, 44, 58, 72, 86, 100, 114, 128, 142, 156, 170, 184, 198, 212, 226, 240, 254, 268, 282, 296, 310, 324, 338, 352, 366, 380, 394, 408, 422, 436, 450, 464, 478, 492, 506 or 520.
- the isolated monoclonal antibody or an antigen binding fragment thereof competes for the same epitope with the isolated monoclonal antibody or an antigen-binding fragment thereof as provided herein.
- the antibody is characterized by clone-paired heavy and light chain CDR sequences contained in the heavy chain and light chain variable region sequences listed in Table 1.
- each CDR is defined in accordance with Kabat definition, the Chothia definition, the combination of Kabat definition and Chothia definition, the AbM definition, or the contact definition of CDR.
- the antibody is characterized by clone-paired heavy and light chain variable region sequences listed in Table 1.
- the antibody is characterized by clone-paired heavy chain and light chain variable region sequences having amino acid sequences at least about 70%, 80%, 90%, or 95% identity to the clone-paired sequences in Table 1.
- the present disclosure provides an isolated monoclonal antibody or an antigen-binding fragment thereof, which competes for the same epitope with an antibody described herein.
- the antibody competes for the same epitope with an antibody having clone-paired heavy and light chain variable regions in Table 1.
- the isolated monoclonal antibody described herein is a chimeric, humanized, or human antibody.
- isolated monoclonal antibody described herein is of the IgGl , IgG2, IgG3 or IgG4 type.
- the antigen-binding fragment described herein is a recombinant ScFv (single chain fragment variable) antibody, Fab fragment, F(ab')2 fragment, or Fv fragment.
- composition comprising an isolated monoclonal antibody or an antigen-binding fragment thereof as provided herein, and at least one pharmaceutically acceptable carrier.
- an isolated nucleic acid that encodes the isolated monoclonal antibody or an antigen-binding fragment thereof as provided herein.
- a host cell comprising the vector as provided herein.
- the host cell may be a mammalian cell.
- the host cell may be a CHO cell.
- a process of producing an antibody may comprise culturing the host cell as provided herein under conditions suitable for expressing the antibody, and recovering the antibody.
- a method of treating or ameliorating the effects of a cancer or an autoimmune disease in a subject may comprise administering to the subject a therapeutically effective amount of the antibody or an antigen-binding fragment thereof as provided herein.
- the cancer is acute myeloid leukemia.
- the antibody or an antigen-binding fragment thereof is administered intravenously, intra-arterially, intra-tumorally or subcutaneously.
- a method of detecting a cancer cell or cancer stem cell in a sample or subject comprises contacting a subject or a sample from the subject with the antibody or an antigen-binding fragment thereof as provided herein, and detecting binding of said antibody to a cancer cell or cancer stem cell in said subject or sample.
- the sample can be a body fluid or biopsy.
- the sample can be blood, sputum, tears, saliva, mucous, serum, urine or feces.
- the detection comprises immunohistochemistry, ELISA, RIA or Western blot.
- FIG. 1A is a ribbon drawing of the LAIR-1 ectodomain (or extracellular domain or ECD) structure in rainbow colors from N-terminus (blue) to C-terminus (red).
- the figure is based on T. Harma C et al, "Crystal structure and collagen- binding site of immune inhibitory receptor LAIR-1 : unexpected implications for collagen binding by platelet receptor GPVI" Blood (2010) 115(7): 1364-73)
- FIG. IB shows specific amino acid residues in the sequence of LAIR1 Ig domain (amino acid residues 25-121; SEQ ID NO: 535) that serve the ligand binding functions (underlined residues are beta-strands).
- FIG. 2 shows the binding of mAb LA-56 to ECD of LAIR1 in ELISA.
- FIG. 3 shows the binding of mAb LA-89 to ECD of LAIR1 in ELISA.
- FIG. 4 shows the binding of mAb LA-29 to ECD of LAIR1 in ELISA.
- FIG 5. shows the binding of mAb LA-141 to ECD of LAIR1 in ELISA.
- FIG. 6 shows the binding of mAb LA-235 to ECD of LAIR1 in ELISA.
- FIG. 7 shows the binding of mAb LA- 192 to ECD of LAIR1 in ELISA.
- FIG. 8 shows the binding of mAb LA-61 to ECD of LAIRl in ELISA.
- FIG. 9 shows the binding of mAb LA-145 to ECD of LAIRl in ELISA.
- FIG. 10 shows the binding of mAb LA- ⁇ 111 to ECD of LAIRl in ELISA.
- FIG. 11 shows the binding of mAb LA- ⁇ 245 to ECD of LAIRl in ELISA.
- FIG. 12 shows the binding of mAb LA- ⁇ 171 to ECD of LAIRl in ELISA.
- FIG. 13 shows the binding of mAb LA- ⁇ 199 to ECD of LAIRl in ELISA.
- FIG. 14 shows the binding of mAb LA- -94 to ECD of LAIRl in ELISA.
- FIG. 15 shows the binding of mAb LA- -6 to ECD of LAIRl in ELISA.
- FIG. 16 shows the binding of mAb LA- ⁇ 121 to ECD of LAIRl in ELISA.
- FIG. 17 shows the binding of mAb LA- -142-1 to ECD of LAIRl in ELISA.
- FIG. 18 shows the binding of mAb LA- -142-2 to ECD of LAIRl in ELISA.
- FIG. 19 shows the binding of mAb LA- -259-1 to ECD of LAIRl in ELISA.
- FIG. 20 shows the binding of mAb LA- -259-2 to ECD of LAIRl in ELISA.
- FIG. 21 shows the binding of mAb LA- -258-1 to ECD of LAIRl in ELISA.
- FIG. 22 shows the binding of mAb LA- -258-2 to ECD of LAIRl in ELISA.
- FIG. 23 shows the binding of mAb LA- -258-3 to ECD of LAIRl in ELISA.
- FIG. 24 shows the binding of mAb LA- -30 to ECD of LAIRl in ELISA.
- FIG. 25 shows the binding of mAb LA- -35 to ECD of LAIRl in ELISA.
- FIG. 26 shows the binding of mAb LA- -37 to ECD of LAIRl in ELISA.
- FIG. 27 shows the binding of mAb LA- -60 to ECD of LAIRl in ELISA.
- FIG. 28 shows the binding of mAb LA- -63 to ECD of LAIRl in ELISA.
- FIG 29 shows the binding of mAb LA 64 to ECD of LAIRl in ELISA.
- FIG. 30 shows the binding of mAb LA- -82 to ECD of LAIRl in ELISA.
- FIG. 31 shows the binding of mAb LA- -87 to ECD of LAIRl in ELISA.
- FIG. 32 shows the binding of mAb LA- ⁇ 219 to ECD of LAIRl in ELISA.
- FIG. 33 shows the binding of mAb LA- ⁇ 101 to ECD of LAIRl in ELISA.
- FIG. 34 shows the binding of mAb LA- ⁇ 117 to ECD of LAIRl in ELISA.
- FIG. 35 shows the binding of mAb LA- ⁇ 151 to ECD of LAIRl in ELISA.
- FIG. 36 shows the binding of mAb LA- ⁇ 155 to ECD of LAIRl in ELISA.
- FIG. 37 shows the binding of mAb LA- -95 to ECD of LAIRl in ELISA.
- FIG. 38 shows the binding of mAb LA- ⁇ 222 to ECD of LAIRl in ELISA.
- FIG. 39 shows the binding of mAb LA- -252 to ECD of LAIRl in ELISA.
- FIG. 40 shows the effects of anti-LAIRl antibody on collagen I binding to LAIRl
- ECD by a competition ELISA. Coating collagen I on a high absorption 96-well plate at 2 ⁇ ⁇ , 100 ⁇ /well at 4°C overnight. Pre-incubate LAIRl -ECD with 6Xhis tag at 10 ⁇ g/ml with anti-LAIRl antibodies (10 ⁇ g/ml) for 30-60 minutes. Add LAIRl -his/anti-LAIRl mAb mixture to the collagen coated 96-well plates. Detection of LAIRl binding by HRP conjugated anti-his tag antibody using TMB substrate and reading at 450nm used a plate reader. The assay was repeated for 3 times.
- FIG. 41 illustrates the Octet RED96 System.
- FIG. 42 illustrates the Classic Sandwich assay.
- FIG. 43 graphically illustrates when the antibodies fall within the same epitope bin
- FIG. 44 graphically illustrates when the antibodies fall within different epitope bins
- FIG. 45 shows the first set (Set 1) of binning groups determined. Five epitope bins were identified for 14 rabbit mAbs using the method described in FIGS. 41-44.
- FIG. 46 shows the second set (Set 2) of binning groups determined. Two epitope bins were identified for 7 rabbit mAbs using the method described in FIGS. 41-44.
- FIG. 47 shows the third set (Set 3) of binning groups determined. Two epitope bins were identified for 7 rabbit mAbs using the method described in FIGS. 41-44.
- FIG. 48 shows the fourth set (Set 4) of binning groups determined. Two epitope bins were identified for 7 rabbit mAbs using the method described in Figure in FIGS. 41-44.
- FIG. 49 shows the kinetic binding sensorgram for mAb LA-121 using Octet.
- FIG. 50 shows the kinetic binding sensorgram for mAb LA-258-3 using Octet.
- FIG. 51 shows the kinetic binding sensorgram for mAb LA-258-2 using Octet.
- FIG. 52 shows the kinetic binding sensorgram for mAb LA-259-2 using Octet.
- FIGS. 53A-E show the screening of anti-LAIRl antagonist and agonist antibodies.
- FIG. 53A describes an initial screening method to identify antibodies binding to LAIRl .
- potential anti-LAIRl antibodies in the conditioned-medium of monoclonal antibody- producing rabbit plasma cells were pre-incubated on Protein A coated wells.
- the LAIRl reporter cells (indicating functional binding of LAIRl, as described in Kang et al Nat Cell Biol 2015, 17(5):665-677) were then plated and their GFP+% were detected after 24 hours.
- the conditioned-medium that can induce GFP+% upregulation possibly contains LAIR1- binding monoclonal antibodies.
- FIG. 53B summarizes the data from using a method to identify antagonist anti-LAIRl antibodies.
- FIG. 53C shows the data from using a method to further narrow down antagonist anti-LAIRl antibodies.
- the LAIR1 ligand collagen I was coated on the surface of the wells, then soluble Abs and K562 cells (that express Fc receptors on cell surface) were added, and the percentage of GFP+ LAIR1 reporter cells were detected after 24 hours.
- An antagonist anti-LAIRl antibody as a soluble form, is capable of inhibiting collagen I-induced GFP+ signal (shown as GFP+%) in the reporter cells even in the presence of Fc receptor positive cells in the co-culture.
- FIG. 53D shows that two potential agonist antibodies (LA-94 and LA- 192) and the N297A Fc mutant version of LA-94 (N297A94), and four potential antagonist antibodies (LA-235, LA-219, LA-252, LA-259) and N297A Fc mutant version of LA-235 (N297A235) were suggested using the LAIR1 reporter cell system following the methods in FIGS. 53A-C. All the GFP expression information was summarized in the table (lower panel).
- an antagonist anti-LAIRl antibody as a soluble form, is capable of inhibiting collagen I-induced GFP+ signal in the reporter cells even in the presence of Fc receptor positive cells
- an agonist anti-LAIRl antibody as a soluble form, can induce GFP+ signal in the reporter cells.
- FIG. 53E shows that the dose-dependent activity of the antagonist antibody anti-LAIRl LA-235 to inhibit collagen-induced GFP+ (%) of LAIR1 reporter cells.
- the agonist Ab LA-94 shows an ability to enhance the collagen-induced GFP+ (%) of LAIR1 reporter cells.
- FIGS. 54A-D show that anti-LAIRl antibody blocks leukemia development in an NSG xenograft model.
- FIG. 54A shows that 1 x 10 6 luciferase stably expressing THP-1 cells were transplanted into NSG mice through tail vein injection at day 0, and after 30 minutes, anti-LAIRl antibody was administrated through ophthalmic vein injection. Tumor development was monitored by BLI imaging.
- FIG. 54B shows the survival curve of mice from FIG. 54A.
- FIG. 54C shows that 5 x 10 6 GFP+ MV4-11 cells were transplanted into NSG mice through tail vein injection at day 0, and after 30 minutes, 10 mg/kg anti-LAIRl antibodies were administrated through ophthalmic vein injection.
- Tissues were harvested after 24 hours and homing of GFP+ MV4-11 cells were detected through flow cytometry, expressed as a ratio of MV4-11 cells in liver (LVR), bone marrow (BM), and spleen (SP) to those in peripheral blood (PB) (expressed as LVR/PB, BM/PB, and SP/PB, respectively).
- LVR liver
- BM bone marrow
- SP spleen
- FIG. 54D shows that lxlO 5 /well human endothelial cells were plated on the upper well of the 24 well transwell plate at day -7. lxlO 5 MV4-11 cells were added at day 0, and the cell number of MV4-11 cells in the lower well were counted using flow cytometry at day 1 (18 hours later).
- FIGS. 55A-D show that anti-LAIRl antibody blocks leukemia development in human LAIRl ectopically-expressed MLL-AF9 mouse model.
- FIG. 55A shows the schematic of human LAIRl ectopically-expressed MLL-AF9 mouse model.
- FIG. 55B shows that GFP+ cells used for transplantation in A are human LAIRl positive but do not express mouse LAIRl .
- FIG. 55C shows that human LAIRl ectopically-expressed in mouse bone marrow cells up-regulated phosphorylated SHP1 (left), and increased the number of colony formation unit (CFU) (right).
- FIG. 55D shows that 100 ⁇ g anti-LAIRl antibody per mouse was injected to mice that had been transplanted with the human LAIRl ectopically-expressed cells, at days 5, 7, and 9 after transplantation. Periphery blood samples were collected at day 15, and the percentage of GFP+ cells were detected using flow cytometry.
- FIG. 56 shows that anti-LAIRl demonstrates Fc-dependent ability to enhance phagocytosis of human macrophages.
- CFSE-stained THP-1 cells which express LAIRl on its surface, were incubated with control or anti-LAIRl antibodies for 15 min on ice followed by PBS washing. The cells were then incubated with human PBMC-derived macrophages for 30 min. Phagocytosis of THP-1 cells by human macrophages was measured.
- FIGS. 57A-B show that anti-LAIRl agonist antibody inhibits T cell activity.
- indicated concentrations of anti-CD3 antibody was coated on the surface of the wells of a 96-well flat-bottom plate, and lxlO 5 PBMC mixed with control or LA-192 anti- LAIRl antibodies (final concentration 50 ⁇ g/ml) were incubated. The percentage of CD3+ T cells were detected by flow cytometry at day 5.
- human T cells/GFP+ THP-1 cells mixture was treated by indicated control or various anti-LAIRl antibodies. Apoptosis of GFP+ THP-1 cells was measured after 4 hr.
- each numerical parameter should at least be construed in light of the number of reported significant digits and by applying ordinary rounding techniques. Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. Any numerical value, however, inherently contain certain errors necessarily resulting from the standard deviation found in their respective testing
- antibody refers to an intact immunoglobulin of any isotype, or a fragment thereof that can compete with the intact antibody for specific binding to the target antigen, and includes, for instance, chimeric, humanized, fully human, and bispecific antibodies.
- An "antibody” is a species of an antigen binding protein.
- An intact antibody will generally comprise at least two full-length heavy chains and two full-length light chains, but in some instances can include fewer chains such as antibodies naturally occurring in camelids which can comprise only heavy chains.
- Antibodies can be derived solely from a single source, or can be "chimeric,” that is, different portions of the antibody can be derived from two different antibodies as described further below.
- antigen binding proteins, antibodies, or binding fragments can be produced in hybridomas, by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact antibodies.
- antibody includes, in addition to antibodies comprising two full-length heavy chains and two full-length light chains, derivatives, variants, fragments, and muteins thereof, examples of which are described below.
- antibodies include monoclonal antibodies, bispecific antibodies, minibodies, domain antibodies, synthetic antibodies (sometimes referred to herein as "antibody mimetics"), chimeric antibodies, humanized antibodies, human antibodies, antibody fusions (sometimes referred to herein as "antibody conjugates”), and fragments thereof, respectively.
- the term also encompasses peptibodies.
- Naturally occurring antibody structural units typically comprise a tetramer.
- Each such tetramer typically is composed of two identical pairs of polypeptide chains, each pair having one full-length "light” (in certain embodiments, about 25 kDa) and one full-length "heavy” chain (in certain embodiments, about 50-70 kDa).
- the amino-terminal portion of each chain typically includes a variable region of about 100 to 110 or more amino acids that typically is responsible for antigen recognition.
- the carboxy -terminal portion of each chain typically defines a constant region that can be responsible for effector function.
- Human light chains are typically classified as kappa and lambda light chains.
- Heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
- IgG has several subclasses, including, but not limited to, IgGl, IgG2, IgG3, and IgG4.
- IgM has subclasses including, but not limited to, IgMl and IgM2.
- IgA is similarly subdivided into subclasses including, but not limited to, IgAl and IgA2.
- variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids.
- J Fundamental Immunology
- the variable regions of each light/heavy chain pair typically form the antigen binding site.
- variable region refers to a portion of the light and/or heavy chains of an antibody, typically including approximately the amino-terminal 120 to 130 amino acids in the heavy chain and about 100 to 110 amino terminal amino acids in the light chain.
- variable regions of different antibodies differ extensively in amino acid sequence even among antibodies of the same species.
- the variable region of an antibody typically determines specificity of a particular antibody for its target.
- variable regions typically exhibit the same general structure of relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions or CDRs.
- the CDRs from the two chains of each pair typically are aligned by the framework regions, which can enable binding to a specific epitope.
- both light and heavy chain variable regions typically comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
- the assignment of amino acids to each domain is typically in accordance with the definitions of Kabat
- an antibody heavy chain binds to an antigen in the absence of an antibody light chain.
- an antibody light chain binds to an antigen in the absence of an antibody heavy chain.
- an antibody binding region binds to an antigen in the absence of an antibody light chain.
- an antibody binding region binds to an antigen in the absence of an antibody heavy chain.
- an individual variable region specifically binds to an antigen in the absence of other variable regions.
- definitive delineation of a CDR and identification of residues comprising the binding site of an antibody is accomplished by solving the structure of the antibody and/or solving the structure of the antibody-ligand complex. In certain embodiments, that can be accomplished by any of a variety of techniques known to those skilled in the art, such as X-ray crystallography. In certain embodiments, various methods of analysis can be employed to identify or approximate the CDR regions. Examples of such methods include, but are not limited to, the Kabat definition, the Chothia definition, the AbM definition and the contact definition.
- the Kabat definition is a standard for numbering the residues in an antibody and is typically used to identify CDR regions. See, e.g., Johnson & Wu, Nucleic Acids Res., 28: 214-8 (2000).
- the Chothia definition is similar to the Kabat definition, but the Chothia definition takes into account positions of certain structural loop regions. See, e.g., Chothia et al , J. Mol. Biol, 196: 901-17 (1986); Chothia et al. , Nature, 342: 877-83 (1989).
- the AbM definition uses an integrated suite of computer programs produced by Oxford Molecular Group that model antibody structure.
- the CDR regions in the heavy chain are typically referred to as HI, H2, and H3 and are numbered sequentially in the direction from the amino terminus to the carboxy terminus.
- the CDR regions in the light chain are typically referred to as LI, L2, and L3 and are numbered sequentially in the direction from the amino terminus to the carboxy terminus.
- the term "light chain” includes a full-length light chain and fragments thereof having sufficient variable region sequence to confer binding specificity.
- a full-length light chain includes a variable region domain, VL, and a constant region domain, CL.
- the variable region domain of the light chain is at the amino-terminus of the polypeptide.
- Light chains include kappa chains and lambda chains.
- the term "heavy chain” includes a full-length heavy chain and fragments thereof having sufficient variable region sequence to confer binding specificity.
- a full-length heavy chain includes a variable region domain, VH, and three constant region domains, CHI, CH2, and CH3.
- the VH domain is at the amino-terminus of the polypeptide, and the CH domains are at the carboxyl-terminus, with the CH3 being closest to the carboxy -terminus of the polypeptide.
- Heavy chains can be of any isotype, including IgG (including IgGl, IgG2, IgG3 and IgG4 subtypes), IgA (including IgAl and IgA2 subtypes), IgM and IgE.
- a bispecific or bifunctional antibody typically is an artificial hybrid antibody having two different heavy /light chain pairs and two different binding sites.
- Bispecific antibodies can be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab' fragments. See, e.g. , Songsivilai et al, Clin. Exp. Immunol, 79: 315-321 (1990); Kostelny et al, J. Immunol, 148: 1547-1553 (1992).
- an antigen refers to a substance capable of inducing adaptive immune responses.
