WO2018085842A1 - Therapeutic targets for facioscapulohumeral muscular dystrophy - Google Patents

Therapeutic targets for facioscapulohumeral muscular dystrophy Download PDF

Info

Publication number
WO2018085842A1
WO2018085842A1 PCT/US2017/060410 US2017060410W WO2018085842A1 WO 2018085842 A1 WO2018085842 A1 WO 2018085842A1 US 2017060410 W US2017060410 W US 2017060410W WO 2018085842 A1 WO2018085842 A1 WO 2018085842A1
Authority
WO
WIPO (PCT)
Prior art keywords
dux4
protein
expression
fold
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/060410
Other languages
English (en)
French (fr)
Inventor
Peter L. Jones
Michael R. Green
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Massachusetts Amherst
Original Assignee
University of Massachusetts Amherst
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US16/347,688 priority Critical patent/US11160823B2/en
Priority to EP21161592.7A priority patent/EP3896451B1/en
Priority to JP2019523836A priority patent/JP7231226B2/ja
Priority to EP17867141.8A priority patent/EP3535588A4/en
Priority to CA3042700A priority patent/CA3042700A1/en
Priority to AU2017355712A priority patent/AU2017355712B2/en
Application filed by University of Massachusetts Amherst filed Critical University of Massachusetts Amherst
Publication of WO2018085842A1 publication Critical patent/WO2018085842A1/en
Anticipated expiration legal-status Critical
Priority to US17/489,983 priority patent/US11963975B2/en
Priority to US17/714,349 priority patent/US20220226364A1/en
Priority to JP2023018459A priority patent/JP2023071691A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/7105Natural ribonucleic acids, i.e. containing only riboses attached to adenine, guanine, cytosine or uracil and having 3'-5' phosphodiester links
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/33Heterocyclic compounds
    • A61K31/395Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
    • A61K31/55Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
    • A61K31/551Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
    • A61K31/55131,4-Benzodiazepines, e.g. diazepam or clozapine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/713Double-stranded nucleic acids or oligonucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/90Stable introduction of foreign DNA into chromosome
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5044Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics involving specific cell types
    • G01N33/5061Muscle cells
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/11Antisense
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/14Type of nucleic acid interfering nucleic acids [NA]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • BACKGROUND Facioscapulohumeral muscular dystrophy is caused by the aberrant expression of the DUX4 gene from an epigenetic ally dysregulated D4Z4 array at chromosome 4q35. This gene is generally not expressed, or expressed at very low levels, in healthy individuals. In FSHD patients, DUX4 gene is aberrantly expressed at higher levels in the skeletal muscles. This aberrant expression ultimately leads to muscle pathology, atrophy, and clinical weakness. Most therapies being developed target the DUX4 mRNA or protein.
  • the disclosure relates to compositions and methods useful for the treatment of diseases associated with aberrant expression of DUX4 (e.g. , facioscapulohumeral muscular dystrophy, FSHD).
  • epigenetic modulators disclosed herein are useful because they epigenetically regulate (e.g. , inhibit) aberrant expression of DUX4.
  • reduction of DUX4 expression by epigenetic modulators (e.g. , selective inhibitors) in subjects having diseases characterized by aberrant expression of DUX4 (e.g. , FSHD) is expected to result in reduced expression of the pathogenic DUX4-FL protein and thereby decrease disease symptomatology or reverse disease symptoms.
  • the epigenetic modulator reduces ZSCAN4 gene expression in a subject.
  • aspects of the disclosure relate to the discovery that inhibition of DUX4 gene expression by epigenetic modulators (e.g. , selective inhibitors) results in reduction in DUX4 gene expression and/or reduction of DUX4 protein (e.g. , DUX4-FL) protein production.
  • epigenetic modulators e.g. , selective inhibitors
  • selective inhibition of genes encoding certain Bromodomain-containing proteins e.g. , BRD2, BAZIA, etc.
  • histone demethylases e.g. , KDM4C
  • certain methyltransferases e.g. , ASHIL
  • chromatin remodeling proteins e.g. , SMARCA5, SMARCB 1, etc.
  • selective epigenetic modulators of DUX4 gene reduce production of pathogenic DUX4-FL protein and are useful for treating FSHD.
  • the disclosure provides a method for treating facioscapulohumeral muscular dystrophy (FSHD) in a subject in need thereof.
  • the methods comprises: administering to the subject a therapeutically effective amount of an epigenetic modulator of DUX4 gene expression.
  • the epigenetic modulator reduces DUX4 expression in the muscle cells, muscle progenitor cells, or muscle stem cells of the subject.
  • the epigenetic modulator of DUX4 is not an interfering nucleic acid that hybridizes to DUX4.
  • the epigenetic modulator of DUX4 is an inhibitor of a demethylase enzyme.
  • the demethylase is a lysine- specific demethylase.
  • the lysine- specific demethylase is selected from the group consisting of: KDM4A, KDM4B, KDM4C, KDM4D, KDM6A, KDM6B, and PHF2.
  • the lysine- specific demethylase is KDMC4C and the epigenetic modulator specifically inhibits KDM4C.
  • the epigenetic modulator is an inhibitor of a bromodomain- containing protein (BRD).
  • BRD protein is BRD2, BRD3, BRDT, ASHIL, BRPFl, BRPF3, BPTF, BAZIA, BAZIB, or BAZ2A.
  • the BRD protein is BRD2 and the epigenetic modulator specifically inhibits BRD2.
  • the BRD protein is BAZ1A and the epigenetic modulator specifically inhibits BAZ1A.