- an antigen is a substance which serves as a target for the receptors of an adaptive immune response.
- an antigen is a molecule that binds to antigen- specific receptors but cannot induce an immune response in the body by itself.
- Antigens are usually proteins and polysaccharides, less frequently also lipids. Suitable antigens include without limitation parts of bacteria (coats, capsules, cell walls, flagella, fimbrai, and toxins), viruses, and other microorganisms.
- Antigens also include tumor antigens, e.g., antigens generated by mutations in tumors.
- antigens also include immunogens and haptens.
- antigen-binding fragment refers to a portion of a protein which is capable of binding specifically to an antigen.
- the antigen- binding fragment is derived from an antibody comprising one or more CDRs, or any other antibody fragment that binds to an antigen but does not comprise an intact native antibody structure.
- antigen-binding fragment examples include, without limitation, a diabody, a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific dsFv (dsFv-dsFv 1 ), a disulfide stabilized diabody (ds diabody), a single-chain antibody molecule (scFv), an scFv dimer (bivalent diabody), a multispecific antibody, a single domain antibody (sdAb), a camelid antibody or a nanobody, a domain antibody, and a bivalent domain antibody.
- a diabody examples include, without limitation, a diabody, a Fab, a Fab', a F(ab')2, an Fv fragment, a disulfide stabilized Fv fragment (dsFv), a (dsFv)2, a bispecific
- an antigen-binding fragment is capable of binding to the same antigen to which the parent antibody binds.
- an antigen-binding fragment may comprise one or more CDRs from a particular human antibody grafted to a framework region from one or more different human antibodies.
- a "Fab fragment” comprises one light chain and the CHI and variable regions of one heavy chain.
- the heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule.
- a "Fab' fragment” comprises one light chain and a portion of one heavy chain that contains the VH domain and the CHI domain and also the region between the CHI and CH2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab' fragments to form an F(ab')2 molecule.
- a "F(ab')2 fragment” contains two light chains and two heavy chains that contain the VH and CHI domains and also a portion of the constant region between the CHI and CH2 domains, such that an interchain disulfide bond is formed between the two heavy chains.
- a F(ab')2 fragment thus is composed of two Fab' fragments that are held together by a disulfide bond between the two heavy chains.
- An "Fc” region comprises two heavy chain fragments comprising the CHI and CH2 domains of an antibody. The two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the CH3 domains. [00107]
- the "Fv region” comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
- Single-chain antibodies are Fv molecules in which the heavy and light chain variable regions have been connected by a flexible linker to form a single polypeptide chain, which forms an antigen binding region.
- Single chain antibodies are discussed in detail in International Patent Application Publication No. WO 88/01649 and U.S. Patent No.
- a “domain antibody” is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain.
- two or more VH regions are covalently joined with a peptide linker to create a bivalent domain antibody.
- the two VH regions of a bivalent domain antibody can target the same or different antigens.
- a "bivalent antigen binding protein” or “bivalent antibody” comprises two antigen binding sites. In some instances, the two binding sites have the same antigen specificities. Bivalent antigen binding proteins and bivalent antibodies can be bispecific, see, infra. A bivalent antibody other than a “multispecific” or “multifunctional” antibody, in certain embodiments, typically is understood to have each of its binding sites identical.
- a "multispecific antigen binding protein” or “multispecific antibody” is one that targets more than one antigen or epitope.
- a "bispecific,” “dual-specific” or “bifunctional” antigen binding protein or antibody is a hybrid antigen binding protein or antibody, respectively, having two different antigen binding sites.
- Bispecific antigen binding proteins and antibodies are a species of multispecific antigen binding protein antibody and can be produced by a variety of methods including, but not limited to, fusion of hybridomas or linking of Fab' fragments. See, e.g., Songsivilai and Lachmann, 1990, Clin. Exp. Immunol. 79:315-321 ; Kostelny et al , 1992, J. Immunol. 148: 1547-1553.
- the two binding sites of a bispecific antigen binding protein or antibody will bind to two different epitopes, which can reside on the same or different protein targets.
- Binding affinity generally refers to the strength of the sum total of non-covalent interactions between a single binding site of a molecule (e.g. , an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity that reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein.
- Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer.
- a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative and exemplary embodiments for measuring binding affinity are described in the following.
- an antibody that "specifically binds to" or is “specific for” a particular polypeptide or an epitope on a particular polypeptide is one that binds to that particular polypeptide or epitope on a particular polypeptide without substantially binding to any other polypeptide or polypeptide epitope.
- the LAIRl specific antibodies of the present invention are specific to LAIRl .
- the antibody that binds to LAIRl has a dissociation constant (K d ) of ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, ⁇ 0.1 nM, ⁇ 0.01 nM, or ⁇ 0.001 nM (e.g. 1(T 8 M or less, e.g.
- Kd refers to the ratio of the dissociation rate to the association rate (k 0 ff/k on ), may be determined using surface plasmon resonance methods for example using instrument such as Biacore.
- the term "compete" when used in the context of antigen binding proteins (e.g. , antibody or antigen-binding fragment thereof) that compete for the same epitope means competition between antigen binding proteins as determined by an assay in which the antigen binding protein (e.g. , antibody or antigen-binding fragment thereof) being tested prevents or inhibits (e.g., reduces) specific binding of a reference antigen binding protein (e.g., a ligand, or a reference antibody) to a common antigen (e.g., LAIRl or a fragment thereof).
- a reference antigen binding protein e.g., a ligand, or a reference antibody
- RIA solid phase direct or indirect radioimmunoassay
- EIA solid phase direct or indirect enzyme immunoassay
- sandwich competition assay see, e.g. , Stahli et al , 1983, Methods in Enzymology 9:242-253
- solid phase direct biotin-avidin EIA see, e.g. , Kirkland et al. , 1986, J. Immunol. 137:3614-3619
- solid phase direct labeled assay solid phase direct labeled sandwich assay
- solid phase direct label RIA using 1-125 label (see, e.g., Morel et al, 1988, Molec. Immunol. 25:7-15); solid phase direct biotin-avidin EIA (see, e.g. , Cheung, et al, 1990, Virology 176:546-552); and direct labeled RIA (Moldenhauer et al, 1990, Scand. J. Immunol. 32:77-82).
- such an assay involves the use of purified antigen bound to a solid surface or cells bearing either of these, an unlabelled test antigen binding protein and a labeled reference antigen binding protein.
- Antigen binding proteins identified by competition assay include antigen binding proteins binding to the same epitope as the reference antigen binding proteins and antigen binding proteins binding to an adjacent epitope sufficiently proximal to the epitope bound by the reference antigen binding protein for steric hindrance to occur. Additional details regarding methods for determining competitive binding are provided in the examples herein.
- a competing antigen binding protein when present in excess, it will inhibit (e.g., reduce) specific binding of a reference antigen binding protein to a common antigen by at least 40- 45%, 45-50%, 50-55%, 55-60%, 60-65%, 65-70%, 70-75% or 75% or more. In some instances, binding is inhibited by at least 80-85%, 85-90%, 90-95%, 95-97%, or 97% or more.
- epitope refers to the specific group of atoms or amino acids on an antigen to which an antibody binds.
- the epitope can be either linear epitope or a conformational epitope.
- a linear epitope is formed by a continuous sequence of amino acids from the antigen and interacts with an antibody based on their primary structure.
- a conformational epitope is composed of discontinuous sections of the antigen's amino acid sequence and interacts with the antibody based on the 3D structure of the antigen.
- an epitope is approximately five or six amino acid in length. Two antibodies may bind the same epitope within an antigen if they exhibit competitive binding for the antigen.
- the term "host cell” means a cell that has been transformed, or is capable of being transformed, with a nucleic acid sequence and thereby expresses a gene of interest.
- the term includes the progeny of the parent cell, whether or not the progeny is identical in morphology or in genetic make-up to the original parent cell, so long as the gene of interest is present.
- identity refers to a relationship between the sequences of two or more polypeptide molecules or two or more nucleic acid molecules, as determined by aligning and comparing the sequences.
- Percent identity means the percent of identical residues between the amino acids or nucleotides in the compared molecules and is calculated based on the size of the smallest of the molecules being compared. For these calculations, gaps in alignments (if any) are preferably addressed by a particular mathematical model or computer program (i.e. , an "algorithm”). Methods that can be used to calculate the identity of the aligned nucleic acids or polypeptides include those described in Computational Molecular Biology, (Lesk, A.
- the sequences being compared are typically aligned in a way that gives the largest match between the sequences.
- One example of a computer program that can be used to determine percent identity is the GCG program package, which includes GAP (Devereux et al , 1984, Nucl. Acid Res. 12:387; Genetics Computer Group, University of Wisconsin, Madison, Wis.).
- GAP is used to align the two polypeptides or polynucleotides for which the percent sequence identity is to be determined.
- the sequences are aligned for optimal matching of their respective amino acid or nucleotide (the "matched span", as determined by the algorithm).
- a gap opening penalty (which is calculated as 3 ⁇ the average diagonal, wherein the "average diagonal” is the average of the diagonal of the comparison matrix being used; the “diagonal” is the score or number assigned to each perfect amino acid match by the particular comparison matrix) and a gap extension penalty (which is usually 1/10 times the gap opening penalty), as well as a comparison matrix such as PAM 250 or BLOSUM 62 are used in conjunction with the algorithm.
- a standard comparison matrix see, Dayhoff et al , 1978, Atlas of Protein Sequence and Structure 5:345-352 for the PAM 250 comparison matrix; Henikoff et al. , 1992, Proc. Natl. Acad. Sci. U.S.A. 89: 10915-10919 for the
- GAP program can be adjusted if so desired to result in an alignment that spans at least 50 or other number of contiguous amino acids of the target polypeptide.
- an "isolated" biological component such as a nucleic acid, peptide or cell
- Nucleic acids, peptides and proteins which have been "isolated” thus include nucleic acids and proteins purified by standard purification methods.
- the term also embraces nucleic acids, peptides and proteins prepared by recombinant expression in a host cell as well as chemically synthesized nucleic acids.
- oligonucleotide means a polynucleotide comprising 200 or fewer nucleotides. In some embodiments, oligonucleotides are 10 to 60 bases in length. In other embodiments, oligonucleotides are 12, 13, 14, 15, 16, 17, 18, 19, or 20 to 40 nucleotides in length. Oligonucleotides can be single stranded or double stranded, e.g. , for use in the construction of a mutant gene. Oligonucleotides can be sense or antisense oligonucleotides.
- An oligonucleotide can include a label, including a radiolabel, a fluorescent label, a hapten or an antigenic label, for detection assays. Oligonucleotides can be used, for example, as PCR primers, cloning primers or hybridization probes.
- operably linked refers to an arrangement of elements wherein the components so described are configured so as to perform their usual function.
- a given signal peptide that is operably linked to a polypeptide directs the secretion of the polypeptide from a cell.
- a promoter that is operably linked to a coding sequence will direct the expression of the coding sequence.
- the promoter or other control elements need not be contiguous with the coding sequence, so long as they function to direct the expression thereof. For example, intervening untranslated yet transcribed sequences can be present between the promoter sequence and the coding sequence and the promoter sequence can still be considered “operably linked" to the coding sequence.
- polynucleotide or “nucleic acid” includes both single-stranded and double-stranded nucleotide polymers.
- the nucleotides comprising the polynucleotide can be ribonucleotides or deoxyribonucleotides or a modified form of either type of nucleotide.
- Said modifications include base modifications such as bromouridine and inosine derivatives, ribose modifications such as 2',3'-dideoxyribose, and internucleotide linkage modifications such as phosphorothioate, phosphorodithioate, phosphoroselenoate, phosphorodiselenoate, phosphoroanilothioate, phoshoraniladate and phosphoroamidate.
- polypeptide or "protein” means a macromolecule having the amino acid sequence of a native protein, that is, a protein produced by a naturally-occurring and non-recombinant cell; or it is produced by a genetically-engineered or recombinant cell, and comprise molecules having the amino acid sequence of the native protein, or molecules having deletions from, additions to, and/or substitutions of one or more amino acids of the native sequence.
- the term also includes amino acid polymers in which one or more amino acids are chemical analogs of a corresponding naturally-occurring amino acid and polymers.
- polypeptide and protein specifically encompass LAIR1 antigen binding proteins, antibodies, or sequences that have deletions from, additions to, and/or substitutions of one or more amino acid of antigen-binding protein.
- polypeptide fragment refers to a polypeptide that has an amino-terminal deletion, a carboxyl-terminal deletion, and/or an internal deletion as compared with the full-length native protein. Such fragments can also contain modified amino acids as compared with the native protein. In certain embodiments, fragments are about five to 500 amino acids long. For example, fragments can be at least 5, 6, 8, 10, 14, 20, 50, 70, 100, 1 10, 150, 200, 250, 300, 350, 400, or 450 amino acids long.
- Useful polypeptide fragments include immunologically functional fragments of antibodies, including binding domains.
- useful fragments include but are not limited to a CDR region, a variable domain of a heavy and/or light chain, a portion of an antibody chain or just its variable region including two CDRs, and the like.
- compositions and formulations suitable for pharmaceutical delivery of the fusion proteins herein disclosed are conventional. Remington's Pharmaceutical Sciences, by E. W. Martin, Mack Publishing Co., Easton, PA, 15th Edition (1975) , describes compositions and formulations suitable for pharmaceutical delivery of the fusion proteins herein disclosed. In general, the nature of the carrier will depend on the particular mode of administration being employed. For instance, parenteral formulations usually comprise injectable fluids that include pharmaceutically and physiologically acceptable fluids such as water, physiological saline, balanced salt solutions, aqueous dextrose, glycerol or the like as a vehicle. For solid compositions (e.g.
- non-toxic solid carriers can include, for example, pharmaceutical grades of mannitol, lactose, starch or magnesium stearate.
- pharmaceutical compositions to be administered can contain minor amounts of non-toxic auxiliary substances, such as wetting or emulsifying agents, preservatives, and pH buffering agents and the like, for example sodium acetate or sorbitan monolaurate.
- the term "subject” refers to a human or any non-human animal (e.g. mouse, rat, rabbit, dog, cat, cattle, swine, sheep, horse or primate).
- a human includes pre and post-natal forms.
- a subject is a human being.
- a subject can be a patient, which refers to a human presenting to a medical provider for diagnosis or treatment of a disease.
- the term "subject” is used herein interchangeably with "individual” or "patient.
- a subject can be afflicted with or is susceptible to a disease or disorder but may or may not display symptoms of the disease or disorder.
- an "effective amount” or “therapeutically effective amount” means the amount of agent that is sufficient to prevent, treat, reduce and/or ameliorate the symptoms and/or underlying causes of any disorder or disease, or the amount of an agent sufficient to produce a desired effect on a cell.
- a “therapeutically effective amount” is an amount sufficient to reduce or eliminate a symptom of a disease.
- a therapeutically effective amount is an amount sufficient to overcome the disease itself.
- Treating" or “treatment” of a condition as used herein includes preventing or alleviating a condition, slowing the onset or rate of development of a condition, reducing the risk of developing a condition, preventing or delaying the development of symptoms associated with a condition, reducing or ending symptoms associated with a condition, generating a complete or partial regression of a condition, curing a condition, or some combination thereof.
- a "vector” refers to a nucleic acid molecule as introduced into a host cell, thereby producing a transformed host cell.
- a vector may include nucleic acid sequences that permit it to replicate in the host cell, such as an origin of replication.
- a vector may also include one or more therapeutic genes and/or selectable marker genes and other genetic elements known in the art.
- a vector can transduce, transform or infect a cell, thereby causing the cell to express nucleic acids and/or proteins other than those native to the cell.
- a vector optionally includes materials to aid in achieving entry of the nucleic acid into the cell, such as a viral particle, liposome, protein coating or the like.
- Leukocyte-associated immunoglobulin-like receptor 1 is a protein that in humans is encoded by the LAIR1 gene.
- LAIR1 has also been designated as CD305 (cluster of differentiation 305).
- LAIRl is a type I transmembrane glycoprotein that contains one extracellular Ig-like domain and two intracellular ITIMs. Like the genes that encode LILRBs, lairl is localized to the leukocyte receptor complex (LRC) on human chromosome 19ql3.4. LAIRl binds collagens, and its ITIMs recruit SHP-1 and SHP-2. LAIRl is expressed in T 5 cells, B cells, natural killer (NK) cells, macrophages, and dendritic cells, as well as
- hematopoietic progenitors including human CD34 + cells.
- the inventors have found that LAIRl is expressed on AML stem cells and differentiated AML and ALL cells and its inhibition blocks AML-SC activity and leukemia development
- the present disclosure provides a monoclonal antibody or antigenic ) binding fragment thereof that when binding to LAIRl, modulates the activity of LAIRl .
- the monoclonal antibodies described herein were prepared using standard methods, followed by screening, characterization and functional assessment.
- variable regions were sequenced and then subcloned into a human expression vector to produce the chimeric antibody genes, which were then expressed and purified. These chimeric antibodies 15 were tested for antigen binding, signaling blocking, and in xenograft experiments.
- the methods for generating monoclonal antibodies generally begin along the same lines as those for preparing polyclonal antibodies.
- the first step for both these methods is immunization of an appropriate host.
- a given composition for immunization may vary in its immunogenicity. It is often necessary therefore to boost the host immune system, as may be achieved by coupling a peptide or
- polypeptide immunogen to a carrier.
- exemplary and preferred carriers are keyhole limpet hemocyanin (KLH) and bovine serum albumin (BSA). Other albumins such as ovalbumin, mouse serum albumin or rabbit serum albumin can also be used as carriers.
- Means for conjugating a polypeptide to a carrier protein are well known in the art and include glutaraldehyde, m-maleimidobencoyl-N-hydroxysuccinimide ester, carbodiimyde and bis- biazotized benzidine.
- the immunogenicity of a particular immunogen composition can be enhanced by the use of non-specific stimulators of the immune response, known as adjuvants.
- exemplary and preferred adjuvants include complete Freund's adjuvant (a non-specific stimulator of the immune response containing killed Mycobacterium tuberculosis), incomplete Freund's adjuvants and aluminum hydroxide adjuvant.
- the amount of immunogen composition used in the production of polyclonal antibodies varies upon the nature of the immunogen as well as the animal used for
- immunization A variety of routes can be used to administer the immunogen (subcutaneous, intramuscular, intradermal, intravenous and intraperitoneal).
- the production of polyclonal antibodies may be monitored by sampling blood of the immunized animal at various points following immunization. A second, booster injection, also may be given. The process of boosting and titering is repeated until a suitable titer is achieved.
- the immunized animal can be bled and the serum isolated and stored, and/or the animal can be used to generate MAbs.
- somatic cells with the potential for producing antibodies, specifically B lymphocytes (B cells), are selected for use in the MAb generating protocol. These cells may be obtained from biopsied spleens or lymph nodes, or from circulating blood. The antibody-producing B lymphocytes from the immunized animal are then fused with cells of an immortal myeloma cell, generally one of the same species as the animal that was immunized or human or human/mouse chimeric cells.
- B lymphocytes B lymphocytes
- Myeloma cell lines suited for use in hybridoma-producing fusion procedures preferably are non-antibody -producing, have high fusion efficiency, and enzyme deficiencies that render then incapable of growing in certain selective media which support the growth of only the desired fused cells (hybridomas). Any one of a number of myeloma cells may be used, as are known to those of skill in the art (Goding, pp. 65-66, 1986; Campbell, pp. 75-83, 1984).
- Methods for generating hybrids of antibody-producing spleen or lymph node cells and myeloma cells usually comprise mixing somatic cells with myeloma cells in a 2: 1 proportion, though the proportion may vary from about 20: 1 to about 1 : 1, respectively, in the presence of an agent or agents (chemical or electrical) that promote the fusion of cell membranes.
- Fusion methods using Sendai virus have been described by Kohler and Milstein (1975; 1976), and those using polyethylene glycol (PEG), such as 37% (v/v) PEG, by Gefter et al. (1977).
- PEG polyethylene glycol
- the use of electrically induced fusion methods also is appropriate (Goding, pp. 71-74, 1986).
- Fusion procedures usually produce viable hybrids at low frequencies, about 1 x 10 "6 to 1 x 10 "8 . However, this does not pose a problem, as the viable, fused hybrids are differentiated from the parental, infused cells (particularly the infused myeloma cells that would normally continue to divide indefinitely) by culturing in a selective medium.
- the selective medium is generally one that contains an agent that blocks the de novo synthesis of nucleotides in the tissue culture media.
- Exemplary and preferred agents are aminopterin, methotrexate, and azaserine. Aminopterin and methotrexate block de novo synthesis of both purines and pyrimidines, whereas azaserine blocks only purine synthesis.
- the media is supplemented with hypoxanthine and thymidine as a source of nucleotides (HAT medium).