  • the epigenetic modulator is an inhibitor of a chromatin remodeling protein.
  • the chromatin remodeling protein is SMARCA5 or SMARCB 1.
  • the protein involved with chromatin remodeling is SMARCA5 and the epigenetic modulator specifically inhibits SMARCA5.
  • the epigenetic modulator of DUX4 is an inhibitor of a
  • the methyltransferase enzyme is CARM1, DOT1L, KMT2A, KMT2C, KMT2E, PRMT1, SETD1A, SETD1B, SMYD3, or ASHIL.
  • the methyltransferase is ASHIL and the epigenetic modulator specifically inhibits ASHIL.
  • the epigenetic modulator of DUX4 is a nucleic acid, polypeptide, or small molecule.
  • the epigenetic modulator of DUX4 is a nucleic acid.
  • the nucleic acid is an interfering nucleic acid selected from the group consisting of: double stranded RNA (dsRNA), siRNA, shRNA, miRNA, and antisense oligonucleotide (ASO).
  • dsRNA double stranded RNA
  • siRNA siRNA
  • shRNA shRNA
  • miRNA miRNA
  • ASO antisense oligonucleotide
  • the epigenetic modulator of DUX4 is an interfering nucleic acid having a sequence as listed in Table 1.
  • the epigenetic modulator of DUX4 is a polypeptide. In some embodiments, wherein the polypeptide is an antibody.
  • the epigenetic modulator of DUX4 is a small molecule. Aspects of the disclosure relate, in part, on the discovery that small molecules that alter DUX4 expression by altering myogenic differentiation (e.g. , JQl) are not, in some embodiments, viable candidates for treatment of FSHD. Accordingly, in some embodiments, the small molecule inhibits DUX4 expression without altering or substantially altering one or more myogenic regulatory genes in the cells of the subject. In some embodiments, the one or more myogenic regulatory genes are selected from the group consisting of myogenin (Myog), MyoD, and myosin heavy chain (MyHC). In some embodiments, the small molecule does not inhibit myodifferentiation in the cells of the subject.
  • myogenic differentiation e.g. , JQl
  • MyHC myosin heavy chain
  • the epigenetic modulator of DUX4 is not JQl, or an analogue of JQl .
  • the muscle cells are differentiated muscle cells, optionally terminally differentiated muscle cells.
  • the effective amount is administered to a muscle cell of the subject ex vivo.
  • the muscle cell comprises an epigenetically dysregulated D4Z4 array at chromosome 4q35. In some embodiments, the epigenetically dysregulated D4Z4 array comprises fewer than 11 repeat units.
  • the method further comprises assessing the DUX4 expression level of the subject before and/or after the administering, wherein a change in the DUX4 expression level indicates effectiveness of the treatment.
  • the disclosure provides a method for identifying an epigenetic modulator of DUX4 gene expression.
  • the method comprises (i) contacting a cell characterized by expression of DUX4 with a candidate agent for modulating expression or activity of a putative chromatin modifier of DUX4; (ii) detecting expression level of DUX4 in the cell; and, (iii) identifying the candidate agent as an epigenetic modulator of DUX4 when the expression level of DUX4 decreases relative to a control cell after contact with the candidate agent.
  • the cell and/or the control cell is a muscle cell, such as a terminally differentiated muscle cell.
  • the cell comprises an
  • control cell does not comprise an epigenetically dysregulated D4Z4 array.
  • a candidate agent is selected from a compound library.
  • the library comprises or consists of demethylase inhibitors.
  • the demethylase inhibitors are lysine-specific demethylase inhibitors.
  • the library comprises or consists of bromodomain inhibitors.
  • the library comprises or consists of inhibitors of chromatin remodeling proteins ⁇ e.g., SMARCA5 inhibitors, etc.).
  • the library comprises or consists of methyltransferase inhibitors ⁇ e.g., ASH1L inhibitors).
  • a candidate agent is a nucleic acid, polypeptide, or small molecule.
  • a candidate agent is a nucleic acid.
  • the nucleic acid is an interfering nucleic acid selected from the group consisting of: double stranded RNA (dsRNA), siRNA, shRNA, miRNA, and antisense oligonucleotide (ASO).
  • dsRNA double stranded RNA
  • siRNA siRNA
  • shRNA shRNA
  • miRNA miRNA
  • ASO antisense oligonucleotide
  • a candidate agent is a polypeptide.
  • the polypeptide is an antibody.
  • a candidate agent is a small molecule.
  • expression levels of DUX4 are detected using a hybridization- based assay, Western blot, flow cytometry, quantitative real-time polymerase chain reaction (qRT-PCR) or FACS.
  • aspects of the disclosure relate to the development of gene editing complexes and/or molecules that are useful for bringing about a reduction in DUX4 gene expression.
  • the disclosure provides a method for inhibiting DUX4 gene expression in a cell that involves contacting the cell with an effective amount of a recombinant gene editing complex, in which the gene editing complex brings about a reduction in expression of a lysine - specific demethylase, a BRD protein, a methyltransferase, or another chromatin remodeling protein in the cell.
  • a recombinant gene editing complex does not hybridize or bind directly to DUX4.
  • a recombinant gene editing complex comprises a Cas protein, a zinc finger nuclease (ZFN), a Transcription activator-like effector nuclease (TALEN), or a nuclease (e.g. , a meganuclease).
  • ZFN zinc finger nuclease
  • TALEN Transcription activator-like effector nuclease
  • nuclease e.g. , a meganuclease
  • a recombinant gene editing complex further comprises a transcriptional repressor domain.
  • the transcriptional repressor domain is a KRAB domain.