- HAT medium a source of nucleotides
- azaserine is used, the media is supplemented with hypoxanthine.
- Ouabain is added if the B cell source is an Epstein Barr virus (EBV) transformed human B cell line, in order to eliminate EBV transformed lines that have not fused to the myeloma.
- EBV Epstein Barr virus
- the preferred selection medium is HAT or HAT with ouabain. Only cells capable of operating nucleotide salvage pathways are able to survive in HAT medium.
- the myeloma cells are defective in key enzymes of the salvage pathway, e.g. , hypoxanthine phosphoribosyl transferase (HPRT), and they cannot survive.
- HPRT hypoxanthine phosphoribosyl transferase
- the B cells can operate this pathway, but they have a limited life span in culture and generally die within about two weeks. Therefore, the only cells that can survive in the selective media are those hybrids formed from myeloma and B cells.
- EBV-transformed B cells When the source of B cells used for fusion is a line of EBV-transformed B cells, as here, ouabain is also used for drug selection of hybrids as EBV-transformed B cells are susceptible to drug killing, whereas the myeloma partner used is chosen to be ouabain resistant.
- Culturing provides a population of hybridomas from which specific hybridomas are selected. Typically, selection of hybridomas is performed by culturing the cells by single- clone dilution in microtiter plates, followed by testing the individual clonal supernatants (after about two to three weeks) for the desired reactivity.
- the assay should be sensitive, simple and rapid, such as radioimmunoassays, enzyme immunoassays, cytotoxicity assays, plaque assays dot immunobinding assays, and the like.
- the selected hybridomas are then serially diluted or single-cell sorted by flow cytometric sorting and cloned into individual antibody -producing cell lines, which clones can then be propagated indefinitely to provide mAbs.
- the cell lines may be exploited for MAb production in two basic ways.
- a sample of the hybridoma can be injected (often into the peritoneal cavity) into an animal (e.g., a mouse).
- the animals are primed with a hydrocarbon, especially oils such as pristane (tetramethylpentadecane) prior to injection.
- pristane tetramethylpentadecane
- the injected animal develops tumors secreting the specific monoclonal antibody produced by the fused cell hybrid.
- the body fluids of the animal such as serum or ascites fluid, can then be tapped to provide MAbs in high concentration.
- the individual cell lines could also be cultured in vitro, where the MAbs are naturally secreted into the culture medium from which they can be readily obtained in high concentrations.
- human hybridoma cells lines can be used in vitro to produce immunoglobulins in cell supernatant.
- the cell lines can be adapted for growth in serum-free medium to optimize the ability to recover human monoclonal immunoglobulins of high purity.
- MAbs produced by either means may be further purified, if desired, using filtration, centrifugation and various chromatographic methods such as FPLC or affinity
- Fragments of the monoclonal antibodies of the disclosure can be obtained from the purified monoclonal antibodies by methods which include digestion with enzymes, such as pepsin or papain, and/or by cleavage of disulfide bonds by chemical reduction.
- monoclonal antibody fragments encompassed by the present disclosure can be synthesized using an automated peptide synthesizer.
- RNA can be isolated from the hybridoma line and the antibody genes obtained by RT-PCR and cloned into an immunoglobulin expression vector.
- combinatorial immunoglobulin phagemid libraries are prepared from RNA isolated from the cell lines and phagemids expressing appropriate antibodies are selected by panning using viral antigens.
- Antibodies or antigen-binding fragments thereof according to the present disclosure may be defined, in the first instance, by their binding specificity, which in this case is for LAIRl. Those of skill in the art, by assessing the binding specificity/affinity of a given antibody using techniques well known to those of skill in the art, can determine whether such antibodies fall within the scope of the instant claims.
- antibodies and antigen-binding fragments specifically bind to LAIRl.
- such antibodies when bound to LAIRl, such antibodies modulate the activation of LAIRl .
- the antibody or antigen-binding fragment, when bound to LAIRl activates LAIRl.
- the antibody or antigen-binding fragment, when bound to LAIRl suppresses activation of LAIRl.
- the antibody or antigen-binding fragment, when bound to LAIRl can specifically interfere with, block or reduce the interaction between collagen I and LAIRl.
- the antibody or antigen-binding fragment provided herein is capable of inhibiting collagen-mediated activity of LAIRl.
- the antibody or antigen-binding fragment provided herein is capable of enhancing collagen-mediated activity of LAIRl. In certain embodiments, the antibodies or antigen-binding fragments provided herein specifically or selectively bind to human LAIRl (SEQ ID NO: 533).
- the monoclonal antibody or antigen-binding fragment thereof provided herein are capable of specifically binding to LAIRl with a binding affinity about 10 "6 M or less (e.g. 10 "6 M, 10 “8 M, 10 “9 M, 10 "10 M, 10 "11 M, 10 "12 M, 10 ⁇ 13 M) as measured by plasmon resonance binding assay.
- the binding affinity can be represented by KD value, which is calculated as the ratio of dissociation rate to association rate (k kon) when the binding between the antigen and the antigen-binding molecule reaches equilibrium.
- the antigen-binding affinity e.g.
- the monoclonal antibody or antigen-binding fragment thereof provided herein are capable of binding to LAIRl with EC50 (i.e. , 50% binding concentration) of 0.00 ⁇ g/ml- ⁇ g/ml (e.g.
- 0.001 u.g/rnl-0.5ug/ml 0.001 ⁇ g/ml-0.2 ⁇ g/ml, 0.001 g ml-0.1 g ml, 0.01 g ml-0.2 g ml, 0.01 g ml-0.1 g ml, 0.0 ⁇ g ml-0.05 g ml, 0.01 ⁇ g/ml-0.03 ⁇ g/ml or 0.001 g ml-0.01 g ml,) as measured by ELISA, or EC50 of
- O.O ⁇ g ml-l g ml (e.g. 0.01 g ml-0.5 g ml, 0.01 g ml-0.2 g ml, ⁇ . ⁇ - ⁇ ⁇ , 0.05 ⁇ g/ml-0.5 ⁇ g/ml or 0.05 ⁇ g/ml-0.2 ⁇ g/ml) as measured by FACS.
- Binding of the antibodies to LAIRl can be measured by methods known in the art, for example, ELISA, FACS, surface plasmon resonance, GST pull down, epitope-tag, immunoprecipitation, Far- Western, fluorescence resonance energy transfer, time resolved fluorescence immunoassays (TR-FIA), radioimmunoassays (RIA), enzyme immunoassays, latex agglutination, Western blot, and immunohistochemistry or other binding assays.
- the test antibody i.e.
- first antibody is allowed to bind to immobilized LAIRl or cells expressing LAIRl, after washing away the unbound antibody, and a labeled secondary antibody is introduced which can bind to and thus allow the detection of the bound first antibody.
- the detection can be conducted with a microplate reader when immobilized LAIRl is used, or by using FACS analysis when the cells expressing LAIRl are used.
- the antibody or antigen-binding fragment has an IC50 for blocking the binding of collagen to LAIRl of less than ⁇ ⁇ , 1000 nM to 100 nM, 100 nM to 10 nM, 10 nM to 1 nM, 1000 pM to 500 pM, 500 pM to 200 pM, less than 200 pM, 200 pM to 150 pM, 200 pM to 100 pM, 100 pM to 10 pM, 10 pM to 1 pM.
- the antibodies or antigen-binding fragments provided herein having clone-paired CDRs from the heavy and light chains variable region sequences as illustrated in Table 1. Such antibodies may be produced by the clones discussed below in the Examples section using methods described herein.
- each CDR is defined in accordance with Kabat definition, the Chothia definition, the combination of Kabat definition and Chothia definition, the AbM definition, or the contact definition of CDR.
- the antibody or antigen-binding fragment is characterized by clone- paired heavy and light chain CDR sequences from Tables 2 and.
- the antibodies may be defined by their variable sequence, which include additional "framework" regions.
- the antibody is characterized by clone-paired heavy chain and light chain amino acid sequences from Table 1.
- the antibodies sequences may vary from these sequences, particularly in regions outside the CDRs.
- the amino acids may vary from those set out above by a given percentage, e.g. , 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homology, or the amino acids may vary from those set out above by permitting conservative substitutions (discussed below).
- the antibody derivatives of the present disclosure comprise VL and VH domains having up to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more conservative or non-conservative amino acid substitutions, while still exhibiting the desired binding and functional properties.
- the antibodies of the present disclosure were generated as IgG's, it may be useful to modify the constant regions to alter their function.
- the constant regions of the antibodies typically mediate the binding of the antibody to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
- the term "antibody” includes intact immunoglobulins of types IgA, IgG, IgE, IgD, IgM (as well as subtypes thereof), wherein the light chains of the immunoglobulin may be of types kappa or lambda.
- variable and constant regions are joined by a 35 "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids.
- the present disclosure further comprises nucleic acids which hybridize to nucleic acids encoding the antibodies disclosed herein.
- the nucleic acids hybridize under moderate or high stringency conditions to nucleic acids that encode antibodies disclosed herein and also encode antibodies that maintain the ability to specifically bind to an LAIR1.
- a first nucleic acid molecule is "hybridizable" to a second nucleic acid molecule when a single stranded form of the first nucleic acid molecule can anneal to the second nucleic acid molecule under the appropriate conditions of temperature and solution ionic strength (see Sambrook et al., supra). The conditions of temperature and ionic strength determine the
- “stringency” of the hybridization Typical moderate stringency hybridization conditions are 40% formamide, with 5X or 6X SSC and 0.1% SDS at 42°C.
- High stringency hybridization conditions are 50% formamide, 5X or 6X SSC (0.15M NaCl and 0.015M Na-citrate) at 42°C or, optionally, at a higher temperature (e.g. , 57°C, 59°C, 60°C, 62°C, 63°C, 65°C or 68°C).
- Hybridization requires that the two nucleic acids contain complementary sequences, although, depending on the stringency of the hybridization, mismatches between bases are possible.
- the appropriate stringency for hybridizing nucleic acids depends on the length of the nucleic acids and the degree of complementation, variables well known in the art. The greater the degree of similarity or homology between two nucleotide sequences, the higher the stringency under which the nucleic acids may hybridize. For hybrids of greater than 100 nucleotides in length, equations for calculating the melting temperature have been derived (see Sambrook et al, supra). For hybridization with shorter nucleic acids, e.g.,
- oligonucleotides the position of mismatches becomes more important, and the length of the oligonucleotide determines its specificity (see Sambrook et al., supra).
- the present disclosure provides epitopes to which anti-LAIRl antibodies bind.
- epitopes that are bound by the antibodies described herein are useful.
- an epitope provided herein can be utilized to isolate antibodies or antigen binding proteins that bind to LAIR1.
- an epitope provided herein can be utilized to generate antibodies or antigen binding proteins which bind to LAIR1.
- an epitope or a sequence comprising an epitope provided herein can be utilized as an immunogen to generate antibodies or antigen binding proteins that bind to LAIR1.
- an epitope described herein or a sequence comprising an epitope described herein can be utilized to interfere with biological activity of LAIR 1.
- antibodies or antigen-binding fragments thereof that bind to any of the epitopes are particularly useful.
- an epitope provided herein, when bound by an antibody, modulates the biological activity of LAIR1.
- an epitope provided herein, when bound by an antibody activates LAIR1. In some embodiments, an epitope provided herein, when bound by an antibody, suppress the activation of LAIR1. In some embodiments, an epitope provided herein, when bound by an antibody, modulates the interaction between collagen and LAIR1.
- the domain(s)/region(s) containing residues that are in contact with or are buried by an antibody can be identified by mutating specific residues in LAIR1 and determining whether the antibody can bind the mutated LAIR1 protein.
- residues that play a direct role in binding or that are in sufficiently close proximity to the antibody such that a mutation can affect binding between the antibody and antigen can be identified.
- the domain(s) or region(s) of the antigen that contain residues in contact with the antigen binding protein or covered by the antibody can be elucidated.
- Such a domain can include the binding epitope of an antigen binding protein.
- the monoclonal antibody or antigen-binding fragment thereof can specifically bind to the Ig domain of LAIRl (amino acid residues 25-121). In some embodiments, the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope contained within the Ig domain of LAIRl . In some embodiments, the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl contained within the amino acid residues 25-47, 53-81, 88-96 and/or 102-119.
- the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl contained within the amino acid residues 30-34, 45-47 and/or 88-89. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl contained within the amino acid residues 37-41, 116-119, 98-105, 59-63 and/or 66-71.
- the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 30-34, 37-41, 45-47, 59-63, 66- 71, 88-89, 98-105, 108-110 or 116-119. In some embodiments, the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 35-36, 44, 53-56, 64-65, 73-81, 89-96, 106-107 or 111-115.
- the monoclonal antibody or antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 25, 35, 56, 65-68, 73, 75-77, 80, 89, 93, 106, 107 or 109. In some embodiments, the monoclonal antibody or an antigen- binding fragment thereof can specifically bind to an epitope of LAIRl contained within amino acid residues 59-69 and/or 100-112. In some embodiments, the monoclonal antibody or an antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 59, 61, 65, 67, 68, 69, 100, 102, 109, 111 or 112.
- the monoclonal antibody or an antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 59, 61 and 109. In some embodiments, the monoclonal antibody or an antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 61 or 62 of LAIRl . In some embodiments, the monoclonal antibody or an antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 68 or 69 of LAIRl .
- the monoclonal antibody or an antigen-binding fragment thereof can specifically bind to an epitope of LAIRl comprising amino acid residues 61 or 62, 65 or 66, and 111 or 112 of LAIR1. In some embodiments, the monoclonal antibody or an antigen- binding fragment thereof can specifically bind to an epitope of LAIR1 comprising amino acid residues 111 or 112 of LAIR1.
- the present disclosure provides antigen-binding proteins that compete with one of the exemplified antibodies or antigen-binding fragment binding to the epitope described herein for specific binding to LAIR1.
- antigen binding proteins can also bind to the same epitope as one of the herein exemplified antibodies or the antigen- binding fragment, or an overlapping epitope.
- Antigen-binding proteins that compete with or bind to the same epitope as the exemplified antibodies are expected to show similar functional properties.
- the exemplified antibodies include those described above, including those with the heavy and light chain variable regions and CDRs listed in Tables 1-5.
- reasons such as improved expression, improved cross-reactivity or diminished off-target binding.
- the following is a general discussion of relevant techniques for antibody engineering.
- Hybridomas may be cultured, then cells lysed, and total RNA extracted. Random hexamers may be used with RT to generate cDNA copies of RNA, and then PCR performed using a multiplex mixture of PCR primers expected to amplify all human variable gene sequences. PCR product can be cloned into pGEM-T Easy vector, then sequenced by automated DNA sequencing using standard vector primers. Assay of binding and
- IgG neutralization may be performed using antibodies collected from hybridoma supematants and purified by FPLC, using Protein G columns.
- Recombinant full length IgG antibodies may be generated by subcloning heavy and light chain Fv DNAs from the cloning vector into an IgG plasmid vector, transfected into HEK293 cells or CHO cells, and antibodies collected and purified from the HEK293 or CHO cell supernatant.
- Antibody molecules will comprise fragments (such as F(ab'), F(ab')2) that are produced, for example, by the proteolytic cleavage of the mAbs, or single-chain immunoglobulins producible, for example, via recombinant means. Such antibody derivatives are monovalent. In one embodiment, such fragments can be combined with one another, or with other antibody fragments or receptor ligands to form "chimeric" binding molecules. Significantly, such chimeric molecules may contain substituents capable of binding to different epitopes of the same molecule.
- the antibody is a derivative of the disclosed antibodies, e.g., an antibody comprising the CDR sequences identical to those in the disclosed antibodies (e.g., a chimeric, or CDR-grafted antibody).
- an antibody comprising the CDR sequences identical to those in the disclosed antibodies (e.g., a chimeric, or CDR-grafted antibody).
- modifications such as introducing conservative changes into an antibody molecule.
- the hydropathic index of amino acids may be considered.
- the importance of the hydropathic amino acid index in conferring interactive biologic function on a protein is generally understood in the art (Kyte and Doolittle, 1982). It is accepted that the relative hydropathic character of the amino acid contributes to the secondary structure of the resultant protein, which in turn defines the interaction of the protein with other molecules, for example, enzymes, substrates, receptors, DNA, antibodies, antigens, and the like.
- hydrophilicity values have been assigned to amino acid residues: basic amino acids: arginine (+3.0), lysine (+3.0), and histidine (-0.5); acidic amino acids: aspartate (+3.0 ⁇ 1), glutamate (+3.0 ⁇ 1), asparagine (+0.2), and glutamine (+0.2); hydrophilic, nonionic amino acids: serine (+0.3), asparagine (+0.2), glutamine (+0.2), and threonine (-0.4), sulfur containing amino acids: cysteine (-1.0) and methionine (-1.3); hydrophobic, nonaromatic amino acids: valine (-1.5), leucine (-1.8), isoleucine (-1.8), proline (-0.5 ⁇ 1), alanine (-0.5), and glycine (0); hydrophobic, aromatic amino acids: tryptophan (-3.4), phenylalanine (-2.5), and tyrosine (-2.3).
- an amino acid can be substituted for another having a similar hydrophilicity and produce a biologically or immunologically modified protein.
- substitution of amino acids whose hydrophilicity values are within ⁇ 2 is preferred, those that are within ⁇ 1 are particularly preferred, and those within ⁇ 0.5 are even more particularly preferred.
- amino acid substitutions generally are based on the relative similarity of the amino acid side-chain substituents, for example, their hydrophobicity, hydrophilicity, charge, size, and the like.
- Exemplary substitutions that take into consideration the various foregoing characteristics are well known to those of skill in the art and include: arginine and lysine; glutamate and aspartate; serine and threonine; glutamine and asparagine; and valine, leucine and isoleucine.
- the present disclosure also contemplates isotype modification.
- isotype modification By modifying the Fc region to have a different isotype, different functionalities can be achieved. For example, changing to IgGi can increase antibody dependent cell cytotoxicity, switching to class A can improve tissue distribution, and switching to class M can improve valency.
- Modified antibodies may be made by any technique known to those of skill in the art, including expression through standard molecular biological techniques, or the chemical synthesis of polypeptides. Methods for recombinant expression are addressed elsewhere in this document.
- the antibodies disclosed herein can also be engineered to include modifications within the Fc region, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or effector function (e.g. , antigen-dependent cellular cytotoxicity).
- the antibodies disclosed herein can be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more functional properties of the antibody.
- the numbering of residues in the Fc region is that of the EU index of Kabat.
- the antibodies disclosed herein also include antibodies with modified (or blocked) Fc regions to provide altered effector functions. See, e.g. , U.S. Patent No. 5,624,821; WO2003/086310; WO2005/120571 ;
- WO2006/0057702 Such modification can be used to enhance or suppress various reactions of the immune system, with possible beneficial effects in diagnosis and therapy.
- Alterations of the Fc region include amino acid changes (substitutions, deletions and insertions), glycosylation or deglycosylation (deglycosylation may also be referred to as aglycosylaton), and adding multiple Fc. Changes to the Fc can also alter the half-life of antibodies in therapeutic antibodies, enabling less frequent dosing and thus increased convenience and decreased use of material. This mutation has been reported to abolish the heterogeneity of inter-heavy chain disulfide bridges in the hinge region.
- the hinge region of CHI is modified such that the number of cysteine residues in the hinge region is increased or decreased.
- the number of cysteine residues in the hinge region of CHI is altered, for example, to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
- the antibody is modified to increase its biological half-life.
- one or more of the following mutations can be introduced: T252L, T254S, T256F, as described in U.S.
- the antibody can be altered within the CHI or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Patent No.
- the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibodies.
- one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand but retains the antigen binding ability of the parent antibody.
- the effector ligand to which affinity is altered can be, for example, an Fc receptor or the CI component of complement. This approach is described in further detail in U.S. Patent No. 5,624,821 and No. 5,648,260.
- one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the antibody to fix complement.
- This approach is described further in PCT Publication WO 94/29351.
- the Fc region is modified to increase or decrease the ability of the antibodies to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to increase or decrease the affinity of the antibodies for an Fey receptor by modifying one or more amino acids at the following positions: 238, 239, 243, 248, 249, 252, 254, 255, 256, 258, 264, 265, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 301, 303, 305, 307, 309, 312, 315, 320, 322, 324, 326, 327, 329, 330, 331, 333, 334, 335, 337, 338,
- the Fc region is modified to decrease the ability of the antibodies to mediate effector function and/or to increase anti-inflammatory properties by modifying residues 243 and 264.
- the Fc region of the antibody is modified by changing the residues at positions 243 and 264 to alanine.
- the Fc region is modified to decrease the ability of the antibody to mediate effector function and/or to increase anti-inflammatory properties by modifying residues 243, 264, 267 and 328.
- the antibody comprises a particular glycosylation pattern. For example, an aglycosylated antibody can be made (i.e. , the antibody lacks glycosylation).
- the glycosylation partem of an antibody may be altered to, for example, increase the affinity or avidity of the antibody for an antigen. Such modifications can be accomplished by, for example, altering one or more of the glycosylation sites within the antibody sequence. For example, one or more amino acid substitutions can be made that result removal of one or more of the variable region framework glycosylation sites to thereby eliminate glycosylation at that site. Such a glycosylation may increase the affinity or avidity of the antibody for antigen. See, e.g. , U.S. Patent No. 5,714,350 and No. 6,350,861.
- an antibody may also be made in which the glycosylation pattern includes hypofucosylated or afucosylated glycans, such as a hypofucosylated antibodies or afucosylated antibodies have reduced amounts of fucosyl residues on the glycan.
- the antibodies may also include glycans having an increased amount of bisecting GlcNac structures. Such altered glycosylation patterns have been demonstrated to increase the ADCC ability of antibodies. Such modifications can be accomplished by, for example, expressing the antibodies in a host cell in which the glycosylation pathway was been genetically engineered to produce glycoproteins with particular glycosylation patterns.
- the cell lines Ms704, Ms705, and Ms709 lack the fucosyltransferase gene, FUT8 (a (l,6)-fucosyltransferase), such that antibodies expressed in the Ms704, Ms705, and Ms709 cell lines lack fucose on their carbohydrates.
- the Ms704, Ms705, and Ms709 FUT8-/- cell lines were created by the targeted disruption of the FUT8 gene in CHO/DG44 cells using two replacement vectors (see U.S. Patent Publication No. 20040110704.
- EP 1 176 195 describes a cell line with a functionally disrupted FUT8 gene, which encodes a fucosyl transferase, such that antibodies expressed in such a cell line exhibit
- EP 1 176 195 also describes cell lines which have a low enzyme activity for adding fucose to the N- acetylglucosamine that binds to the Fc region of the antibody or does not have the enzyme activity, for example the rat myeloma cell line YB2/0 (ATCC CRL 1662).
- PCT Publication WO 03/035835 describes a variant CHO cell line, Lecl3 cells, with reduced ability to attach fucose to Asn (297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell.
- Antibodies with a modified glycosylation profile can also be produced in chicken eggs, as described in PCT Publication WO 06/089231.
- antibodies with a modified glycosylation profile can be produced in plant cells, such as Lemna (US Patent 7,632,983). Methods for production of antibodies in a plant system are disclosed in the U.S. Patents 6,998,267 and 7,388,081.
- PCT Publication WO 99/54342 describes cell lines engineered to express glycoprotein-modifying glycosyl transferases (e.g., (l,4)-N-acetylglucosaminyltransferase III (GnTIII)) such that antibodies expressed in the engineered cell lines exhibit increased bisecting GlcNac structures which results in increased ADCC activity of the antibodies.
- glycoprotein-modifying glycosyl transferases e.g., (l,4)-N-acetylglucosaminyltransferase III (GnTIII)
- the fucose residues of the antibodies can be cleaved off using a fucosidase enzyme; e.g. , the fucosidase a-L-fucosidase removes fucosyl residues from antibodies.
- a fucosidase enzyme e.g. , the fucosidase a-L-fucosidase removes fucosyl residues from antibodies.
- Antibodies disclosed herein further include those produced in lower eukaryote host cells, in particular fungal host cells such as yeast and filamentous fungi have been genetically engineered to produce glycoproteins that have mammalian- or human-like glycosylation patterns.
- a particular advantage of these genetically modified host cells over currently used mammalian cell lines is the ability to control the glycosylation profile of glycoproteins that are produced in the cells such that compositions of glycoproteins can be produced wherein a particular N-gly can structure predominates (see, e.g. , U.S. Patents 7,029,872 and 7,449,308).
- These genetically modified host cells have been used to produce antibodies that have predominantly particular N-gly can structures.
- fungi such as yeast or filamentous fungi lack the ability to produce fucosylated glycoproteins
- antibodies produced in such cells will lack fucose unless the cells are further modified to include the enzymatic pathway for producing fucosylated glycoproteins (See for example, PCT Publication WO2008112092).
- the antibodies disclosed herein further include those produced in lower eukaryotic host cells and which comprise fucosylated and nonfucosylated hybrid and complex N-glycans, including bisected and multiantennary species, including but not limited to N-glycans such as GlcNAc(l-4)Man3GlcNAc2; Gal(l-4)GlcNAc(l-4)Man3GlcNAc2; NANA(l-4)Gal(l-4)GlcNAc(l-4)Man3GlcNAc2.
- N-glycans such as GlcNAc(l-4)Man3GlcNAc2; Gal(l-4)GlcNAc(l-4)Man3GlcNAc2; NANA(l-4)Gal(l-4)GlcNAc(l-4)Man3GlcNAc2.
- the antibody compositions provided herein may comprise antibodies having at least one hybrid N-glycan selected from the group consisting of GlcNAcMan5GlcNAc2; GalGlcNAcMan5GlcNAc2; and NANAGalGlcNAcMan5GlcNAc2.
- the hybrid N-glycan is the predominant N-glycan species in the composition.
- the hybrid N-glycan is a particular N-glycan species that comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the hybrid N-glycans in the composition.
- the antibody compositions provided herein comprise antibodies having at least one complex N-glycan selected from the group consisting of GlcNAcMan3GlcNAc2; GalGlcNAcMan3GlcNAc2; NANAGalGlcN AcMan3 GlcNAc2; GlcNAc2Man3GlcNAc2; GalGlcNAc2Man3GlcNAc2; Gal2GlcNAc2Man3GlcNAc2; NANAGal2GlcNAc2Man3GlcNAc2; and NANA2Gal2GlcNAc2Man3GlcNAc2.
- N-glycan selected from the group consisting of GlcNAcMan3GlcNAc2; GalGlcNAcMan3GlcNAc2; NANAGalGlcN AcMan3 GlcNAc2; GlcNAc2Man3GlcNAc2; Gal2GlcNAc2Man3GlcNAc2
- the complex N-glycan is the predominant N-glycan species in the composition.
- the complex N-glycan is a particular N-glycan species that comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans in the composition.
- the N-glycan is fusosylated.
- the fucose is in an al,3-linkage with the GlcNAc at the reducing end of the N-glycan, an al,6-linkage with the GlcNAc at the reducing end of the N-glycan, an al,2-linkage with the Gal at the non-reducing end of the N-glycan, an al,3-linkage with the GlcNac at the non-reducing end of the N-glycan, or an al,4-linkage with a GlcNAc at the non-reducing end of the N-glycan.
- the glycoform is in an al,3-linkage or al,6-linkage fucose to produce a glycoform selected from the group consisting of Man5GlcNAc2(Fuc), GlcNAcMan5GlcNAc2(Fuc),
- Gal2(Fucl -2)GlcNAc2Man3GlcNAc2 NANAGal2(Fucl -2)GlcNAc2Man3GlcNAc2
- NANA2Gal2(Fucl-2)GlcNAc2Man3GlcNAc2 NANA2Gal2(Fucl-2)GlcNAc2Man3GlcNAc2.
- the antibodies comprise high mannose N-glycans, including but not limited to, Man8GlcNAc2, Man7GlcNAc2, Man6GlcNAc2, Man5GlcNAc2,
- N-glycans that consist of the Man3GlcNAc2 N-glycan structure.
- the complex N-glycans further include fucosylated and non-fucosylated bisected and multiantennary species.
- N-glycan and “glycoform” are used interchangeably and refer to an N-linked oligosaccharide, for example, one that is attached by an asparagine-Nacetylglucosamine linkage to an asparagine residue of a polypeptide.
- N-linked glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein.
- a Single Chain Variable Fragment is a fusion of the variable regions of the heavy and light chains of immunoglobulins, linked together with a short (usually serine, glycine) linker.
- This chimeric molecule retains the specificity of the original immunoglobulin, despite removal of the constant regions and the introduction of a linker peptide. This modification usually leaves the specificity unaltered.
- These molecules were created historically to facilitate phage display where it is highly convenient to express the antigen binding domain as a single peptide.
- scFv can be created directly from subcloned heavy and light chains derived from a hybridoma.
- Single chain variable fragments lack the constant Fc region found in complete antibody molecules, and thus, the common binding sites (e.g., protein A/G) used to purify antibodies. These fragments can often be purified/immobilized using Protein L since Protein L interacts with the variable region of kappa light chains.
- Flexible linkers generally are comprised of helix- and turn-promoting amino acid residues such as alaine, serine and glycine. However, other residues can function as well.
- Tang et al. (1996) used phage display as a means of rapidly selecting tailored linkers for single-chain antibodies (scFvs) from protein linker libraries.
- scFvs single-chain antibodies
- a random linker library was constructed in which the genes for the heavy and light chain variable domains were linked by a segment encoding an 18-amino acid polypeptide of variable composition.
- the scFv repertoire (approx. 5 ⁇ 10 6 different members) was displayed on filamentous phage and subjected to affinity selection with hapten. The population of selected variants exhibited significant increases in binding activity but retained considerable sequence diversity.
- the recombinant antibodies of the present disclosure may also involve sequences or moieties that permit dimerization or multimerization of the receptors.
- sequences include those derived from IgA, which permit formation of multimers in conjunction with the J-chain.
- Another multimerization domain is the Gal4 dimerization domain.
- the chains may be modified with agents such as biotin/avidin, which permit the combination of two antibodies.
- a single-chain antibody can be created by joining receptor light and heavy chains using a non-peptide linker or chemical unit.
- the light and heavy chains will be produced in distinct cells, purified, and subsequently linked together in an appropriate fashion (i.e. , the N-terminus of the heavy chain being attached to the C-terminus of the light chain via an appropriate chemical bridge).
- Cross-linking reagents are used to form molecular bridges that tie functional groups of two different molecules, e.g. , a stablizing and coagulating agent. However, it is
- dimers or multimers of the same analog or heteromeric complexes comprised of different analogs can be created.
- hetero-bifunctional cross-linkers can be used that eliminate unwanted homopolymer formation.
- An exemplary hetero-bifunctional cross-linker contains two reactive groups: one reacting with primary amine group (e.g., N-hydroxy succinimide) and the other reacting with a thiol group (e.g., pyridyl disulfide, maleimides, halogens, etc.).
- primary amine group e.g., N-hydroxy succinimide
- a thiol group e.g., pyridyl disulfide, maleimides, halogens, etc.
- the cross-linker may react with the lysine residue(s) of one protein (e.g., the selected antibody or fragment) and through the thiol reactive group, the cross-linker, already tied up to the first protein, reacts with the cysteine residue (free sulfhydryl group) of the other protein (e.g., the selective agent).
- cross-linker having reasonable stability in blood will be employed.
- Numerous types of disulfide-bond containing linkers are known that can be successfully employed to conjugate targeting and therapeutic/preventative agents.
- Linkers that contain a disulfide bond that is sterically hindered may prove to give greater stability in vivo, preventing release of the targeting peptide prior to reaching the site of action. These linkers are thus one group of linking agents.
- SMPT cross-linking reagent
- Another cross-linking reagent is SMPT, which is a bifunctional cross-linker containing a disulfide bond that is "sterically hindered" by an adjacent benzene ring and methyl groups. It is believed that steric hindrance of the disulfide bond serves a function of protecting the bond from attack by thiolate anions such as glutathione which can be present in tissues and blood, and thereby help in preventing decoupling of the conjugate prior to the delivery of the attached agent to the target site.
- thiolate anions such as glutathione which can be present in tissues and blood
- the SMPT cross-linking reagent lends the ability to cross-link functional groups such as the SH of cysteine or primary amines (e.g., the epsilon amino group of lysine).
- Another possible type of cross-linker includes the hetero-bifunctional photoreactive phenylazides containing a cleavable disulfide bond such as sulfosuccinimidyl-2-(p-azido salicylamido) ethyl-l,3'-dithiopropionate.
- the N-hydroxy- succinimidyl group reacts with primary amino groups and the phenylazide (upon photolysis) reacts non-selectively with any amino acid residue.
- non-hindered linkers In addition to hindered cross-linkers, non-hindered linkers also can be employed in accordance herewith.
- Other useful cross-linkers include SATA, SPDP and 2-iminothiolane (Wawrzynczak & Thorpe, 1987). The use of such cross-linkers is well understood in the art. Another embodiment involves the use of flexible linkers.
- U.S. Patent No. 4,680,3308 describes bifunctional linkers useful for producing conjugates of ligands with amine-containing polymers and/or proteins, especially for forming antibody conjugates with chelators, drugs, enzymes, detectable labels and the like.
- U.S. Patent No. 5,141,648 and No. 5,563,250 disclose cleavable conjugates containing a labile bond that is cleavable under a variety of mild conditions. This linker is particularly useful in that the agent of interest may be bonded directly to the linker, with cleavage resulting in release of the active agent.
- Particular uses include adding a free amino or free sulfhydryl group to a protein, such as an antibody, or a drug.
- U.S. Patent No. 5,856,456 provides peptide linkers for use in connecting polypeptide constituents to make fusion proteins, e.g., single chain antibodies.
- the linker is up to about 50 amino acids in length, contains at least one occurrence of a charged amino acid (preferably arginine or lysine) followed by a proline, and is characterized by greater stability and reduced aggregation.
- U.S. Patent No. 5,880,270 discloses aminooxy -containing linkers useful in a variety of immunodiagnostic and separative techniques.
- the antibodies of the present disclosure may be purified.
- purified is intended to refer to a composition, isolatable from other components, wherein the protein is purified to any degree relative to its naturally- obtainable state.
- a purified protein therefore also refers to a protein, free from the environment in which it may naturally occur.
- substantially purified this designation will refer to a composition in which the protein or peptide forms the major component of the composition, such as constituting about 50%, about 60%, about 70%, about 80%, about 90%, about 95% or more of the proteins in the composition.
- Protein purification techniques are well known to those of skill in the art. These techniques involve, at one level, the crude fractionation of the cellular milieu to polypeptide and non-polypeptide fractions. Having separated the polypeptide from other proteins, the polypeptide of interest may be further purified using chromatographic and electrophoretic techniques to achieve partial or complete purification (or purification to homogeneity).
- Analytical methods particularly suited to the preparation of a pure peptide are ion-exchange chromatography, exclusion chromatography; polyacrylamide gel electrophoresis; isoelectric focusing.
- Other methods for protein purification include, precipitation with ammonium sulfate, PEG, antibodies and the like or by heat denaturation, followed by centrifugation; gel filtration, reverse phase, hydroxylapatite and affinity chromatography; and combinations of such and other techniques.
- polypeptide in a prokaryotic or eukaryotic expression system and extract the protein using denaturing conditions.
- the polypeptide may be purified from other cellular components using an affinity column, which binds to a tagged portion of the polypeptide.
- affinity column which binds to a tagged portion of the polypeptide.
- Such methods often utilize the selection agent bound to a support, such as a column, filter or bead.
- the antibodies is bound to a support, contaminants removed (e.g. e.g. , washed away), and the antibodies released by applying conditions (salt, heat, etc.).
- compositions comprising anti-LAIRl antibodies and/or antigens for generating the same.
- compositions provided herein comprise a prophylactically or therapeutically effective amount of an antibody or a fragment thereof, and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
- carrier refers to a diluent, excipient, or vehicle with which the therapeutic is administered.
- Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- Water is a particular carrier when the pharmaceutical composition is administered intravenously.
- Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
- Other suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
- compositions can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents.
- These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
- Oral formulations can include standard carriers such as
- compositions will contain a prophylactically or therapeutically effective amount of the antibody or fragment thereof, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient.
- the formulation should suit the mode of administration, which can be oral, intravenous, intraarterial, intrabuccal, intranasal, nebulized, bronchial inhalation, or delivered by mechanical ventilation.
- Antibodies of the present disclosure can be formulated for parenteral administration, e.g. , formulated for injection via the intradermal, intravenous, intramuscular, subcutaneous, intra-tumoral or even intraperitoneal routes.
- the antibodies could alternatively be administered by a topical route directly to the mucosa, for example by nasal drops, inhalation, or by nebulizer.
- Pharmaceutically acceptable salts include the acid salts and those which are formed with inorganic acids such as, for example, hydrochloric or phosphoric acids, or such organic acids as acetic, oxalic, tartaric, mandelic, and the like.
- Salts formed with the free carboxyl groups may also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
- Passive transfer of antibodies known as artificially acquired passive immunity, generally will involve the use of intravenous injections.
- the forms of antibody can be human or animal blood plasma or serum, as pooled human immunoglobulin for intravenous (IVIG) or intramuscular (IG) use, as high-titer human IVIG or IG from immunized or from donors recovering from disease, and as monoclonal antibodies (MAbs).
- IVIG intravenous
- IG intramuscular
- MAbs monoclonal antibodies
- Such immunity generally lasts for only a short period of time, and there is also a potential risk for hypersensitivity reactions, and serum sickness, especially from gamma globulin of
- the antibodies will be formulated in a carrier suitable for injection, i.e. , sterile and syringeable.
- compositions of the disclosure are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water-free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
- a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
- the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline.
- an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
- compositions of the disclosure can be formulated as neutral or salt forms.
- Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
- Antibodies of the present disclosure may be linked to at least one agent to form an antibody conjugate.
- it is conventional to link or covalently bind or complex at least one desired molecule or moiety.
- a molecule or moiety may be, but is not limited to, at least one effector or reporter molecule.
- Effector molecules comprise molecules having a desired activity, e.g. , cytotoxic activity.
- Non-limiting examples of effector molecules which have been attached to antibodies include toxins, anti-tumor agents, therapeutic enzymes, radionuclides, antiviral agents, chelating agents, cytokines, growth factors, and oligo- or polynucleotides.
- reporter molecule is defined as any moiety which may be detected using an assay.
- reporter molecules which have been conjugated to antibodies include enzymes, radiolabels, haptens, fluorescent labels, phosphorescent molecules, chemiluminescent molecules, chromophores, photoaffinity molecules, colored particles or ligands, such as biotin.
- Antibody conjugates are generally preferred for use as diagnostic agents.
- Antibody diagnostics generally fall within two classes, those for use in in vitro diagnostics, such as in a variety of immunoassays, and those for use in vivo diagnostic protocols, generally known as "antibody-directed imaging.”
- Many appropriate imaging agents are known in the art, as are methods for their attachment to antibodies (see, for e.g. , U.S. Patent No. 5,021,236, No.
- the imaging moieties used can be paramagnetic ions, radioactive isotopes, fluorochromes, NMR-detectable substances, and X-ray imaging agents.
- ions such as chromium (III), manganese (II), iron (III), iron (II), cobalt (II), nickel (II), copper (II), neodymium (III), samarium (III), ytterbium (III), gadolinium (III), vanadium (II), terbium (III), dysprosium (III), holmium (III) and/or erbium (III), with gadolinium being particularly preferred.
- Ions useful in other contexts, such as X-ray imaging include but are not limited to lanthanum (III), gold (III), lead (II), and especially bismuth (III).
- radioactive isotopes for therapeutic and/or diagnostic application, one might mention astatine 211 , 14 carbon, 51 chromium, 6 chlorine, "cobalt, 58 cobalt, copper 67 , 152 Eu, gallium 67 , 3 ⁇ 4ydrogen, iodine 123 , iodine 125 , iodine 131 , indium 111 , 59 iron, 2 phosphorus, rhenium 186 , rhenium 188 , 75 selenium, 5 sulphur, technicium 99 " 1 and/or yttrium 90 .
- Radioactively labeled monoclonal antibodies of the present disclosure may be produced according to well- known methods in the art. For instance, monoclonal antibodies can be iodinated by contact with sodium and/or potassium iodide and a chemical oxidizing agent such as sodium hypochlorite, or an enzymatic oxidizing agent, such as lactoperoxidase.
- Monoclonal antibodies according to the disclosure may be labeled with technetium 99 " 1 by ligand exchange process, for example, by reducing pertechnate with stannous solution, chelating the reduced technetium onto a Sephadex column and applying the antibody to this column.
- direct labeling techniques may be used, e.g., by incubating pertechnate, a reducing agent such as SNCh, a buffer solution such as sodium-potassium phthalate solution, and the antibody.
- Intermediary functional groups which are often used to bind radioisotopes which exist as metallic ions to antibody are diethylenetriaminepentaacetic acid (DTP A) or ethylene diaminetetracetic acid (EDTA).
- fluorescent labels contemplated for use as conjugates include Alexa 350, Alexa 430, AMCA, BODIPY 630/650, BODIPY 650/665, BODIPY-FL, BODIPY-R6G, BODIPY-TMR, BODIPY-TRX, Cascade Blue, Cy3, Cy5,6-FAM, Fluorescein Isothiocyanate, HEX, 6-JOE, Oregon Green 488, Oregon Green 500, Oregon Green 514, Pacific Blue, REG, Rhodamine Green, Rhodamine Red, Renographin, ROX, TAMRA, TET,
- Another type of antibody conjugates contemplated in the present disclosure are those intended primarily for use in vitro, where the antibody is linked to a secondary binding ligand and/or to an enzyme (an enzyme tag) that will generate a colored product upon contact with a chromogenic substrate.