  • a gene editing complex comprises a sequence set forth in SEQ ID NO: 29.
  • a recombinant gene editing complex further comprises a guide RNA (gRNA), optionally a single-stranded guide RNA (sgRNA).
  • gRNA guide RNA
  • sgRNA single-stranded guide RNA
  • the gRNA or sgRNA hybridizes specifically to a gene encoding: a lysine-specific demethylase, a BRD protein, a methyltransferase, or a protein involved with chromatin remodeling.
  • the lysine-specific demethylase is KDM4C.
  • the BRD protein is BRD2.
  • the BRD protein is BAZIA.
  • the chromatin remodeling protein is SMARCA5.
  • the methyltransferase is ASH1L.
  • the recombinant gene editing complex is delivered to the cell by a viral vector, such as, for example, a lentiviral vector or a recombinant adeno-associated virus (rAAV) vector.
  • a viral vector such as, for example, a lentiviral vector or a recombinant adeno-associated virus (rAAV) vector.
  • a cell is a muscle cell, optionally a terminally differentiated muscle cell.
  • the disclosure provides a composition comprising a recombinant gene editing complex comprising (i) a recombinant gene editing protein; and, (ii) a guide RNA (gRNA) that specifically hybridizes to a lysine-specific demethylase, a BRD protein, a methyltransferase, or a protein involved with chromatin remodeling, in which binding of the guide strand to a target gene in a cell results in inhibition of DUX4 gene expression in the cell.
  • gRNA guide RNA
  • the disclosure provides a composition comprising a recombinant gene editing complex as described herein.
  • the composition comprises a viral vector (e.g. , a lentiviral vector or a rAAV vector) encoding a gene editing complex as described by the disclosure.
  • the composition further comprises a pharmaceutically acceptable excipient.
  • the disclosure provides a method for treating facioscapulohumeral muscular dystrophy (FSHD) in a subject in need thereof, the method comprising: administering to the subject a therapeutically effective amount of a recombinant gene editing complex as described by the disclosure or a composition as described by the disclosure.
  • FSHD facioscapulohumeral muscular dystrophy
  • the subject is a mammal, optionally a human.
  • the recombinant gene editing complex is administered to the subject by injection, optionally intramuscular injection or intravenous injection.
  • the recombinant gene editing complex is administered to muscle cells of the subject, optionally terminally differentiated muscle cells, muscle stem cells, muscle satellite cells, or myoblasts of the subject.
  • FIG 1 shows effects of shRNA knockdown of Bromodomain-containing protein
  • BRD BRD family members BRD2, BRD3, BRD4, and BRDT, on expression of Dux4 (DUX4-fl), other myogenic factors (Myogenin, MyoD, MyHC), FSHD Region Gene 1 (FRG1), Utrophin (UTRN), and 18S.
  • Dux4 DUX4-fl
  • Myogenin MyoD
  • MyHC FSHD Region Gene 1
  • Utrophin Utrophin
  • 18S 18S.
  • Each BRD gene was knocked down with two different lentivirally-expressed shRNAs.
  • Figure 2 shows effects of shRNA knockdown of methylase family members Coactivator Associated Arginine Methyltransferase 1 (CARM1) and Lysine Methyltransferase 2A
  • KMT2A Lysine demethylase 4 A
  • KDM4B Lysine demethylase 4B
  • KDM4C Lysine demethylase 4C
  • KDM4D Lysine demethylase 4D
  • FIG. 3 shows effects of shRNA knockdown of Bromodomain Adjacent To Zinc Finger
  • BAZ1B Bromodomain Adjacent To Zinc Finger Domain 1A (BAZ1A),
  • BAZ2A Bromodomain Adjacent To Zinc Finger Domain 2A
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 SMARCA5
  • SMARCA5 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
  • BAP1 BRCA1 Associated Protein 1
  • ASHIL ASHIL
  • Dux4 DUX4-fl
  • other myogenic factors Myogenin, MyoD, MyHC
  • FSGl FSHD Region Gene 1
  • Utrophin UTRN
  • Figures 4A-4E show shRNA knockdown of candidate target genes.
  • Figure 4A shows knockdown of ASHIL using 3 different shRNAs.
  • Figure 4B shows knockdown of BRD2 using two different shRNAs.
  • Figure 4C shows knockdown of KDM4C using three different shRNAs.
  • Figure 4D shows knockdown of SMARCA5 using two different shRNAs.
  • Figure 4E shows knockdown of BAZ1A using two different shRNAs.
  • Figure 5 shows a graphic depiction of CRISPR/dCas9/KRAB transcription modulation.
  • Figure 6 shows representative data for lentiviral-based dCas9-KRAB knockdown of
  • KDM4C in 17ABic cells Relative gene expression of KDM4C, DUX4-A (D4-fl), FRGl, MyoG, MyHC, 18S and MyoD are shown. Data from experiments using two different guide RNAs (gRNAs) are shown.
  • gRNAs guide RNAs
  • Figure 7 shows representative data for lentiviral-based dCas9-KRAB knockdown of ASHIL in 17ABic cells. Relative gene expression of ASHIL, DUX4-A (D4-fl), FRGl, MyoG, MyHC, 18S and MyoD are shown. Data from experiments using a single guide RNA (gRNA) are shown.
  • Figure 8 shows representative data for lentiviral-based dCas9-KRAB knockdown of SMARCA5 in 17ABic cells. Relative gene expression of SMARCA5, DUX4-A (D4-fl), FRGl, MyoG, MyHC, 18S and MyoD are shown. Data from experiments using two different guide RNAs (gRNAs) are shown.