- suitable enzymes include urease, alkaline phosphatase, (horseradish) hydrogen peroxidase or glucose oxidase.
- Preferred secondary binding ligands are biotin and avidin and streptavidin compounds. The use of such labels is well known to those of skill in the art and are described, for example, in U.S. Patents
- Yet another known method of site-specific attachment of molecules to antibodies comprises the reaction of antibodies with hapten-based affinity labels.
- hapten-based affinity labels react with amino acids in the antigen binding site, thereby destroying this site and blocking specific antigen reaction.
- this may not be advantageous since it results in loss of antigen binding by the antibody conjugate.
- Molecules containing azido groups may also be used to form covalent bonds to proteins through reactive nitrene intermediates that are generated by low intensity ultraviolet light (Potter and Haley, 1983).
- 2- and 8-azido analogues of purine nucleotides have been used as site-directed photoprobes to identify nucleotide binding proteins in crude cell extracts (Owens & Haley, 1987; Atherton et al, 1985).
- the 2- and 8-azido nucleotides have also been used to map nucleotide binding domains of purified proteins (Khatoon et al, 1989; King et al, 1989; Dholakia ei al, 1989) and may be used as antibody binding agents.
- attachment methods involve the use of a metal chelate complex employing, for example, an organic chelating agent such a
- DTP A diethylenetriaminepentaacetic acid anhydride
- ethylenetriaminetetraacetic acid N- chloro-p-toluenesulfonamide
- Monoclonal antibodies may also be reacted with an enzyme in the presence of a coupling agent such as glutaraldehyde or periodate.
- Conjugates with fluorescein markers are prepared in the presence of these coupling agents or by reaction with an isothiocyanate.
- Patent 4,938,948 imaging of breast tumors is achieved using monoclonal antibodies and the detectable imaging moieties are bound to the antibody using linkers such as methyl-p-hydroxybenzimidate or N-succinimidyl- 3-(4-hydroxyphenyl)propionate.
- the present disclosure further provides methods of using the monoclonal antibody or antigen-binding fragment thereof provided herein.
- cancers While hyperproliferative diseases can be associated with any disease which causes a cell to begin to reproduce uncontrollably, the prototypical example is cancer.
- One of the key elements of cancer is that the cell's normal apoptotic cycle is interrupted and thus agents that interrupt the growth of the cells are important as therapeutic agents for treating these diseases.
- a potential requirement is the presence of LAIRl on the surface of the cancer cell, and in particular on the surface of cancer stem cells, or on the surface of immune cells who are inhibited by such presence of LAIRl .
- Cancer cells that may be treated according to the present disclosure include but are not limited to cells from the bladder, blood, bone, bone marrow, brain, breast, colon, esophagus, gastrointestine, gum, head, kidney, liver, lung, nasopharynx, neck, ovary, prostate, skin, stomach, pancreas, testis, tongue, cervix, or uterus.
- the cancer may specifically be of the following histological type, though it is not limited to these: neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma; lymphoepithelial carcinoma; basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp;
- adenocarcinoma familial polyposis coli
- solid carcinoma carcinoid tumor, malignant
- branchiolo-alveolar adenocarcinoma papillary adenocarcinoma; chromophobe carcinoma; acidophil carcinoma; oxyphilic adenocarcinoma; basophil carcinoma; clear cell
- adenocarcinoma granular cell carcinoma; follicular adenocarcinoma; papillary and follicular adenocarcinoma; nonencapsulating sclerosing carcinoma; adrenal cortical carcinoma;
- endometroid carcinoma skin appendage carcinoma; apocrine adenocarcinoma; sebaceous adenocarcinoma; ceruminous adenocarcinoma; mucoepidermoid carcinoma;
- cystadenocarcinoma papillary cystadenocarcinoma; papillary serous cystadenocarcinoma; mucinous cystadenocarcinoma; mucinous adenocarcinoma; signet ring cell carcinoma; infiltrating duct carcinoma; medullary carcinoma; lobular carcinoma; inflammatory carcinoma; Paget's disease, mammary; acinar cell carcinoma; adenosquamous carcinoma; adenocarcinoma w/squamous metaplasia; thymoma, malignant; ovarian stromal tumor, malignant; thecoma, malignant; granulosa cell tumor, malignant; androblastoma, malignant; Sertoli cell carcinoma; Ley dig cell tumor, malignant; lipid cell tumor, malignant;
- paraganglioma malignant; extra-mammary paraganglioma, malignant; pheochromocytoma; glomangiosarcoma; malignant melanoma; amelanotic melanoma; superficial spreading melanoma; malignant melanoma in giant pigmented nevus; epithelioid cell melanoma; blue nevus, malignant; sarcoma; fibrosarcoma; fibrous histiocytoma, malignant; myxosarcoma; liposarcoma; leiomyosarcoma; rhabdomyosarcoma; embryonal rhabdomyosarcoma; alveolar rhabdomyosarcoma; stromal sarcoma; mixed tumor, malignant; Mullerian mixed tumor; nephroblastoma; hepatoblastoma; carcinosarcoma; mesenchymoma, malignant;
- choriocarcinoma mesonephroma, malignant; hemangiosarcoma; hemangioendothelioma, malignant; Kaposi's sarcoma; hemangiopericytoma, malignant; lymphangiosarcoma;
- osteosarcoma juxtacortical osteosarcoma; chondrosarcoma; chondroblastoma, malignant; mesenchymal chondrosarcoma; giant cell tumor of bone; Ewing's sarcoma; odontogenic tumor, malignant; ameloblastic odontosarcoma; ameloblastoma, malignant; ameloblastic fibrosarcoma; pinealoma, malignant; chordoma; glioma, malignant; ependymoma;
- astrocytoma protoplasmic astrocytoma; fibrillary astrocytoma; astroblastoma; glioblastoma; oligodendroglioma; oligodendroblastoma; primitive neuroectodermal; cerebellar sarcoma; ganglioneuroblastoma; neuroblastoma; retinoblastoma; olfactory neurogenic tumor;
- meningioma malignant; neurofibrosarcoma; neurilemmoma, malignant; granular cell tumor, malignant; malignant lymphoma; Hodgkin's disease; paragranuloma; malignant lymphoma, small lymphocytic; malignant lymphoma, large cell, diffuse; malignant lymphoma, follicular; mycosis fungoides; other specified non-Hodgkin's lymphomas; malignant histiocytosis;
- mast cell sarcoma multiple myeloma; mast cell sarcoma; immunoproliferative small intestinal disease; leukemia; lymphoid leukemia; plasma cell leukemia; erythroleukemia; lymphosarcoma cell leukemia; myeloid leukemia; basophilic leukemia; eosinophilic leukemia; monocytic leukemia; mast cell leukemia; megakaryoblastic leukemia; myeloid sarcoma; and hairy cell leukemia.
- the tumor may comprise an osteosarcoma, angiosarcoma, rhabdosarcoma, leiomyosarcoma, Ewing sarcoma, glioblastoma, neuroblastoma, or leukemia.
- AML Acute myeloid leukemia
- ANLL acute nonlymphocytic leukemia
- AML is a cancer of the myeloid line of blood cells, characterized by the rapid growth of abnormal white blood cells that accumulate in the bone marrow and interfere with the production of normal blood cells.
- AML is the most common acute leukemia affecting adults, and its incidence increases with age.
- AML is a relatively rare disease, accounting for approximately 1.2% of cancer deaths in the United States, its incidence is expected to increase as the population ages.
- AML AML acute myelogenous leukemia
- leukemic cells which causes a drop in red blood cells, platelets, and normal white blood cells.
- These symptoms include fatigue, shortness of breath, easy bruising and bleeding, and increased risk of infection.
- risk factors and chromosomal abnormalities have been identified, but the specific cause is not clear.
- AML progresses rapidly and is typically fatal within weeks or months if left untreated.
- AML has several subtypes; treatment and prognosis varies among subtypes. Five- year survival varies from 15-70%, and relapse rate varies from 33-78%, depending on subtype. AML is treated initially with chemotherapy aimed at inducing a remission; patients may go on to receive additional chemotherapy or a hematopoietic stem cell transplant. Recent research into the genetics of AML has resulted in the availability of tests that can predict which drug or drugs may work best for a particular patient, as well as how long that patient is likely to survive.
- AML A lack of normal white blood cell production makes the patient susceptible to infections; while the leukemic cells themselves are derived from white blood cell precursors, they have no infection-fighting capacity.
- a drop in red blood cell count (anemia) can cause fatigue, paleness, and shortness of breath.
- a lack of platelets can lead to easy bruising or bleeding with minor trauma.
- Enlargement of the spleen may occur in AML, but it is typically mild and asymptomatic. Lymph node swelling is rare in AML, in contrast to acute lymphoblastic leukemia. The skin is involved about 10% of the time in the form of leukemia cutis. Rarely, Sweet's syndrome, a paraneoplastic inflammation of the skin, can occur with AML.
- a number of risk factors for developing AML have been identified, including: other blood disorders, chemical exposures, ionizing radiation, and genetics.
- Preleukemic blood disorders such as myelodysplastic syndrome or
- myeloproliferative disease can evolve into AML; the exact risk depends on the type of MDS/MPS. Exposure to anticancer chemotherapy, in particular alkylating agents, can increase the risk of subsequently developing AML. The risk is highest about three to five years after chemotherapy. Other chemotherapy agents, specifically epipodophyllotoxins and anthracyclines, have also been associated with treatment-related leukemia. These treatment- related leukemias are often associated with specific chromosomal abnormalities in the leukemic cells. Occupational chemical exposure to benzene and other aromatic organic solvents is controversial as a cause of AML. Benzene and many of its derivatives are known to be carcinogenic in vitro.
- the first clue to a diagnosis of AML is typically an abnormal result on a complete blood count. While an excess of abnormal white blood cells (leukocytosis) is a common finding, and leukemic blasts are sometimes seen, AML can also present with isolated decreases in platelets, red blood cells, or even with a low white blood cell count (leukopenia). While a presumptive diagnosis of AML can be made via examination of the peripheral blood smear when there are circulating leukemic blasts, a definitive diagnosis usually requires an adequate bone marrow aspiration and biopsy.
- Marrow or blood is examined via light microscopy, as well as flow cytometry, to diagnose the presence of leukemia, to differentiate AML from other types of leukemia (e.g. , acute lymphoblastic leukemia - ALL), and to classify the subtype of disease (see below).
- a sample of marrow or blood is typically also tested for chromosomal abnormalities by routine cytogenetics or fluorescent in situ hybridization. Genetic studies may also be performed to look for specific mutations in genes such as FLT3, nucleophosmin, and KIT, which may influence the outcome of the disease.
- Cytochemical stains on blood and bone marrow smears are helpful in the distinction of AML from ALL, and in subclassification of AML.
- the combination of a myeloperoxidase or Sudan black stain and a nonspecific esterase stain will provide the desired information in most cases.
- the myeloperoxidase or Sudan black reactions are most useful in establishing the identity of AML and distinguishing it from ALL.
- the nonspecific esterase stain is used to identify a monocytic component in AMLs and to distinguish a poorly differentiated monoblastic leukemia from ALL.
- the diagnosis and classification of AML can be challenging, and should be performed by a qualified hematopathologist or hematologist. In straightforward cases, the presence of certain morphologic features (such as Auer rods) or specific flow cytometry results can distinguish AML from other leukemias; however, in the absence of such features, diagnosis may be more difficult.
- the diagnosis of AML is established by demonstrating involvement of more than 20% of the blood and/or bone marrow by leukemic myeloblasts.
- the French-American-British (FAB) classification is a bit more stringent, requiring a blast percentage of at least 30% in bone marrow (BM) or peripheral blood (PB) for the diagnosis of AML.
- AML must be carefully differentiated from "preleukemic" conditions such as myelodysplastic or myeloproliferative syndromes, which are treated differently.
- APL acute promyelocytic leukemia
- First-line treatment of AML consists primarily of chemotherapy, and is divided into two phases: induction and post-remission (or consolidation) therapy.
- induction therapy is to achieve a complete remission by reducing the number of leukemic cells to an undetectable level;
- consolidation therapy is to eliminate any residual undetectable disease and achieve a cure.
- Hematopoietic stem cell transplantation is usually considered if induction chemotherapy fails or after a patient relapses, although transplantation is also sometimes used as front-line therapy for patients with high-risk disease.
- chemotherapy may not be offered to the very elderly, and the options may include less intense chemotherapy or palliative care.
- AML acute promyelocytic leukemia
- ATRA drug al rafts-retinoic acid
- APL disseminated intravascular coagulation (DIC), complicating the treatment of APL when the promyelocytes release the contents of their granules into the peripheral circulation.
- DIC intravascular coagulation
- the goal of the induction phase is to reach a complete remission.
- Complete remission does not mean the disease has been cured; rather, it signifies no disease can be detected with available diagnostic methods.
- Complete remission is obtained in about 50%-75% of newly diagnosed adults, although this may vary based on the prognostic factors described above.
- the length of remission depends on the prognostic features of the original leukemia. In general, all remissions will fail without additional consolidation therapy.
- the specific type of post-remission therapy is individualized based on a patient's prognostic factors (see above) and general health.
- prognostic factors i.e., inv(16), t(8;21), and t(15;17)
- patients will typically undergo an additional three to five courses of intensive chemotherapy, known as consolidation chemotherapy.
- intensive chemotherapy known as consolidation chemotherapy.
- allogeneic stem cell transplantation is usually recommended if the patient is able to tolerate a transplant and has a suitable donor.
- AML patients with relapsed AML who are not candidates for stem cell transplantation, or who have relapsed after a stem cell transplant, may be offered treatment in a clinical trial, as conventional treatment options are limited.
- Agents under investigation include cytotoxic drugs such as clofarabine, as well as targeted therapies, such as farnesyl transferase inhibitors, decitabine, and inhibitors of MDR1 (multidrug-resistance protein).
- cytotoxic drugs such as clofarabine
- targeted therapies such as farnesyl transferase inhibitors, decitabine, and inhibitors of MDR1 (multidrug-resistance protein).
- MDR1 multidrug-resistance protein
- arsenic trioxide has been tested in trials and approved by the U.S. FDA. Like ATRA, arsenic trioxide does not work with other subtypes of AML.
- MDS myelodysplastic syndrome
- secondary AML myeloproliferative disease
- FLT3 internal tandem duplications have been shown to confer a poorer prognosis in AML. Treating these patients with more aggressive therapy, such as stem-cell transplantation in first remission, has not been shown to enhance long-term survival. ITDs of FLT3 may be associated with leukostasis.
- FDA US Food and Drug Administration
- Rydapt® midostaurin, formerly PKC412
- AML acute myeloid leukemia
- FLT3+ FMS-like tyrosine kinase 3 mutation-positive
- genes being investigated as prognostic factors or therapeutic targets include CEBPA, BAALC, ERG, and NPM1.
- ALL Acute Lymphoblastic Leukemia
- Acute lymphoblastic leukemia or acute lymphoid leukemia is an acute form of leukemia, or cancer of the white blood cells, characterized by the overproduction of cancerous, immature white blood cells—known as lymphoblasts.
- lymphoblasts are overproduced in the bone marrow and continuously multiply, causing damage and death by inhibiting the production of normal cells— such as red and white blood cells and platelets— in the bone marrow and by infiltrating to other organs.
- ALL is most common in childhood with a peak incidence at 2-5 years of age, and another peak in old age.
- ALL are indicative of a reduced production of functional blood cells, because the leukemia wastes the resources of the bone marrow, which are normally used to produce new, functioning blood cells. These symptoms can include fever, increased risk of infection (especially bacterial infections like pneumonia, due to neutropenia;
- symptoms of such an infection include shortness of breath, chest pain, cough, vomiting, changes in bowel or bladder habits), increased tendency to bleed (due to thrombocytopenia) and signs indicative of anemia including pallor, tachycardia (high heart rate), fatigue and headache.
- the symptoms are not specific to ALL, but worsen to the point that medical help is sought. They result from the lack of normal and healthy blood cells because they are crowded out by malignant and immature leukocytes (white blood cells). Therefore, people with ALL experience symptoms from malfunctioning of their erythrocytes (red blood cells), leukocytes, and platelets. Laboratory tests that might show abnormalities include blood count tests, renal function tests, electrolyte tests, and liver enzyme tests.
- the signs and symptoms of ALL are variable but follow from bone marrow replacement and/or organ infiltration, and include generalized weakness and fatigue, anemia, dizziness, frequent or unexplained fever and infection, weight loss and/or loss of appetite, excessive and unexplained bruising, bone pain, joint pain (caused by the spread of "blast” cells to the surface of the bone or into the joint from the marrow cavity), breathlessness, enlarged lymph nodes, liver and/or spleen, pitting edema (swelling) in the lower limbs and/or abdomen, and petechiae, which are tiny red spots or lines in the skin due to low platelet levels.
- cancer is caused by damage to DNA that leads to uncontrolled cellular growth and spreads throughout the body, either by increasing chemical signals that cause growth or by interrupting chemical signals that control growth. Damage can be caused through the formation of fusion genes, as well as the dysregulation of a proto-oncogene via juxtaposition of it to the promoter of another gene, e.g. , the T-cell receptor gene. This damage may be caused by environmental factors such as chemicals, drugs or radiation, and occurs naturally during mitosis or other normal processes (although cells have numerous
- ALL is associated with exposure to radiation and chemicals in animals and humans.
- High level radiation exposure is a known risk factor for developing leukemia, as found by studies of survivors of atom bomb exposure in Hiroshima and Nagasaki.
- exposure to benzene and other chemicals can cause leukemia.
- Epidemiological studies have associated leukemia with workplace exposure to chemicals, but these studies are not as conclusive.
- Diagnosing ALL begins with a medical history, physical examination, complete blood count, and blood smears. Because the symptoms are so general, many other diseases with similar symptoms must be excluded. Typically, the higher the white blood cell count the worse the prognosis. Blast cells are seen on blood smear in the majority of cases (blast cells are precursors (stem cells) to all immune cell lines). A bone marrow biopsy is conclusive proof of ALL. A lumbar puncture (also known as a spinal tap) will indicate if the spinal column and brain have been invaded.
- RNA testing can establish how aggressive the disease is; different mutations have been associated with shorter or longer survival.
- Immunohistochemical testing may reveal TdT or CALLA antigens on the surface of leukemic cells.
- TdT is a protein expressed early in the development of pre-T and pre-B cells
- CALLA is an antigen found in 80% of ALL cases and also in the "blast crisis" of CML.
- Medical imaging (such as ultrasound or CT scanning) can find invasion of other organs commonly the lung, liver, spleen, lymph nodes, brain, kidneys, and reproductive organs.
- the aim is to induce a lasting remission, defined as the absence of detectable cancer cells in the body (usually less than 5% blast cells in the bone marrow).
- Treatment for acute leukemia can include chemotherapy, steroids, radiation therapy, intensive combined treatments
- Chemotherapy is the initial treatment of choice. Most ALL patients will receive a combination of different treatments. There are no surgical options, due to the body-wide distribution of the malignant cells. In general, cytotoxic chemotherapy for ALL combines multiple antileukemic drugs in various combinations. Chemotherapy for ALL consists of three phases: remission induction, intensification, and maintenance therapy.
- Radiation therapy is used on painful bony areas, in high disease burdens, or as part of the preparations for a bone marrow transplant (total body irradiation). Radiation in the form of whole-brain radiation is also used for central nervous system prophylaxis, to prevent recurrence of leukemia in the brain. Whole-brain prophylaxis radiation used to be a common method in treatment of children's ALL. Recent studies showed that CNS chemotherapy provided results as favorable but with less developmental side-effects. As a result, the use of whole-brain radiation has been more limited. Most specialists in adult leukemia have abandoned the use of radiation therapy for CNS
- prophylaxis instead using intrathecal chemotherapy.
- CD 19 is a molecule found on all B- cells and can be used as a means of distinguishing the potentially malignant B-cell population in the patient.
- mice are immunized with the CD 19 antigen and produce anti- CD ⁇ antibodies.
- Hybridomas developed from the mouse spleen cells fused to a myeloma cell line can be developed as a source for the cDNA encoding the CD 19 specific antibody.
- the cDNA is sequenced and the sequence encoding the variable heavy and variable light chains of these antibodies are cloned together using a small peptide linker. This resulting sequence encodes the scFv. This can be cloned into a transgene encoding what will become the endodomain of the CAR. There are varying arrangements of subunits used as the endodomain but they generally consist of the hinge region that attaches to the scFv, a transmembrane region, the intracellular region of a costimulatory molecule such as CD28, and the intracellular domain of CD3-zeta containing ITAM repeats. Other sequences frequently included are: 4-lbb and OX40.
- the final transgene sequence containing the scFv and endodomain sequences is then inserted into immune effector cells that are obtained from the patient and expanded in vitro. In previous trials these have been a type of T-cell capable of cytotoxicity. Inserting the DNA into the effector cell can be accomplished by several methods. Most commonly, this is done using a lentivirus which encodes the transgene.
- Pseudotyped, self-inactivating lenti viruses have been shown to be an effective method for the stable insertion of a desired transgene into the target cell genomic DNA. Other methods include electroporation and transfection but these are limited in their efficacy as transgene expression will diminish over time.
- the gene-modified effector cells are then transplanted back into the patient. Typically this process is done in conjunction with a conditioning regiment such as cyclophosphamide which has been shown to potentiate the effects of infused T-cells. This effect has been attributed to the creation of an immunologic space niche.
- the process as a whole results in an effector cell, typically a T-cell that can recognize a tumor cell antigen in a major histocompatibility complex independent manner and initiate a cytotoxic response
- B-cell chronic lymphocytic leukemia also known as chronic lymphoid leukemia (CLL)
- CLL chronic lymphoid leukemia
- B-CLL affects B cell lymphocytes, which originate in the bone marrow, develop in the lymph nodes, and normally fight infection by producing antibodies.
- B cells grow out of control and accumulate in the bone marrow and blood, where they crowd out healthy blood cells.
- CLL is a stage of small lymphocytic lymphoma (SLL), a type of B-cell lymphoma, which presents primarily in the lymph nodes.
- SLL and SLL are considered the same underlying disease, just with different appearances.
- CLL is a disease of adults. Most (>75%) people newly diagnosed with CLL are over the age of 50, and the majority are men. However, in rare cases, it can occur in teenagers and occasionally in children. Some of these may relate to an inherited predisposition.
- CLL results in swollen lymph nodes, spleen, and liver, and eventually anemia and infections.
- Early CLL is not treated, and late CLL is treated with chemotherapy and monoclonal antibodies.
- CLL DNA analysis has distinguished two major types of CLL, with different survival times.
- CLL that is positive for the marker ZAP-70 has an average survival of 8 years, while CLL negative for ZAP-70 has an average survival of more than 25 years.
- Many patients, especially older ones, with slowly progressing disease can be reassured and may not need any treatment in their lifetimes.
- lymphocytic lymphoma Most people are diagnosed without symptoms as the result of a routine blood test that returns a high white blood cell count. Less commonly, CLL may present with enlarged lymph nodes without a high white blood cell count or no evidence of the disease in the blood. This is referred to as small lymphocytic lymphoma. In some individuals the disease comes to light only after the neoplastic cells overwhelm the bone marrow resulting in anemia producing tiredness or weakness.
- CLL is usually first suspected by the presence of lymphocytosis, an increase in a type of white blood cell, on a complete blood count (CBC) test. This frequently is an incidental finding on a routine physician visit. Most often the lymphocyte count is greater than 4000 cells per microliter ( ⁇ ) of blood, but can be much higher.
- CBC complete blood count
- CLL CLL The diagnosis of CLL is based on the demonstration of an abnormal population of B lymphocytes in the blood, bone marrow, or tissues that display an unusual but
- This atypical molecular partem includes the coexpression of cells surface markers cluster of differentiation 5 (CD5) and cluster of differentiation 23 (CD23).
- CD5 cluster of differentiation 5
- CD23 cluster of differentiation 23
- all the CLL cells within one individual are clonal, that is, genetically identical. In practice, this is inferred by the detection of only one of the mutually exclusive antibody light chains, kappa or lambda, on the entire population of the abnormal B cells.
- Normal B lymphocytes consist of a stew of different antibody-producing cells, resulting in a mixture of both kappa and lambda expressing cells.
- the lack of the normal distribution of kappa and lambda producing B cells is one basis for demonstrating clonality, the key element for establishing a diagnosis of any B cell malignancy (B cell non- Hodgkin lymphoma).
- B cell non- Hodgkin lymphoma B cell non- Hodgkin lymphoma.
- the combination of the microscopic examination of the peripheral blood and analysis of the lymphocytes by flow cytometry to confirm clonality and marker molecule expression is needed to establish the diagnosis of CLL. Both are easily accomplished on a small amount of blood.
- a flow cytometer is an instrument that can examine the expression of molecules on individual cells in fluids. This requires the use of specific antibodies to marker molecules with fluorescent tags recognized by the instrument.
- the lymphocytes are genetically clonal, of the B cell lineage (expressing marker molecules cluster of
- CD 19 differentiation 19
- CD20 characteristically express the marker molecules CD5 and CD23.
- CD5 and CD23 These B cells resemble normal lymphocytes under the microscope, although slightly smaller, and are fragile when smeared onto a glass slide, giving rise to many broken cells, which are called “smudge” or “smear” cells.
- Matutes's CLL score allows the identification of a homogeneous subgroup of classical CLL, that differs from atypical/mixed CLL for the five markers' expression (CD5, CD23, FMC7, CD22 and immunoglobulin light chain) Matutes's CLL scoring system is very helpful for the differential diagnosis between classical CLL and the other B cell chronic lymphoproliferative disorders, but not for the immunological distinction between
- CLL malignant B cells mixed/atypical CLL and mantle cell lymphoma (MCL malignant B cells).
- Discrimination between CLL and MCL can be improved by adding non-routine markers such as CD54 and CD200.
- routine markers the most discriminating feature is the CD20/CD23 mean fluorescence intensity ratio.
- FMC7 expression can surprisingly be misleading for borderline cases.
- Staging determining the extent of the disease, is done with the Rai staging system or the Binet classification (see details) and is based primarily on the presence of a low platelet or red cell count. Early stage disease does not need to be treated.
- CLL treatment focuses on controlling the disease and its symptoms rather than on an outright cure.
- CLL is treated by chemotherapy, radiation therapy, biological therapy, or bone marrow transplantation. Symptoms are sometimes treated surgically (splenectomy removal of enlarged spleen) or by radiation therapy ("de-bulking" swollen lymph nodes).
- Leukemia is rarely associated with pregnancy, affecting only about 1 in 10,000 pregnant women. Treatment for chronic lymphocytic leukemias can often be postponed until after the end of the pregnancy. If treatment is necessary, then giving chemotherapy during the second or third trimesters is less likely to result in pregnancy loss or birth defects than treatment during the first trimester.
- CLL While generally considered incurable, CLL progresses slowly in most cases. Many people with CLL lead normal and active lives for many years— in some cases for decades. Because of its slow onset, early-stage CLL is, in general, not treated since it is believed that early CLL intervention does not improve survival time or quality of life. Instead, the condition is monitored over time to detect any change in the disease pattern.
- the decision to start CLL treatment is taken when the patient's clinical symptoms or blood counts indicate that the disease has progressed to a point where it may affect the patient's quality of life.
- Clinical "staging systems" such as the Rai 4-stage system and the Binet classification can help to determine when and how to treat the patient. Determining when to start treatment and by what means is often difficult; studies have shown there is no survival advantage to treating the disease too early.
- the National Cancer Institute Working Group has issued guidelines for treatment, with specific markers that should be met before it is initiated.
- Combination chemotherapy regimens are effective in both newly diagnosed and relapsed CLL.
- Combinations of fludarabine with alkylating agents produce higher response rates and a longer progression-free survival than single agents:
- FC fludarabine with cyclophosphamide
- FCR fludarabine, cyclophosphamide, and rituximab
- Chemoimmunotherapy with FCR has shown to improve response rates, progression-free survival and overall survival in a large randomized trial in CLL patients selected for good physical fitness. This has been the first clinical trial demonstrating that the choice of a first line therapy can improve the overall survival of patients with CLL.
- Alkylating agents approved for CLL include bendamustine and cyclophosphamide.
- Targeted therapy attacks cancer cells at a specific target, with the aim of not harming normal cells.
- Monoclonal antibodies such as alemtuzumab (directed against CD52), and rituximab and ofatumumab (directed against CD20), are used in CLL.
- Tyrosine kinase inhibitor therapy can also be used in CLL.
- Ibrutinib is a Bruton's tyrosine kinase (BTK) inhibitor.
- Idelalisib is a PI3K inhibitor that targets the ⁇ pathway. It is taken orally.
- hematopoietic stem cell transplantation hematopoietic stem cell transplantation
- Myeloablative (bone marrow killing) forms of allogeneic stem cell transplantation a high-risk treatment using blood cells from a healthy donor, may be curative, but treatment-related toxicity is significant.
- An intermediate level, called reduced-intensity conditioning allogeneic stem cell transplantation may be better tolerated by older or frail patients.
- Refractory CLL is a disease that no longer responds favorably to treatment.
- more aggressive therapies including lenalidomide, flavopiridol, and bone marrow (stem cell) transplantation, are considered.
- the monoclonal antibody, alemtuzumab (directed against CD52) may be used in patients with refractory, bone marrow-based disease.
- Complications include Richter's syndrome, hypogammaglobulinemia leading to recurrent infection, warm autoimmune hemolytic anemia in 10-15% of patients,
- Chronic lymphocytic leukemia may transform into Richter's syndrome, the development of fast-growing diffuse large B cell lymphoma, prolymphocytic leukemia, Hodgkin's lymphoma, or acute leukemia in a patient who has chronic lymphocytic leukemia. Its incidence is estimated to be around 5 percent in patients with CLL.
- Gastrointestinal (GI) involvement can rarely occur with chronic lymphocytic leukemia. Some of the reported manifestations include intussusception, small intestinal bacterial contamination, colitis and others. Usually, GI complications with CLL occur after Richter transformation. There have been two case reports to date of GI involvement in chronic lymphocytic leukemia without Richter's transformation.
- Non-small-cell lung carcinoma is any type of epithelial lung cancer other than small cell lung carcinoma (SCLC).
- SCLC small cell lung carcinoma
- NSCLCs are relatively insensitive to chemotherapy, compared to small cell carcinoma. When possible, they are primarily treated by surgical resection with curative intent, although chemotherapy is increasingly being used both pre-operatively (neoadjuvant chemotherapy) and post-operatively (adjuvant chemotherapy).
- NSCLC non-small-cell lung cancer
- NOS non-small-cell lung cancer
- Lung cancer in never-smokers is almost universally NSCLC, with a sizeable majority being adenocarcinoma.
- malignant lung tumors are found to contain components of both SCLC and NSCLC.
- the tumors should be classified as combined small cell lung carcinoma (c-SCLC), and are (usually) treated like "pure" SCLC.
- Adenocarcinoma of the lung is currently the most common type of lung cancer in "never smokers" (lifelong non-smokers). Adenocarcinomas account for approximately 40% of lung cancers. Historically, adenocarcinoma was more often seen peripherally in the lungs than small cell lung cancer and squamous cell lung cancer, both of which tended to be more often centrally located. Interestingly, however, recent studies suggest that the "ratio of centrally -to-peripherally occurring" lesions may be converging toward unity for both adenocarcinoma and squamous cell carcinoma.
- SCC Squamous cell carcinoma
- LCLC Large cell lung carcinoma
- SCLC small cell lung carcinoma
- NSCLCs are usually not very sensitive to chemotherapy and/or radiation, so surgery is the treatment of choice if diagnosed at an early stage, often with adjuvant (ancillary) chemotherapy involving cisplatin.
- Other treatment choices are chemotherapy, radiation therapy (radiotherapy), and targeted therapy.
- New methods of giving radiation treatment allow doctors to be more accurate in treating lung cancers. This means less radiation affects nearby healthy tissues.
- New methods include Cyberknife and stereotactic radiosurgery (SRS).
- SRS stereotactic radiosurgery
- Other treatments are radiofrequency ablationand chemoembolization.
- chemotherapies are used in advanced (metastatic) NSCLC. Some patients with particular mutations in the EGFR gene respond to EGFR tyrosine kinase inhibitors such as gefitinib. About 7% of NSCLC have EML4-ALK translocations; these may benefit from ALK inhibitors which are in clinical trials. Crizotinib gained FDA approval in August 2011.
- Stomach cancer or gastric cancer is cancer developing from the lining of the stomach. Early symptoms may include heartburn, upper abdominal pain, nausea and loss of appetite. Later signs and symptoms may include weight loss, yellow skin, vomiting, difficulty swallowing, and blood in the stool among others.
- the cancer may spread from the stomach to other parts of the body, particularly the liver, lungs, bones, lining of the abdomen and lymph nodes.
- the prognosis of stomach cancer is generally poor, due to the fact the tumor has often metastasized by the time of discovery and the fact that most people with the condition are elderly (median age is between 70 and 75 years) at presentation. The 5-year survival rate for stomach cancer is reported to be less than 10%.
- H. pylori The most common cause is infection by the bacteria Helicobacter pylori, which accounts for more than 60% of cases. Certain types of H. pylori have greater risks than others. Other common causes include eating pickled vegetables and smoking. About 10% of cases run in families and between 1% and 3% of cases are due to genetic syndromes inherited from a person's parents such as hereditary diffuse gastric cancer. Most cases of stomach cancers are gastric carcinomas. This type can be divided into a number of subtypes. Lymphomas and mesenchymal tumors may also develop within the stomach. Most of the time, stomach cancer develops through a number of stages over a number of years. Diagnosis is usually by biopsy done during endoscopy. This is then followed by medical imaging to determine if the disease has spread to other parts of the body. Japan and South Korea, two countries that have high rates of disease, screen for stomach cancer.
- a Mediterranean diet lowers the risk of cancer as does the stopping of smoking. There is tentative evidence that treating H. pylori decreases the future risk. If cancer is treated early, many cases can be cured. Treatments may include some combination of surgery, chemotherapy, radiation therapy, and targeted therapy. If treated late, palliative care may be advised. Outcomes are often poor with a less than 10% 5-year survival rate globally. This is largely because most people with the condition present with advanced disease. In the United States 5-year survival is 28% while in South Korea it is over 65% partly due to screening efforts. [00316] Globally stomach cancer is the fifth leading cause of cancer and the third leading cause of death from cancer making up 7% of cases and 9% of deaths.
- Stomach cancer is often either asymptomatic (producing no noticeable symptoms) or it may cause only nonspecific symptoms (symptoms that are specific not only to stomach cancer, but also to other related or unrelated disorders) in its early stages. By the time symptoms occur, the cancer has often reached an advanced stage (see below) and may have also metastasized (spread to other, perhaps distant, parts of the body), which is one of the main reasons for its relatively poor prognosis. Early cancers may be associated with indigestion or a burning sensation (heartburn). However, less than 1 in every 50 people referred for endoscopy due to indigestion has cancer. Abdominal discomfort and loss of appetite, especially for meat, can occur.
- Gastric cancers that have enlarged and invaded normal tissue can cause weakness, fatigue, bloating of the stomach after meals, abdominal pain in the upper abdomen, nausea and occasional vomiting, diarrhea or constipation. Further enlargement may cause weight loss or bleeding with vomiting blood or having blood in the stool, the latter apparent as black discolouration (melena) and sometimes leading to anemia. Dysphagia suggests a tumour in the cardia or extension of the gastric tumor into the esophagus.
- Gastric cancer is a multifactorial disease.
- Helicobacter pylori infection is an essential risk factor in 65-80% of gastric cancers, but in only 2% of such infections.
- the mechanism by which H. pylori induces stomach cancer potentially involves chronic inflammation, or the action of H. pylori virulence factors such as CagA.
- Smoking increases the risk of developing gastric cancer significantly, from 40% increased risk for current smokers to 82% increase for heavy smokers. Gastric cancers due to smoking mostly occur in the upper part of the stomach near the esophagus. Some studies show increased risk with alcohol consumption as well.
- Gastric cancer shows a male predominance in its incidence as up to two males are affected for every female. Estrogen may protect women against the development of this cancer form. Approximately 10% of cases show a genetic component.
- a genetic risk factor for gastric cancer is a genetic defect of the CDH1 gene known as hereditary diffuse gastric cancer (HDGC).
- the CDH1 gene which codes for E-cadherin, lies on the 16th chromosome.
- This mutation is considered autosomal dominant meaning that half of a carrier's children will likely experience the same mutation.
- Diagnosis of hereditary diffuse gastric cancer usually takes place when at least two cases involving a family member, such as a parent or grandparent, are diagnosed, with at least one diagnosed before the age of 50. The diagnosis can also be made if there are at least three cases in the family, in which case age is not considered.
- Gastroscopic exam is the diagnostic method of choice. This involves insertion of a fibre optic camera into the stomach to visualize it.
- Upper GI series may be called barium roentgenogram).
- Computed tomography or CT scanning of the abdomen may reveal gastric cancer, but is more useful to determine invasion into adjacent tissues, or the presence of spread to local lymph nodes. Wall thickening of more than 1 cm that is focal, eccentric and enhancing favours malignancy.
- gastroscopic modalities have been developed to increase yield of detected mucosa with a dye that accentuates the cell structure and can identify areas of dysplasia. Endocytoscopy involves ultra-high magnification to visualise cellular structure to better determine areas of dysplasia. Other gastroscopic modalities such as optical coherence tomography are also being tested investigationally for similar applications.
- a number of cutaneous conditions are associated with gastric cancer.
- Other cutaneous manifestations of gastric cancer include tripe palms (a similar darkening hyperplasia of the skin of the palms) and the Leser-Trelat sign, which is the rapid development of skin lesions known as seborrheic keratoses.
- Various blood tests may be performed including a complete blood count (CBC) to check for anaemia, and a fecal occult blood test to check for blood in the stool.
- CBC complete blood count
- fecal occult blood test to check for blood in the stool.
- EMR endoscopic mucosal resection
- stomach cancer has no firmly established standard of care.
- chemotherapy if used, has usually served to palliatively reduce the size of the tumor, relieve symptoms of the disease and increase survival time.
- Some drugs used in stomach cancer treatment have included: 5-FU (fluorouracil) or its analog capecitabine, BCNU (carmustine), methyl-CCNU (semustine) and doxorubicin (Adriamycin), as well as mitomycin C, and more recently cisplatin and taxotere, often using drugs in various combinations.
- 5-FU fluorouracil
- BCNU carmustine
- methyl-CCNU methyl-CCNU
- doxorubicin Adriamycin
- Radiotherapy also called radiotherapy
- stomach cancer often as an adjuvant to chemotherapy and/or surgery.
- the present disclosure provides methods of treating a LAIR1 associated condition in a subject, comprising administering to the subject a therapeutically effective amount of the monoclonal antibody or antigen-binding fragment thereof provided herein.
- the present disclosure provides methods of preventing, detecting, or diagnosing LAIR1 associated condition, comprising contacting the monoclonal antibody or the antigen-binding fragments thereof provided herein with a biological sample obtained from a subject suspect of or having or at risk of having the LAIR1 associated condition and determining the level of LAIR1 antibody or the antigen-binding fragments thereof that binds to LAIR1 in the biological sample.
- the therapeutically effective amount (when used alone or in combination with other agents such as chemotherapeutic agents) of an antibody or antigen-binding fragment thereof provided herein will depend on various factors known in the art, such as for example type of disease to be treated, the type of antibody, body weight, age, past medical history, present medications, state of health of the subject, immune condition and potential for cross-reaction, allergies, sensitivities and adverse side-effects, as well as the administration route and the type, the severity and development of the disease and the discretion of the attending physician or veterinarian.
- the monoclonal antibody or antigen- binding fragment thereof provided herein may be administered at a therapeutically effective dosage of about 0.001 mg/kg to about 100 mg/kg one or more times per day (e.g. , about 0.001 mg/kg, about 0.3 mg/kg, about 0.5 mg/kg, about 1 mg/kg, about 3 mg/kg, about 5 mg/kg, about 10 mg/kg, about 15 mg/kg, about 20 mg/kg, about 25 mg/kg, about 30 mg/kg, about 35 mg/kg, about 40 mg/kg, about 45 mg/kg, about 50 mg/kg, about 55 mg/kg, about 60 mg/kg, about 65 mg/kg, about 70 mg/kg, about 75 mg/kg, about 80 mg/kg, about 85 mg/kg, about 90 mg/kg, about 95 mg/kg, or about 100 mg/kg one or more times per day).
- a therapeutically effective dosage of about 0.001 mg/kg to about 100 mg/kg one or more times per day (e.g. , about 0.001 mg
- the monoclonal antibody or antigen-binding fragment thereof is administered at a dosage of about 50 mg/kg or less, and in certain embodiments the dosage is 20 mg/kg or less, 10 mg/kg or less, 3 mg/kg or less, 1 mg/kg or less, 0.3 mg/kg or less, 0.1 mg/kg or less, or 0.01 mg/kg or less, or 0.001 mg/kg or less.