  • Figure 9 shows representative data for lentiviral-based dCas9-KRAB knockdown of
  • BAZIA in 17ABic cells Relative gene expression of BAZIA, DUX4-A (D4-fl), FRGl, MyoG, MyHC, 18S and MyoD are shown. Data from experiments using two different guide RNAs (gRNAs) are shown.
  • gRNAs guide RNAs
  • Figure 10 shows representative data for lentiviral-based dCas9-KRAB knockdown of BRD2 in 17ABic cells. Relative gene expression of BRD2, DUX4-A (D4-fl), FRGl, MyoG, MyHC, 18S and MyoD are shown. Data from experiments using a single guide RNA (gRNA) are shown.
  • gRNA single guide RNA
  • Figures 11A-11F show shRNA knockdown of epigenetic regulators reduces expression of DUX4-fl in FSHD myocytes.
  • Differentiated FSHD myocytes were infected in two serial rounds with shRNAs to ASH1L (Figure 11A), BAZIA (Figure 1 IB), BRD2 ( Figure 11C),
  • KDM4C Figure 11D
  • SMARCA5 Figure HE
  • a scrambled control Four days later, cells were harvested for analysis of the full-length DUX4 isoform (DUX4-fl), Myogenin (Myog), MyoD, Myosin heavy chain 1 (MyHC), FRGl, Utrophin (Utr), and 18S gene expression by qRT-PCR.
  • Figure 11F shows shRNAs to ASH1L (16169), BRD2 (6308), KDM4C (22058), or SMARCA5 (13214) reduce DUX4-fl expression across several FSHD cohorts (05Abic, 18Abic, and 17Abic).
  • relative mRNA expression for mock or control-infected cells is set to 1. Data are plotted as the mean + SD value of technical replicates.
  • Figures 12A-12D show transcriptional repression of epigenetic regulators by dCas9- KRAB reduces expression of DUX4-fl in FSHD myocytes.
  • Differentiated FSHD myocytes were subjected to four serial co-infections with combinations of lentiviral supernatants expressing either dCas9-KRAB or individual sgRNAs (gl-2 for each target gene) targeting BAZIA ( Figure 12A), BRD2 ( Figure 12B), KDM4C (Figure 12C), or SMARCA5 (Figure 12D).
  • Cells were harvested -72 h later for analysis of gene expression by qRT-PCR (as in Fig. 11 A- 1 IF). Data are plotted as the mean + SD value of three independent experiments, with relative mRNA expression for cells infected with dCas9-KRAB alone set to 1.
  • Figures 13A-13D show knockdown of candidate regulators increases chromatin repression at the D4Z4 macro satellite.
  • Differentiated FSHD myocytes were infected in two serial rounds with shRNAs to ASH1L (Figure 13A), BRD2 ( Figure 13B), KDM4C ( Figure 13C), SMARCA5 ( Figure 13D), a GFP control, or a scrambled control. Four days later, cells were harvested for ChIP analysis.
  • Chromatin was immunoprecipitated using antibodies specific for H3K9me3 or H3 and analyzed by qPCR using primers to the chromosome 4 D4Z4 array (4- spec D4Z4), the Myogenin promoter (Myog prom), a region proximal to D4Z4 (5' flank), and the 4p array on chromosome 4. Data are presented as fold enrichment of the target region by aH3K9me3 normalized to a-histone H3, with enrichment for the GFP shRNA-infected cells set to 1. Data are plotted as the mean + SD value of two independent experiments.
  • Figures 14A-14D show knockdown of candidate regulators increases chromatin repression at the D4Z4 macro satellite.
  • Differentiated FSHD myocytes were infected in two serial rounds with shRNAs to BRD2 (Figure 14A), ASH1L ( Figure 14B), SMARCA5 ( Figure 14C), KDM4C ( Figure 14D), a GFP control, or a scrambled control. Four days later, cells were harvested for ChIP analysis.
  • Chromatin was immunoprecipitated using antibodies specific for H3K36me3 and analyzed by qPCR using primers to the chromosome 4 D4Z4 array (4-spec D4Z4), the Myogenin promoter (Myog prom), a region proximal to D4Z4 (5' flank), and the 4p array on chromosome 4. Data are presented as fold enrichment of the target region by aH3K9me3 normalized to ⁇ -histone H3, with enrichment for the GFP shRNA-infected cells set to 1.
  • Figure 15 shows treatment of primary myoblasts isolated from FSHD1 -affected (A) and FSHD-asymptomatic (B) patients with small molecules alone or in combination that affect the epigenetic state of the D4Z4 affect DUX4 expression.
  • Figure 16 shows JQ1 regulation of DUX4 is indirect and achieved by inhibiting the expression of several key myogenic regulatory genes myogenin (Myog), myoD, myosin heavy chain (MyHC), and myostatin (Myost).
  • FIG. 17 shows that myogenic genes myogenin (Myog), myoD, myosin heavy chain
  • MyHC are misregulated by JQ1 in both FSHD and healthy human skeletal muscle myoblasts (HSMM).
  • Figure 18 shows representative data for ZSCAN4 expression in FSHD skeletal muscle myotubes in the absence and presence of DUX-4 antisense oligonucleotides. Relative gene expression of DUX-4 and ZSCAN4 are shown.
  • Figure 19 shows representative data for ZSCAN4 expression in FSHD skeletal muscle myotubes in the absence and presence of SMARCA5 and KDM4C antisense oligonucleotides. Relative gene expression of SMARCA5, KDM4C and ZSCAN4 are shown.