- the administration dosage may change over the course of treatment. For example, in certain embodiments the initial administration dosage may be higher than the subsequent administration dosages. In certain embodiments, the administration dosage may vary over the course of treatment depending on the reaction of the subject.
- Dosage regimens may be adjusted to provide the optimum desired response (e.g. , a therapeutic response).
- the monoclonal antibody or antigen-binding fragment thereof provided herein is administered to the subject at one time or over a series of treatments.
- the monoclonal antibody or antigen-binding fragment thereof provided herein is administered to the subject by one or more separate administrations, or by continuous infusion depending on the type and severity of the disease.
- Guidance can be found in for example, U.S. Patent No. 4,657,760; 5,206,344; 5,225,212.
- the monoclonal antibody and antigen-binding fragments provided herein may be administered by any route known in the art, such as for example parenteral (e.g. ,
- intraperitoneal including intravenous infusion, intramuscular, or intradermal injection
- non-parenteral e.g. , oral, intranasal, intraocular, sublingual, rectal, or topical
- the monoclonal antibody and antigen-binding fragments thereof provided herein may be administered in a controlled-release manner.
- a controlled- release parenteral preparations can be made as implants, oily injections or particulate systems (e.g. microspheres, microparticles, microcapsules, nanocapsules, nanospheres, and
- the monoclonal antibody and antigen-binding fragments thereof disclosed herein may be administered in degradable or nondegradable polymeric matrices (see Langer, Accounts Chem. Res. 26:537-542, 1993).
- Conditions associated with LAIR1 can be immune related diseases or disorders, infections, and cancers.
- the condition is solid tumors, hematological disorders, infectious diseases, autoimmune diseases or fibrotic diseases.
- the solid tumors include, for example, non-small cell lung cancer (squamous / nonsquamous), small cell lung cancer, renal cell cancer, colorectal cancer, colon cancer, ovarian cancer, breast cancer (including basal breast carcinoma, ductal carcinoma and lobular breast carcinoma), pancreatic cancer, gastric carcinoma, bladder cancer, esophageal cancer, mesothelioma, melanoma, head and neck cancer, thyroid cancer, sarcoma, prostate cancer, glioblastoma, cervical cancer, thymic carcinoma, melanoma, myelomas, mycoses fungoids, merkel cell cancer, hepatocellular carcinoma (HCC), fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, and other sarcomas, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, and other
- the hematologic disorders include, for example, classical Hodgkin lymphoma (CHL), primary mediastinal large B-cell lymphoma, T- cell/histiocyte-rich B-cell lymphoma, acute lymphocytic leukemia (ALL), acute myelocytic leukemia, acute myelogenous leukemia and myeloblastic, promyelocytic, myelomonocytic, monocytic leukemia and erythroleukemia, chronic myelocytic (granulocytic) leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, polycythemia vera, mast cell derived tumors, EBV-positive and -negative PTLD, and diffuse large B-cell lymphoma (DLBCL), plasmablastic lymphoma, extranodal NK/T-cell lymphoma, nasopharyngeal carcinoma, and HHV8-associated primary effusion
- CHL
- the monoclonal antibody or antigen-binding fragment thereof provided herein can be administered alone or in combination with one or more additional therapeutic agents or means.
- the monoclonal antibody or antigen- binding fragments thereof provided herein may be administered in combination with a second therapy, such as radiation therapy, chemotherapy, targeted therapies, gene therapy, immunotherapy, hormonal therapy, angiogenesis inhibition, palliative care, surgery for the treatment of cancer (e.g., tumorectomy), one or more anti-emetics or other treatments for complications arising from chemotherapy, or a second therapeutic agent for use in the treatment of cancer or any medical disorder mediated by LAIR1, for example, another antibody, therapeutic polynucleotide, chemotherapeutic agent(s), anti-angiogenic agent, cytokines, other cytotoxic agent(s), growth inhibitory agent(s).
- a second therapy such as radiation therapy, chemotherapy, targeted therapies, gene therapy, immunotherapy, hormonal therapy, angiogenesis inhibition, palliative care, surgery for the treatment of cancer (e.g., tumorectomy), one or
- the monoclonal antibody or antigen-binding fragment thereof provided herein may be administered simultaneously with the one or more additional therapeutic agents, and in certain of these embodiments the monoclonal antibody or antigen-binding fragment thereof and the additional therapeutic agent(s) may be administered as part of the same
- an antibody or antigen-binding fragment thereof administered "in combination" with another therapeutic agent does not have to be administered simultaneously with or in the same composition as the agent.
- An antibody or antigen-binding fragment thereof administered prior to or after another agent is considered to be administered "in combination" with that agent as the phrase is used herein, even if the antibody or antigen-binding fragment and second agent are administered via different routes.
- additional therapeutic agents administered in combination with the monoclonal antibody or antigen-binding fragments thereof provided herein are administered according to the schedule listed in the product information sheet of the additional therapeutic agent, or according to the Physicians' Desk Reference 2003 (Physicians' Desk Reference, 57th Ed; Medical Economics Company; ISBN: 1563634457; 57th edition (November 2002)) or protocols well known in the art.
- This process may involve contacting the cells/subjects with the both agents/therapies at the same time, e.g. , using a single composition or pharmacological formulation that includes both agents, or by contacting the cell/subject with two distinct compositions or formulations, at the same time, wherein one composition includes the antibody and the other includes the other agent.
- the antibody may precede or follow the other treatment by intervals ranging from minutes to weeks.
- Particular agents contemplated for combination therapy with antibodies of the present disclosure include chemotherapy and hematopoietic stem cell transplantation.
- Chemotherapy may include cytarabine (ara-C) and an anthracycline (most often
- daunorubicin high-dose cytarabine alone
- all-iraws-retinoic acid ATRA
- ATRA all-iraws-retinoic acid
- an anthracycline usually an anthracycline, histamine dihydrochloride (Ceplene) and interleukin 2 (Proleukin) after the completion of consolidation therapy
- gemtuzumab ozogamicin Mylotarg
- kinase inhibitors farnesyl transferase inhibitors
- decitabine inhibitors of MDR1
- multidrug-resistance protein multidrug-resistance protein
- arsenic trioxide arsenic trioxide or relapsed acute promyelocytic leukemia (APL).
- the agents for combination therapy are selected from the groups consisting of an anthracycline topoisomerase inhibitor, a daunorubicin, a nucleoside metabolic inhibitor, a cytarabine, a combination of daunorubicin and cytarabine, a
- daunorubicin and cytarabine liposome for injection Vyxeos, an all-trans-retinoic acid (ATRA), an arsenic, an arsenic trioxide, a histamine dihydrochloride, Ceplene, an
- interleukin-2 Proleukin, a gemtuzumab ozogamicin, Mylotarg, a clofarabine, a famesyl transferase inhibitor, a decitabine, an IDHl inhibitor, an IDH2 inhibitor, an enasidenib, Idhifa, an IDO inhibitor, an epacadostat, a platinum complex derivative, oxaliplatin, a kinase inhibitor, a tyrosine kinase inhibitor, a PI3 kinase inhibitor, a BTK inhibitor, ibrutinib, a PD-1 antibody, a PD-L1 antibody, a CTLA-4 antibody, a LAG3 antibody, an ICOS antibody, a TIGIT antibody, a TIM3 antibody, an antibody binding to a tumor antigen, an antibody binding to a T-cell surface marker, an antibody binding to a myeloid cell or NK cell surface marker, an alkylating agent, a
- the present disclosure provides methods of using the antibodies or the antigen-binding fragment thereof as disclosed herein to treat immune disorders, including without limitation, inflammation, autoimmune diseases and transplant rejections.
- An autoimmune disease refers to a condition arising from an abnormal immune response to a normal body part. There are more than 80 illnesses caused by autoimmune diseases. Nearly any body part can be involved. Autoimmune diseases have a wide variety of different effects, including damage to or destruction of tissues, altered organ growth and altered organ function. About 24 million (7%) people in the United States are affected by an autoimmune disease.
- Some common diseases that are considered as an autoimmune disease or inflammation in nature include rheumatoid arthritis, systemic lupus erythematosus, alopecia areata, ankylosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease, autoimmune lymphoproliferative syndrome (ALPS), autoimmune thrombocytopenic purpura (ATP), Behcet's disease, bullous pemphigoid, cardiomyopathy, celiac disease, celiac sprue- dermatitis, chronic fatigue immune deficiency syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, cicatricial pemphigoid, cold agglutinin disease, Crest syndrome, Crohn's disease, Dego's disease, dermatomyositis, dermatomyositis-juvenile, discoid
- ITP thrombocytopenia purpura
- IgA IgA nephropathy
- inflammatory bowel disease insulin dependent diabetes (or Type I diabetes)
- juvenile arthritis Meniere's disease, mixed connective tissue disease, multiple sclerosis, myasthenia gravis, pemphigus vulgaris, pernicious anemia, polyarteritis nodosa, polychondritis, polyglandular syndromes, polymyalgia rheumatic, polymyositis and dermatomyositis, primary biliary cirrhosis, psoriasis, Raymond's phenomenon, Reiter's syndrome, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, stiff-man syndrome, systemic lupus erythematosus, Takayasu arteritis, temporal arteritis/giant cell arteritis, ulcerative colitis,
- Rheumatoid arthritis is a long-term autoimmune disease that primarily affects joints, typically resulting in warm, swollen and painful joints. Other symptoms include low red blood cell count, inflammation around the lungs and the heart, fever and low energy. While the cause of rheumatoid arthritis is not clear, it is believed to involve a combination of genetic and environment factors. The underlying mechanism involves the body's immune system mistakenly attacking the joints, resulting in inflammation and thickening of the joint capsule and also affecting the underlying bone and cartilage.
- Systemic lupus erythematosus also known as lupus, is an disease in which the body's immune system mistakenly attacks healthy tissues in many parts of the body.
- lupus Common symptoms include panful and swollen joints, fever, chest pain, hair loss, mouth ulcers, swollen lymph nodes, feeling tired, and a red rash most commonly on the face. While the cause of lupus is still unknown, it may involve both genetic and environmental factors. The mechanism of lupus involves an immune response by autoantibodies against a person's own tissues, which are most commonly anti-nuclear antibodies that result in inflammation.
- Type 1 diabetes is a form of diabetes mellitus in which not enough insulin is produced, which results in high blood sugar levels in the body.
- the symptoms of type 1 diabetes include frequent urination, increased thirst, increased hunger, weight loss, blurry vision, feeling tired and poor healing. While the cause of type 1 diabetes is unknown, the underlying mechanism involves an autoimmune destruction of the insulin-producing beta cells in the pancreas.
- Multiple sclerosis is an autoimmune disease in which the insulating covers of nerve cells in the brain and spinal cord are damaged by a person's own immune system. The damage disrupts the ability of the nervous system to communicate, causing a range of symptoms including double vision, blindness in one eye, muscle weakness, trouble with sensation, or trouble with coordination. While the cause is not clear, the underlying mechanism of multiple sclerosis is thought to be destruction by the immune system.
- Proposed cause include genetic and environment factors.
- autoimmune diseases are pervasive, their cause is generally unclear.
- the human adaptive immune system including both T cells and B cells, is capable of being reactive with self-antigens. But these self-reactive T cells and B cells are usually either killed prior to becoming active within the immune system, placed into a state of anergy, or removed from their role within the immune system by regulatory cells. When any one of these mechanisms fail, some self-reactive cells may become functional within the immune system and cause autoimmune diseases.
- Transplant rejection occurs when grafted tissue is rejected by the recipient's immune system, which destroys the grafted tissue.
- the underlying mechanism of rejection involves a combination of an adaptive immune response via cellular immunity which is mediated by killer T cells and humoral immunity mediated by activated B cells.
- Some components of innate immune response such as phagocytes and soluble immune protein, may also be involved.
- Acute transplant rejection may be treated with immunosuppressive therapy.
- Immunosuppressive drugs include corticosteroids, such as prednisolone and hydrocortisone, calcineurin inhibitors and mTOR inhibitors. Antibody specific to select immune components can also be used in immunosuppressive therapy.
- the present disclosure concerns immunodetection methods for binding, purifying, removing, quantifying and otherwise generally detecting LAIR-related cancers. While such methods can be applied in a traditional sense, another use will be in quality control and monitoring of vaccine and other virus stocks, where antibodies according to the present disclosure can be used to assess the amount or integrity (i.e., long term stability) of HI antigens in viruses. Alternatively, the methods may be used to screen various antibodies for appropriate/desired reactivity profiles.
- Some immunodetection methods include enzyme linked immunosorbent assay (ELISA), radioimmunoassay (RIA), immunoradiometric assay, fluoroimmunoassay, chemiluminescent assay, bioluminescent assay, and Western blot to mention a few.
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- immunoradiometric assay fluoroimmunoassay
- fluoroimmunoassay fluoroimmunoassay
- chemiluminescent assay chemiluminescent assay
- bioluminescent assay bioluminescent assay
- Western blot to mention a few.
- a competitive assay for the detection and quantitation of LAIRl also is provided.
- the steps of various useful immunodetection methods have been described in the scientific literature, such as, e.g. , Doolittle and Ben-Zeev (1999), Gulbis and Gal
- the immunobinding methods include obtaining a sample suspected of containing LAIRl -related cancers, and contacting the sample with a first antibody in accordance with the present disclosure, as the case may be, under conditions effective to allow the formation of immunocomplexes.
- These methods include methods for detecting or purifying LAIRl or LAIRl -related cancer cells from a sample.
- the antibody will preferably be linked to a solid support, such as in the form of a column matrix, and the sample suspected of containing the LAIRl -related cancer cells will be applied to the immobilized antibody.
- the unwanted components will be washed from the column, leaving the LAIRl -expressing cells immunocomplexed to the immobilized antibody, which is then collected by removing the organism or antigen from the column.
- the immunobinding methods also include methods for detecting and quantifying the amount of LAIRl -related cancer cells or related components in a sample and the detection and quantification of any immune complexes formed during the binding process.
- a sample suspected of containing LAIRl -related cancer cells and contact the sample with an antibody that binds LAIRl or components thereof, followed by detecting and quantifying the amount of immune complexes formed under the specific conditions.
- the biological sample analyzed may be any sample that is suspected of containing LAIRl -related cancers, such as a tissue section or specimen, a homogenized tissue extract, a biological fluid, including blood and serum, or a secretion, such as feces or urine.
- the sample-antibody composition such as a tissue section, ELISA plate, dot blot or Western blot, will generally be washed to remove any non-specifically bound antibody species, allowing only those antibodies specifically bound within the primary immune complexes to be detected.
- the antibody employed in the detection may itself be linked to a detectable label, wherein one would then simply detect this label, thereby allowing the amount of the primary immune complexes in the composition to be determined.
- the first antibody that becomes bound within the primary immune complexes may be detected by means of a second binding ligand that has binding affinity for the antibody.
- the second binding ligand may be linked to a detectable label.
- the second binding ligand is itself often an antibody, which may thus be termed a "secondary" antibody.
- the primary immune complexes are contacted with the labeled, secondary binding ligand, or antibody, under effective conditions and for a period of time sufficient to allow the formation of secondary immune complexes.
- the secondary immune complexes are then generally washed to remove any non-specifically bound labeled secondary antibodies or ligands, and the remaining label in the secondary immune complexes is then detected.
- Further methods include the detection of primary immune complexes by a two-step approach.
- a second binding ligand such as an antibody that has binding affinity for the antibody, is used to form secondary immune complexes, as described above.
- the secondary immune complexes are contacted with a third binding ligand or antibody that has binding affinity for the second antibody, again under effective conditions and for a period of time sufficient to allow the formation of immune complexes (tertiary immune complexes).
- the third ligand or antibody is linked to a detectable label, allowing detection of the tertiary immune complexes thus formed. This system may provide for signal amplification if this is desired.
- One method of immunodetection uses two different antibodies.
- a first biotinylated antibody is used to detect the target antigen, and a second antibody is then used to detect the biotin attached to the complexed biotin.
- the sample to be tested is first incubated in a solution containing the first step antibody. If the target antigen is present, some of the antibody binds to the antigen to form a biotinylated antibody/antigen complex.
- the antibody/antigen complex is then amplified by incubation in successive solutions of streptavidin (or avidin), biotinylated DNA, and/or complementary biotinylated DNA, with each step adding additional biotin sites to the antibody/antigen complex.
- the amplification steps are repeated until a suitable level of amplification is achieved, at which point the sample is incubated in a solution containing the second step antibody against biotin.
- This second step antibody is labeled, as for example with an enzyme that can be used to detect the presence of the antibody/antigen complex by histoenzymology using a chromogen substrate.
- a conjugate can be produced which is macroscopically visible.
- Another known method of immunodetection takes advantage of the immuno-PCR (Polymerase Chain Reaction) methodology.
- the PCR method is similar to the Cantor method up to the incubation with biotinylated DNA, however, instead of using multiple rounds of streptavidin and biotinylated DNA incubation, the DNA/biotin/streptavidin/antibody complex is washed out with a low pH or high salt buffer that releases the antibody. The resulting wash solution is then used to carry out a PCR reaction with suitable primers with appropriate controls.
- the enormous amplification capability and specificity of PCR can be utilized to detect a single antigen molecule.
- Immunoassays in their most simple and direct sense, are binding assays. Certain preferred immunoassays are the various types of enzyme linked immunosorbent assays (ELISAs) and radioimmunoassays (RIA) known in the art. Immunohistochemical detection using tissue sections is also particularly useful. However, it will be readily appreciated that detection is not limited to such techniques, and western blotting, dot blotting, FACS analyses, and the like may also be used.
- the antibodies of the disclosure are immobilized onto a selected surface exhibiting protein affinity, such as a well in a polystyrene microtiter plate. Then, a test composition suspected of containing the LAIR1 -related cancer cells is added to the wells. After binding and washing to remove non-specifically bound immune complexes, the bound antigen may be detected. Detection may be achieved by the addition of another anti-LAIRl antibody that is linked to a detectable label.
- ELISA is a simple "sandwich ELISA.” Detection may also be achieved by the addition of a second anti-LAIRl antibody, followed by the addition of a third antibody that has binding affinity for the second antibody, with the third antibody being linked to a detectable label.
- the samples suspected of containing the LAIR1- related cancer cells are immobilized onto the well surface and then contacted with the anti- LAIRl antibodies of the disclosure. After binding and washing to remove non-specifically bound immune complexes, the bound anti-LAIRl antibodies are detected. Where the initial anti-LAIRl antibodies are linked to a detectable label, the immune complexes may be detected directly. Again, the immune complexes may be detected using a second antibody that has binding affinity for the first anti-LAIRl antibody, with the second antibody being linked to a detectable label.
- ELISAs have certain features in common, such as coating, incubating and binding, washing to remove non-specifically bound species, and detecting the bound immune complexes. These are described below.
- a plate with either antigen or antibody In coating a plate with either antigen or antibody, one will generally incubate the wells of the plate with a solution of the antigen or antibody, either overnight or for a specified period of hours. The wells of the plate will then be washed to remove incompletely adsorbed material. Any remaining available surfaces of the wells are then "coated" with a nonspecific protein that is antigenically neutral with regard to the test antisera. These include bovine serum albumin (BSA), casein or solutions of milk powder.
- BSA bovine serum albumin
- the coating allows for blocking of nonspecific adsorption sites on the immobilizing surface and thus reduces the background caused by nonspecific binding of antisera onto the surface.
- a secondary or tertiary detection means rather than a direct procedure.
- the immobilizing surface is contacted with the biological sample to be tested under conditions effective to allow immune complex (antigen/antibody) formation. Detection of the immune complex then requires a labeled secondary binding ligand or antibody, and a secondary binding ligand or antibody in conjunction with a labeled tertiary antibody or a third binding ligand.
- Under conditions effective to allow immune complex (antigen/antibody) formation means that the conditions preferably include diluting the antigens and/or antibodies with solutions such as BSA, bovine gamma globulin (BGG) or phosphate buffered saline
- the "suitable" conditions also mean that the incubation is at a temperature or for a period of time sufficient to allow effective binding. Incubation steps are typically from about 1 to 2 to 4 hours or so, at temperatures preferably on the order of 25°C to 27°C, or may be overnight at about 4°C or so.
- the contacted surface is washed so as to remove non-complexed material.
- a preferred washing procedure includes washing with a solution such as PBS/Tween, or borate buffer. Following the formation of specific immune complexes between the test sample and the originally bound material, and subsequent washing, the occurrence of even minute amounts of immune complexes may be determined.
- the second or third antibody will have an associated label to allow detection.
- this will be an enzyme that will generate color development upon incubating with an appropriate chromogenic substrate.
- a urease, glucose oxidase, alkaline phosphatase or hydrogen peroxidase-conjugated antibody for a period of time and under conditions that favor the development of further immune complex formation (e.g. , incubation for 2 hours at room temperature in a PBS-containing solution such as PBS-Tween).