  • the disclosure relates to methods and compositions useful for the treatment of diseases associated with aberrant expression of DUX4 (e.g. , facioscapulohumeral muscular dystrophy, FSHD).
  • DUX4 e.g. , facioscapulohumeral muscular dystrophy, FSHD
  • the disclosure is based, in part, on the surprising discovery that inhibiting DUX4 gene expression using certain epigenetic modulators (e.g. , inhibitors of KDM4C, ASHIL, SMARCA5, BAZIA, BRD2, etc.) result in decreased production of DUX4-A protein, the pathogenic mRNA isoform associated with FSHD.
  • certain epigenetic modulators e.g. , inhibitors of KDM4C, ASHIL, SMARCA5, BAZIA, BRD2, etc.
  • methods and compositions described by the disclosure inhibit— for example, through RNA interference (RNAi)-mediated knockdown, gene-editing molecule-mediated knockdown, or small molecule inhibitors— DUX4 gene expression by targeting certain regulatory factors (e.g. , chromatin modifiers) of DUX4.
  • RNAi RNA interference
  • chromatin modifiers e.g. , chromatin modifiers
  • the epigenetic modulator reduces ZSCAN4 gene expression in a subject.
  • aspects of the disclosure are based, in part, on the discovery that certain inhibitors (e.g. , certain indirect inhibitors) of DUX4 gene expression (e.g. , JQ1, or analogues of JQ1) inhibit myogenesis or myodifferentiation of cells, for example by altering the kinetics of myogenic differentiation, and/or causing aberrant expression of myogenic regulatory factors, such as myogenin (Myog), MyoD, myosin heavy chain (MyHC), and myostatin (Myost).
  • myogenic regulatory factors such as myogenin (Myog), MyoD, myosin heavy chain (MyHC), and myostatin (Myost).
  • epigenetic modulators of DUX4 expression as described by the disclosure do not inhibit myogenic regulatory genes (e.g. Myog, MyoD, MyHC, Myost, etc.).
  • the epigenetic modulator of DUX4 gene expression is not JQ1, or an analogue of JQ1.
  • the disclosure provides a method for treating
  • the method involves administering to the subject a therapeutically effective amount of an epigenetic modulator of DUX4 gene expression, in which the epigenetic modulator reduces DUX4 expression in the muscle cells of the subject.
  • Facioscapulohumeral Muscular Dystrophy FSHD
  • facioscapulohumeral muscular dystrophy refers to a muscular dystrophy involving progressive loss of skeletal muscle mass and/or function, in which muscles of the face, shoulder blades and upper arms are among the most affected.
  • FSHD is associated with aberrant expression of DUX4.
  • FSHD results from transcriptional activation of a DUX4 gene.
  • activation of the DUX4 gene results in a toxic gain of function in the DUX4 gene (e.g. , production of pathogenic DUX4-fl) and causes a range of symptoms including progressive skeletal muscle weakness (e.g. , facial muscle weakness, shoulder weakness, etc.
  • FSHD results in a subject requiring ventiliatotry support or wheelchair confinement.
  • FSHD is associated with a contraction of the D4Z4 repeat sequence at the subtelomeric region 4q35 on Chromosome 4 of the human genome.
  • chromosome 4 of a subject not having FSHD comprises a D4Z4 repeat region having between 11 and 150 repeat units, resulting in production of an alternatively- spliced 3'-truncated DUX4 transcript (DUX4-s).
  • the DUX4 gene of a subject having a contracted D4Z4 repeat e.g. , 11 or fewer repeat units
  • the invention relates to the discovery that inhibition of certain chromatin modifiers of DUX4 (e.g. , KDM4C, ASH1L, SMARCA5, BAZ1A, BRD2, etc. ) reduces DUX4 (e.g. , DUX4-fl) expression in a subject (e.g. , in a cell of a subject).
  • DUX4 e.g. , DUX4-fl
  • a subject e.g. , in a cell of a subject.
  • reduced DUX4 expression refers to a decrease in levels of DUX4 mRNA and/or protein in a cell or subject compared with an appropriate control.
  • reduced DUX4 expression is associated with a change in state of a DUX4 gene from a transcriptionally active (e.g.
  • a subject e.g. , a cell in a subject
  • a transcriptionally active (e.g. , expressed) DUX4 gene produces DUX4-fl; knockdown (e.g. , silencing) of DUX4 expression in the subject (e.g. , cell in the subject), for example by administration of an inhibitor of a chromatin modifier of DUX4, leads to reduced (or inhibited) expression and production of DUX4-fl in the subject.
  • reduction of DUX4 expression can be measured as expression level of DUX4 in a sample (e.g. , a cell or a subject) after treatment with an inhibitor of a chromatin modifier of DUX4 relative to expression level of DUX4 (e.g. , DUX4-A) in the sample prior to treatment with the inhibitor of the chromatin modifier of DUX4.
  • the expression level of DUX4 e.g. , DUX4-fl
  • the expression level of DUX4 can be measured by any suitable method known in the art, for example by hybridization-based assay (e.g. , RT-PCR, qRT-PCR, Northern Blot), protein-based methods (e.g. , Western blot), spectroscopic methods (e.g. , mass spectrometry), and cell-based methods (e.g. , flow cytometry, fluorescence activated cell sorting (FACS)).
  • hybridization-based assay e.g. ,
  • an epigenetic modulator refers to an agent that alters the transcriptional activity of a gene (e.g. , DUX4), e.g. , by affecting the chromatin state of that gene (e.g. , promoting a condensed chromatin state to inhibit transcription or a relaxed chromatin state to enhance transcription).
  • a gene e.g. , DUX4
  • an epigenetic modulator is an agent that, when delivered to a cell, e.g. , a muscle cell, containing an active DUX4 gene, decreases transcription of DUX4 in the cell.
  • an epigenetic modulator directly modulates DUX4 gene expression.
  • an epigenetic modulator indirectly modulates DUX4 gene expression (e.g. , does not bind directly to DUX4 gene locus or a D4Z4 repeat array, or regulates expression or activity of a direct chromatin modifier of DUX4 gene expression).
  • an epigenetic modulator is an RNAi molecule or small molecule inhibitor that targets a positive regulator (e.g. , a chromatin modifier that promotes an open chromatin state at the DUX4 locus) of DUX4 gene expression, and thereby functions as a negative epigenetic modulator of DUX4 gene expression.
  • aspects of the disclosure relate to the discovery that inhibiting certain regulatory factors (e.g. , chromatin modifiers, such as KDM4C, BRD2, BAZ1A, ASH1L, SMARCA5, etc.) of DUX4 gene expression, for example using RNAi or small molecule inhibitors, results in inhibition of DUX4 gene expression and thus may be useful for treatment of diseases or conditions characterized by aberrant DUX4 expression (e.g. , FSHD).
  • regulatory factors e.g. , chromatin modifiers, such as KDM4C, BRD2, BAZ1A, ASH1L, SMARCA5, etc.
  • the chromatin state (e.g. , packaging of DNA with histone and non-histone proteins) of a cell has significant effects on gene expression.
  • the disclosure relates to chromatin modifiers (e.g. , chromatin remodeling proteins and genes encoding the same) that, when knocked down, reduce expression of the DUX4 gene in cells (e.g. , muscle cells, such as terminally differentiated muscle cells).
  • chromatin modifiers e.g. , chromatin remodeling proteins and genes encoding the same
  • an epigenetic modulator of DUX4 targets a chromatin modifier.
  • the term "chromatin modifier" refers to an agent (e.g. , an enzyme or transcription factor) that modifies DNA (e.g.
  • chromatin modifiers include, but are not limited to histone demethylases (e.g. , lysine demethylase enzymes), histone methlytransferases, histone deacetylases, histone acetyltransferases, certain bromodomain-containing proteins, kinases (e.g. , kinases that phosphorylate histones), and actin-dependent regulators of chromatin.
  • one or more chromatin remodeling proteins is present in a chromatin structure remodeling complex (RSC).
  • RSC chromatin structure remodeling complex
  • a chromatin modifier of DUX4 is a component (e.g. , a protein present in) an RSC.
  • histone demethylase refers to an enzyme that catalyzes the removal of a methyl group from a histone protein.
  • histone demethylase enzymes comprise one or more of the following domains: Swi3, Rsc and Moira (SWIRMl) domain, Jumonji N- or C-terminal (JmjN or JmjC) domain, PHD-finger domain, Zinc-finger domain, amine oxidase domain, and Vietnamese domain.
  • a histone deacetylase comprises at least one Jewish domain and two Jmj domains (e.g. one JmjN domain and one JmjC domain).
  • a histone demethylase is a lysine - specific histone demethylase.
  • lysine-specific histone demethylases include KDM4A, KDM4B, KDM4C, KDM4D, KDM6A, KDM6B, and PHF2.
  • an epigenetic modulator of DUX4 is a histone demethylase inhibitor.
  • bromodomain-containing protein refers to a protein that has a bromodomain that recognizes monoacetylated lysine residues.
  • BRD bromodomain-containing proteins bind to acetylated histones and, in some embodiments, mediate chromatin remodeling.
  • BRD proteins comprise at least one
  • bromodomain e.g. , 1, 2, 3, 4, 5, or more bromodomains
  • Extra-Terminal (ET) domain e.g. , 1, 2, 3, 4, 5, or more bromodomains
  • BRD proteins include BRD2, BRD3, BRD4, BRDT, BRPFl, BRPF3, BPTF, BAZ1A, BAZ1B, and BAZ2A.
  • an epigenetic modulator of DUX4 is a BRD protein inhibitor.
  • actin-dependent regulator of chromatin refers to a protein that is a member of the SWI/SNF Related Matrix Associated Actin Dependent Regulator of
  • an actin-dependent regulator of chromatin further comprises one or more Swi3, Ada2, N-Cor, and TFIIIB (SANT) domains.
  • one or more actin-dependent regulators of chromatin are present in the chromatin remodeling and splicing factor (RSF) complex.
  • actin-dependent regulators of chromatin include SMARCA5, SMARCB l, SMARCA4, SMARCC l, SMARCC2, SMARCD1, SMARCD2, and SMARCD3.
  • an epigenetic modulator of DUX4 is an actin-dependent regulator of chromatin inhibitor.
  • histone methyltransferase refers to an enzyme that catalyzes the transfer of at least one methyl group (e.g. , 1, 2, 3, or more methyl groups) to lysine and/or arginine residues of a histone protein.
  • histone methyltransferase enzymes are characterized as either lysine-specific or arginine- specific methyltransferases.
  • an epigenetic modulator of DUX4 is an inhibitor of a lysine-specific methyltransferase.
  • lysine-specific methyltransferases There are two families of lysine-specific methyltransferases: SET domain-containing methyltransferases and non-SET domain-containing methyltransferases.
  • lysine-specific histone methyltransferases include, but are not limited to, ASH1L, DOT1L, EHMT1, EHMT2, EZH1, EZH2, MLL, MLL2, MLL3, MLL4, MLL5, NSD1, PRDM1, KMT2A, KMT2C, KMT2E, SET, SETBP1, SETD1A, SETD2, SETD3, SETD4, SETD5, SETD6, SETD7, SETD9, SETD1B, SMYD1, SMYD2, SMYD3, SMYD4, SMYD5, SUV39H1, SUV39H2, SUV420H1, and SUV420H2.