- the amount of label is quantified, e.g., by incubation with a chromogenic substrate such as urea, or bromocresol purple, or 2,2'-azino-di-(3-ethyl-benzthiazoline-6- sulfonic acid (ABTS), or H2O2, in the case of peroxidase as the enzyme label. Quantification is then achieved by measuring the degree of color generated, e.g., using a visible spectra spectrophotometer.
- a chromogenic substrate such as urea, or bromocresol purple, or 2,2'-azino-di-(3-ethyl-benzthiazoline-6- sulfonic acid (ABTS), or H2O2
- the Western blot is an analytical technique used to detect specific proteins in a given sample of tissue homogenate or extract. It uses gel electrophoresis to separate native or denatured proteins by the length of the polypeptide (denaturing conditions) or by the 3-D structure of the protein (native/ non-denaturing conditions). The proteins are then transferred to a membrane (typically nitrocellulose or PVDF), where they are probed (detected) using antibodies specific to the target protein.
- a membrane typically nitrocellulose or PVDF
- Samples may be taken from whole tissue or from cell culture. In most cases, solid tissues are first broken down mechanically using a blender (for larger sample volumes), using a homogenizer (smaller volumes), or by sonication. Cells may also be broken open by one of the above mechanical methods. However, it should be noted that bacteria, virus or environmental samples can be the source of protein and thus Western blotting is not restricted to cellular studies only. Assorted detergents, salts, and buffers may be employed to encourage lysis of cells and to solubilize proteins. Protease and phosphatase inhibitors are often added to prevent the digestion of the sample by its own enzymes. Tissue preparation is often done at cold temperatures to avoid protein denaturing.
- the proteins of the sample are separated using gel electrophoresis. Separation of proteins may be by isoelectric point (pi), molecular weight, electric charge, or a combination of these factors. The nature of the separation depends on the treatment of the sample and the nature of the gel. This is a very useful way to determine a protein. It is also possible to use a two-dimensional (2-D) gel which spreads the proteins from a single sample out in two dimensions. Proteins are separated according to isoelectric point (pH at which they have neutral net charge) in the first dimension, and according to their molecular weight in the second dimension.
- isoelectric point pH at which they have neutral net charge
- the proteins are moved from within the gel onto a membrane made of nitrocellulose or polyvinylidene difluoride (PVDF).
- PVDF polyvinylidene difluoride
- the membrane is placed on top of the gel, and a stack of filter papers placed on top of that. The entire stack is placed in a buffer solution which moves up the paper by capillary action, bringing the proteins with it.
- Another method for transferring the proteins is called electroblotting and uses an electric current to pull proteins from the gel into the PVDF or nitrocellulose membrane.
- the proteins move from within the gel onto the membrane while maintaining the organization they had within the gel. As a result of this blotting process, the proteins are exposed on a thin surface layer for detection (see below).
- Both varieties of membrane are chosen for their non-specific protein binding properties (i.e., binds all proteins equally well). Protein binding is based upon hydrophobic interactions, as well as charged interactions between the membrane and protein. Nitrocellulose membranes are cheaper than PVDF, but are far more fragile and do not stand up well to repeated probings. The uniformity and overall effectiveness of transfer of protein from the gel to the membrane can be checked by staining the membrane with Coomassie Brilliant Blue or Ponceau S dyes. Once transferred, proteins are detected using labeled primary antibodies, or unlabeled primary antibodies followed by indirect detection using labeled protein A or secondary labeled antibodies binding to the Fc region of the primary antibodies.
- the antibodies of the present disclosure may also be used in conjunction with both fresh-frozen and/or formalin-fixed, paraffin-embedded tissue blocks prepared for study by immunohistochemistry (IHC).
- IHC immunohistochemistry
- the method of preparing tissue blocks from these particulate specimens has been successfully used in previous IHC studies of various prognostic factors, and is well known to those of skill in the art (Brown et al , 1990; Abbondanzo et al, 1990; Allred et al , 1990).
- frozen-sections may be prepared by rehydrating 50 ng of frozen
- pulverized tissue at room temperature in phosphate buffered saline (PBS) in small plastic capsules; pelleting the particles by centrifugation; resuspending them in a viscous embedding medium (OCT); inverting the capsule and/or pelleting again by centrifugation; snap-freezing in -70°C isopentane; cutting the plastic capsule and/or removing the frozen cylinder of tissue; securing the tissue cylinder on a cryostat microtome chuck; and/or cutting 25-50 serial sections from the capsule.
- whole frozen tissue samples may be used for serial section cuttings.
- Permanent-sections may be prepared by a similar method involving rehydration of the 50 mg sample in a plastic microfuge tube; pelleting; resuspending in 10% formalin for 4 hours fixation; washing/pelleting; resuspending in warm 2.5% agar; pelleting; cooling in ice water to harden the agar; removing the tissue/agar block from the tube; infiltrating and/or embedding the block in paraffin; and/or cutting up to 50 serial permanent sections. Again, whole tissue samples may be substituted.
- the present disclosure concerns immunodetection kits for use with the immunodetection methods described above.
- the antibodies may be used to detect LAIR1 -related cancer cells, the antibodies may be included in the kit.
- immunodetection kits will thus comprise, in suitable container means, a first antibody that binds to an LAIR1, and optionally an immunodetection reagent.
- the antibody may be pre-bound to a solid support, such as a column matrix and/or well of a microtitre plate.
- the immunodetection reagents of the kit may take any one of a variety of forms, including those detectable labels that are associated with or linked to the given antibody. Detectable labels that are associated with or attached to a secondary binding ligand are also contemplated.
- Exemplary secondary ligands are those secondary antibodies that have binding affinity for the first antibody.
- suitable immunodetection reagents for use in the present kits include the two-component reagent that comprises a secondary antibody that has binding affinity for the first antibody, along with a third antibody that has binding affinity for the second antibody, the third antibody being linked to a detectable label.
- a number of exemplary labels are known in the art and all such labels may be employed in connection with the present disclosure.
- kits may further comprise a suitably aliquoted composition of LAIR1, whether labeled or unlabeled, as may be used to prepare a standard curve for a detection assay.
- the kits may contain antibody -label conjugates either in fully conjugated form, in the form of intermediates, or as separate moieties to be conjugated by the user of the kit.
- the components of the kits may be packaged either in aqueous media or in lyophilized form.
- the container means of the kits will generally include at least one vial, test tube, flask, bottle, syringe or other container means, into which the antibody may be placed, or preferably, suitably aliquoted.
- the kits of the present disclosure will also typically include a means for containing the antibody, antigen, and any other reagent containers in close confinement for commercial sale.
- Such containers may include injection or blow-molded plastic containers into which the desired vials are retained.
- This example illustrates LAIRl monoclonal antibodies (mAbs) binding to human LAIRl extracellular domain (ECD).
- the inventors have generated a group of monoclonal antibodies using human LAIRl ECD as antigen. Details of the monoclonal antibodies sequences are listed in Tables 1-5.
- LA-171 EQSVEESGGRLVTPGGSLTLTCTVSGFSLSSYNMG E LVLTQTPSSVSAAVG GTVTI KCQASQSI YSN LA
- the inventors then used a concentration titration (0-10 ⁇ g/ml) by ELISA to determine the LAIRl monoclonal antibody (mAbs) binding to human LAIRl ECD.
- concentration titration (0-10 ⁇ g/ml) by ELISA to determine the LAIRl monoclonal antibody (mAbs) binding to human LAIRl ECD.
- the results of the ELISA assay are demonstrated in FIGS. 2-39 and Table 7.
- X axis indicates the antibody concentrations
- Y-axis is binding signals, measured as OD (450nm).
- LAIRl ECD recombinant protein was coated on high absorption 96-well plates. Serial diluted (3-fold) LAIRl mAb was added to the
- ELISA values may be determined as follows: LAIRl extracellular domain (ECD) protein (with 6 HIS tag at the C-terminus) was produced recombinantly in HEK293 cells and was coated onto a high binding 96-well clear plate (Coming-Costar, Fisher Scientific) at 1 ⁇ g/ml concentration (100 ⁇ /well) and incubated at 4 °C overnight. Plates were rinsed and then blocked with 200 ⁇ /well of 5% non-fat milk in PBS for 2 hour at 37 °C.
- ECD extracellular domain
- Detection was conducted by adding HRP substrate, TMB (ThermoFisher) for 10 minutes, and stopped by adding 50 ⁇ /well of 2N H2SO4. The plates were read for absorbance at 450 nm using a plate reader (SpectraMax M4, Molecular Devices). Data were collected and graphed using a 4-parameter fitting curve with GrapPad Prism 7 software for EC50 calculation.
- Collagen I has been proposed as a ligand of LAIR1 (Lebbink, R. J., de Ruiter, T., Adelmeijer, J. et al. 2006. Collagens are functional, high affinity ligands for the inhibitory immune receptor LAIR-1. J. Exp. Med. 203: 1419.).
- This example illustrates the BLI analysis of 38 anti-LAIRl rabbit mAbs using classic sandwich epitope binning assay format performed in Octet RED96 (FIG. 41).
- the first set (Set 1) of binning group determined five epitope bins for 14 rabbit mAbs.
- the second set (Set 2) of binning group determined two epitope bins for 7 rabbit mAbs.
- the third set (Set 3) of binning groups determined two epitope bins for 7 rabbit mAbs.
- the fourth set (Set 4) of binning groups determined two epitope bins for 7 rabbit mAbs.
- This example illustrates the kinetic binding sensorgrams for selected LAIRl antibodies determined using the Octet.
- This example illustrates the screening of anti-LAIRl agonist and antagonist antibodies.
- LAIR1 ligand collagen I was coated on the surface of the wells, then soluble Abs and Fc receptor positive cell line K562 were added, and the percentage of GFP+ LAIR1 reporter cells were detected after 24 hours (FIG. 53C).
- the antagonist anti-LAIRl LA-235 demonstrated a dose-dependent activity to block collagen-induced upregulation of the LAIR1 reporter cells (FIG. 53E).
- the agonist Ab LA-94 showed an ability to enhance the collagen-induced upregulation of the LAIR1 reporter cells.
- lxlO 5 /well human endothelia cells were plated on the upper room of the 24 well transwell plate on day -7.
- lxlO 5 MV4-11 cells were added on day 0, and the cell number of MV4-11 cells in lower room were counted using flow cytometry on day 1 (18 hours later).
- anti-LAIRl antagonist antibody LA-235 and N297A235 significantly decreased the migration of MV4-11 cells.
- FIG. 55A shows the schematic of human LAIRl expressed MLL-AF9 mouse model.
- GFP+ cells used for transplantation in A are close to 100% human LAIRl positive but do not express mouse LAIRl .
- human LAIRl expressed in mouse bone marrow cells up- regulated phosphorylated SHP1 (left), and increased the number of colony formation unit (CFU) (right).
- anti-LAIRl antibody demonstrates Fc-dependent ability to enhance phagocytosis of human macrophages.
- CFSE-stained THP-1 cells were incubated with control or anti-LAIRl antibodies for 15 min on ice followed by PBS washing. The cells were then incubated with human PBMC-derived macrophages for 30 min.
- Phagocytosis of THP-1 cells by human macrophages was measured. As shown in FIG. 56, anti-LAIRl antibody LA-94 and LA-235 significantly increased the phagocytosis of THP-1 cells while N297A modification of the antibody substantially abolished the antibodies' ability to enhance phagocytosis, indicating that the antibodies' ability to enhance phagocytosis is Fc- dependent.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Hematology (AREA)
- Zoology (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Wood Science & Technology (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Urology & Nephrology (AREA)
- General Engineering & Computer Science (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Physics & Mathematics (AREA)
- Oncology (AREA)
- Analytical Chemistry (AREA)
- Pathology (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Plant Pathology (AREA)
- Virology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Transplantation (AREA)
Priority Applications (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2018204986A AU2018204986B2 (en) | 2017-01-02 | 2018-01-02 | Anti-LAIR1 antibodies and their uses |
| US16/475,223 US11377491B2 (en) | 2017-01-02 | 2018-01-02 | Anti-leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) monoclonal antibodies and method of use thereof to treat cancer |
| JP2019536073A JP7152404B2 (ja) | 2017-01-02 | 2018-01-02 | 抗lair1抗体およびその使用 |
| EP18734005.4A EP3562508A4 (en) | 2017-01-02 | 2018-01-02 | ANTI-LAIR1 ANTIBODIES AND THEIR USES |
| CA3047593A CA3047593A1 (en) | 2017-01-02 | 2018-01-02 | Anti-lair1 antibodies and their uses |
| KR1020197022485A KR102617853B1 (ko) | 2017-01-02 | 2018-01-02 | 항-lair1 항체 및 그의 용도 |
| CN201880015331.9A CN110381998B (zh) | 2017-01-02 | 2018-01-02 | 抗lair1抗体及其用途 |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201762441551P | 2017-01-02 | 2017-01-02 | |
| US62/441,551 | 2017-01-02 | ||
| US201762445673P | 2017-01-12 | 2017-01-12 | |
| US62/445,673 | 2017-01-12 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2018126259A1 true WO2018126259A1 (en) | 2018-07-05 |
Family
ID=62710796
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2018/012040 Ceased WO2018126259A1 (en) | 2017-01-02 | 2018-01-02 | Anti-lair1 antibodies and their uses |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US11377491B2 (https=) |
| EP (1) | EP3562508A4 (https=) |
| JP (1) | JP7152404B2 (https=) |
| KR (1) | KR102617853B1 (https=) |
| CN (1) | CN110381998B (https=) |
| AU (1) | AU2018204986B2 (https=) |
| CA (1) | CA3047593A1 (https=) |
| WO (1) | WO2018126259A1 (https=) |
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20210275677A1 (en) * | 2018-07-10 | 2021-09-09 | Akamara Therapeutics, Inc. | B-cell immunotherapy in cancer treatment |
| WO2022133094A1 (en) * | 2020-12-18 | 2022-06-23 | Bioardis, Llc | Fap binding molecules and uses thereof |
| WO2024059789A3 (en) * | 2022-09-16 | 2024-05-16 | Eli Lilly And Company | Anti-human lair1 antibodies |
| WO2024215782A1 (en) * | 2023-04-11 | 2024-10-17 | Ngm Biopharmaceuticals, Inc. | Methods of treating osteosarcoma using lair1 binding agents |
| WO2024215787A1 (en) * | 2023-04-11 | 2024-10-17 | Ngm Biopharmaceuticals, Inc. | Methods of treating osteosarcoma using lair1 binding agents and pd-1 antagonists |
| US12240899B2 (en) | 2020-06-22 | 2025-03-04 | Ngm Biopharmaceuticals, Inc. | LAIR-1-binding agents and methods of use thereof |
Families Citing this family (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN115443150A (zh) * | 2019-12-17 | 2022-12-06 | 德克萨斯大学系统董事会 | 新型ddr1抗体和其用途 |
| US20250026826A1 (en) * | 2021-02-17 | 2025-01-23 | University Of Florida Research Foundation, Incorporated | Anti-lair1 antibodies for the treatment of cancer |
| WO2023173091A1 (en) | 2022-03-11 | 2023-09-14 | Ngm Biopharmaceuticals, Inc. | Osteoclast-associated ig-like receptor (oscar) and methods of use thereof |
| WO2024067864A1 (en) * | 2022-09-30 | 2024-04-04 | Shanghai Junshi Biosciences Co., Ltd. | Anti-lair1 antibodies and their uses |
| CN120230216B (zh) * | 2025-05-29 | 2025-09-09 | 上海宏成药业有限公司 | 抗lair1抗体及其用途 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090304686A1 (en) * | 2006-03-08 | 2009-12-10 | Universotair Medisch Centrum Utrecht | Interfering in activation of an immune cell by influencing interaction of lair and collagen |
| US20110268741A1 (en) * | 2009-01-05 | 2011-11-03 | The Johns Hopkins University | Immunotherapy for Contact Dermatitis Using Co-Signal Regulation |
| WO2016172583A1 (en) * | 2015-04-23 | 2016-10-27 | Novartis Ag | Treatment of cancer using chimeric antigen receptor and protein kinase a blocker |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN102099876A (zh) * | 2008-07-15 | 2011-06-15 | 株式会社村田制作所 | 电子元器件 |
-
2018
- 2018-01-02 CA CA3047593A patent/CA3047593A1/en active Pending
- 2018-01-02 CN CN201880015331.9A patent/CN110381998B/zh active Active
- 2018-01-02 US US16/475,223 patent/US11377491B2/en active Active
- 2018-01-02 KR KR1020197022485A patent/KR102617853B1/ko active Active
- 2018-01-02 JP JP2019536073A patent/JP7152404B2/ja active Active
- 2018-01-02 EP EP18734005.4A patent/EP3562508A4/en active Pending
- 2018-01-02 WO PCT/US2018/012040 patent/WO2018126259A1/en not_active Ceased
- 2018-01-02 AU AU2018204986A patent/AU2018204986B2/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20090304686A1 (en) * | 2006-03-08 | 2009-12-10 | Universotair Medisch Centrum Utrecht | Interfering in activation of an immune cell by influencing interaction of lair and collagen |
| US20110268741A1 (en) * | 2009-01-05 | 2011-11-03 | The Johns Hopkins University | Immunotherapy for Contact Dermatitis Using Co-Signal Regulation |
| WO2016172583A1 (en) * | 2015-04-23 | 2016-10-27 | Novartis Ag | Treatment of cancer using chimeric antigen receptor and protein kinase a blocker |
Non-Patent Citations (2)
| Title |
|---|
| "Monoclonal antibody to CD 305/LAIR1-Purified", ACRIS, 12 August 2015 (2015-08-12), XP055518115, Retrieved from the Internet <URL:https://m1.acris-antibodies.com/pdf/SM6003.pdf> * |
| MEYAARD ET AL.: "LAIR-1, a Novel Inhibitory Receptor Expressed on Human Mononuclear Leukocytes", IMMUNITY, vol. 7, no. 2, August 1997 (1997-08-01), pages 283 - 290, XP002190966 * |
Cited By (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20210275677A1 (en) * | 2018-07-10 | 2021-09-09 | Akamara Therapeutics, Inc. | B-cell immunotherapy in cancer treatment |
| US12357699B2 (en) * | 2018-07-10 | 2025-07-15 | Alyssum Therapeutic s, Inc. | B-cell immunotherapy in cancer treatment |
| US12240899B2 (en) | 2020-06-22 | 2025-03-04 | Ngm Biopharmaceuticals, Inc. | LAIR-1-binding agents and methods of use thereof |
| WO2022133094A1 (en) * | 2020-12-18 | 2022-06-23 | Bioardis, Llc | Fap binding molecules and uses thereof |
| WO2024059789A3 (en) * | 2022-09-16 | 2024-05-16 | Eli Lilly And Company | Anti-human lair1 antibodies |
| WO2024215782A1 (en) * | 2023-04-11 | 2024-10-17 | Ngm Biopharmaceuticals, Inc. | Methods of treating osteosarcoma using lair1 binding agents |
| WO2024215787A1 (en) * | 2023-04-11 | 2024-10-17 | Ngm Biopharmaceuticals, Inc. | Methods of treating osteosarcoma using lair1 binding agents and pd-1 antagonists |
Also Published As
| Publication number | Publication date |
|---|---|
| JP7152404B2 (ja) | 2022-10-12 |
| JP2020513769A (ja) | 2020-05-21 |
| AU2018204986A1 (en) | 2019-07-04 |
| US20190338026A1 (en) | 2019-11-07 |
| CN110381998A (zh) | 2019-10-25 |
| EP3562508A1 (en) | 2019-11-06 |
| CN110381998B (zh) | 2023-08-29 |
| KR20190100369A (ko) | 2019-08-28 |
| CA3047593A1 (en) | 2018-07-05 |
| US11377491B2 (en) | 2022-07-05 |
| KR102617853B1 (ko) | 2023-12-27 |
| EP3562508A4 (en) | 2021-04-07 |
| AU2018204986B2 (en) | 2024-08-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11498963B2 (en) | Anti-LILRB antibodies and their use in detecting and treating cancer | |
| US11377491B2 (en) | Anti-leukocyte-associated immunoglobulin-like receptor 1 (LAIR1) monoclonal antibodies and method of use thereof to treat cancer | |
| US20250250336A1 (en) | Novel lilrb4 antibodies and uses thereof | |
| JP2023508277A (ja) | 新規のddr1抗体およびその使用 | |
| HK40009967B (zh) | 抗lair1抗体及其用途 | |
| HK40009967A (en) | Anti-lair1 antibodies and their uses | |
| HK1243005B (zh) | 抗lilrb抗體及其在檢測和治療癌症中的用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 18734005 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3047593 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2019536073 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2018204986 Country of ref document: AU Date of ref document: 20180102 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20197022485 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2018734005 Country of ref document: EP |