  • an epigenetic modulator of DUX4 is a lysine-specific methyltransferase inhibitor.
  • an epigenetic modulator of DUX4 is an inhibitor of an arginine- specific methyltransferase.
  • Arginine- specific methyltransferases also referred to as PRMTs, are generally classified into two groups.
  • One group of PRMTs comprising PRMT1, PRMT3, CARM1, PRMT4, and Rmtl/Hmtl produce monomethylarginine and asymmetric
  • an epigenetic modulator of DUX4 is an arginine- specific methyltransferase inhibitor.
  • an epigenetic modulator of DUX4 is an inhibitor of a kinase (e.g. a serine-threonine kinase, for example NEK6), deacetylase enzyme (e.g. , a histone deacetylase, for example HDAC 1), splicing factor protein (e.g.
  • an epigenetic modulator of DUX4 is an inhibitor of any one of the foregoing proteins (e.g.
  • a kinase inhibitor a deacetylase enzyme inhibitor, a splicing factor protein inhibitor, a polymerase inhibitor, a ligase inhibitor, a hydrolase inhibitor, a peptidase inhibitor, or a protease inhibitor.
  • aspects of the invention relate to the discovery that inhibition of certain chromatin modifiers results in reduction in DUX4 gene expression and/or reduction of DUX4 protein (e.g. , DUX4-fl) protein production.
  • DUX4 protein e.g. , DUX4-fl
  • the term "inhibitor” refers to any agent that reduces (e.g. , prevents) activity or expression of a target molecule or gene (e.g. , a chromatin modifier of DUX4).
  • An inhibitor can be a nucleic acid (e.g. , an interfering RNA), peptide, protein, polypeptide (e.g. , antibody), small molecule, or any combination of the foregoing.
  • aspects of the disclosure are based, in part, on the discovery that certain inhibitors (e.g. , certain indirect inhibitors) of DUX4 gene expression inhibit myogenesis or myodifferentiation of cells, and may therefore not be suitable for treatment of FSHD.
  • certain inhibitors e.g. , certain indirect inhibitors
  • the small molecule JQl inhibits not only DUX4 gene expression but also
  • JQl is a selective inhibitor of the BET family of bromodomain proteins. Analogues of JQl have are also known in the art, for example as described by Syeda et al. (2015) Tetrahedron Letters
  • an epigenetic modulator of DUX4 gene expression as described by the disclosure does not inhibit myogenesis or myodifferentiation of cells.
  • an epigenetic modulator of DUX4 gene expression is not JQl or an analog of JQl .
  • Certain indirect inhibitors of DUX4 gene expression have also been observed to cause aberrant expression of myogenic regulatory factors, such as myogenin (Myog), MyoD, myosin heavy chain (MyHC), and myostatin (Myost).
  • myogenic regulatory factors such as myogenin (Myog), MyoD, myosin heavy chain (MyHC), and myostatin (Myost).
  • epigenetic modulators of DUX4 expression as described by the disclosure do not inhibit myogenic regulatory genes (e.g. Myog, MyoD, MyHC, Myost, etc.).
  • inhibition of a myo genie regulatory gene or genes is a reduction in expression of the gene or genes in a cell treated with an inhibitor of DUX4 gene expression relative to expression of the gene or genes in a cell that has not been treated with an inhibitor of DUX4 gene expression.
  • the reduction of expression of the gene or genes is about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or about 99% less than the expression of the gene or genes in a cell that has not been treated with an inhibitor of DUX4 expression.
  • an epigenetic modulator of DUX4 gene expression is a selective inhibitor.
  • a selective inhibitor or an inhibitor that is said to “selectively inhibit” refers to an inhibitor that preferentially inhibits activity or expression of a target molecule of a particular class compared with other molecules of the class.
  • DNA methyltransferase or histone methyltransferase such as a lysine-specific methyltransferase or an arginine-specific methyltransferase
  • a BRD protein such as a lysine-specific methyltransferase or an arginine-specific methyltransferase
  • a histone demethylase such as a histone demethylase, or an actin-dependent regulator of chromatin (e.g. , component of chromatin structure remodeling complex (RSC)).
  • RSC chromatin structure remodeling complex
  • a selective inhibitor selectively inhibits a histone demethylase.
  • a selective inhibitor of KDM4C which is a lysine-specific histone demethylase, has half maximal inhibitory concentration (IC50) relative to KDM4C that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more other histone demethylases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of KDM4A which is a lysine-specific histone demethylase, has half maximal inhibitory concentration (IC50) relative to KDM4A that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more other histone demethylases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of KDM4B which is a lysine-specific histone demethylase, has half maximal inhibitory concentration (IC50) relative to KDM4B that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more other histone demethylases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of KDM4D which is a lysine-specific histone demethylase, has half maximal inhibitory concentration (IC50) relative to KDM4D that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more other histone demethylases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of KDM6A which is a lysine-specific histone demethylase, has half maximal inhibitory concentration (IC50) relative to KDM6A that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more other histone demethylases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of KDM6B which is a lysine-specific histone demethylase, has half maximal inhibitory concentration (IC50) relative to KDM6B that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more other histone demethylases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of PHF2 which is a lysine-specific histone demethylase, has half maximal inhibitory concentration (IC50) relative to PHF2 that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more other histone
  • a selective inhibitor selectively inhibits a histone
  • a selective inhibitor of CARMl which is an arginine-specific histone methyltransferase, has half maximal inhibitory concentration (IC50) relative to CARMl that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more lysine-specific histone methyltransferases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of ASHIL which is a lysine-specific histone methyltransferase, has half maximal inhibitory concentration (IC50) relative to ASHIL that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more lysine- specific histone methyltransferases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of DOT1L which is a lysine- specific histone methyltransferase, has half maximal inhibitory concentration (IC50) relative to DOT1L that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more lysine- specific histone methyltransferases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of KMT2A which is a lysine- specific histone methyltransferase, has half maximal inhibitory concentration (IC50) relative to KMT2A that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more lysine- specific histone methyltransferases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of KMT2C which is a lysine- specific histone methyltransferase, has half maximal inhibitory concentration (IC50) relative to KMT2C that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more lysine- specific histone methyltransferases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of KMT2E which is a lysine-specific histone methyltransferase, has half maximal inhibitory concentration (IC50) relative to KMT2E that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more lysine-specific histone methyltransferases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of PRMTl which is a lysine-specific histone methyltransferase, has half maximal inhibitory concentration (IC50) relative to PRMTl that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more lysine-specific histone methyltransferases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of SETDIA which is a lysine-specific histone methyltransferase, has half maximal inhibitory concentration (IC50) relative to SETDIA that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30- fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more lysine- specific histone methyltransferases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of SETDIB which is a lysine- specific histone methyltransferase, has half maximal inhibitory concentration (IC50) relative to SETDIB that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30- fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more lysine- specific histone methyltransferases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of SMYD3, which is a lysine- specific histone methyltransferase has half maximal inhibitory concentration (IC50) relative to SMYD3 that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more lysine- specific histone methyltransferases.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor selectively inhibits a BRD protein.
  • a selective inhibitor of BRD2 has half maximal inhibitory concentration (IC50) relative to BRD2 that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20- fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more BRD proteins.
  • a selective inhibitor of BRD3 has half maximal inhibitory concentration (IC50) relative to BRD3 that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more BRD proteins.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of BRDT has half maximal inhibitory concentration (IC50) relative to BRDT that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more BRD proteins.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of BRPF1 has half maximal inhibitory concentration (IC50) relative to BRPF1 that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more BRD proteins.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of BRPF3 has half maximal inhibitory concentration (IC50) relative to BRPF3 that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more BRD proteins.
  • a selective inhibitor of BRPTF has half maximal inhibitory concentration (IC50) relative to BRPTF that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more BRD proteins.
  • a selective inhibitor of B AZ1 A has half maximal inhibitory concentration (IC50) relative to BAZ1A that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more BRD proteins.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of BAZ1B has half maximal inhibitory concentration (IC50) relative to BAZ1B that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more BRD proteins.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor of B AZ2A has half maximal inhibitory concentration (IC50) relative to BAZ2A that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more BRD proteins.
  • IC50 half maximal inhibitory concentration
  • a selective inhibitor selectively inhibits an actin-dependent regulator of chromatin (e.g. , SMARCA5, SMARCB 1).
  • a selective inhibitor of SMARCA5 has half maximal inhibitory concentration (IC50) relative to
  • a selective inhibitor of SMARCB 1 has half maximal inhibitory concentration (IC50) relative to SMARCB 1 that is at least 2-fold, at least 4-fold, at least 8-fold, at least 10-fold, at least 20-fold, at least 30-fold, at least 40-fold, or at least 50-fold lower than the IC50 relative to one or more actin-dependent regulators of chromatin.
  • IC50 half maximal inhibitory concentration
  • an epigenetic modulator of DUX4 is an interfering RNA.
  • interfering RNA examples include, but are not limited to double stranded RNA (dsRNA), siRNA, shRNA, miRNA, and antisense oligonucleotide (ASO).
  • Inhibitory oligonucleotides may interfere with gene expression, transcription and/or translation.
  • inhibitory oligonucleotides bind to a target polynucleotide via a region of complementarity.
  • binding of inhibitory oligonucleotide to a target polynucleotide can trigger RNAi pathway- mediated degradation of the target polynucleotide (in the case of dsRNA, siRNA, shRNA, etc.), or can block the translational machinery (e.g.
  • inhibitory oligonucleotides can be single- stranded or double-stranded.
  • inhibitory oligonucleotides are DNA or RNA.
  • the inhibitory oligonucleotide is selected from the group consisting of: antisense oligonucleotide, siRNA, shRNA and miRNA.
  • inhibitory oligonucleotides are modified nucleic acids.
  • nucleotide analog or altered nucleotide or modified nucleotide refers to a non-standard nucleotide, including non-naturally occurring ribonucleotides or
  • nucleotide analogs are modified at any position so as to alter certain chemical properties of the nucleotide yet retain the ability of the nucleotide analog to perform its intended function.
  • positions of the nucleotide which may be derivitized include the 5 position, e.g. , 5-(2-amino)propyl uridine, 5-bromo uridine, 5-propyne uridine, 5-propenyl uridine, etc. ; the 6 position, e.g. , 6-(2-amino)propyl uridine; the 8-position for adenosine and/or guanosines, e.g.
  • Nucleotide analogs also include deaza nucleotides, e.g. , 7-deaza- adenosine; O- and N-modified (e.g. , alkylated, e.g. , N6-methyl adenosine, or as otherwise known in the art) nucleotides; and other heterocyclically modified nucleotide analogs such as those described in Herdewijn, Antisense Nucleic Acid Drug Dev., 2000 Aug. 10(4):297-310.
  • Nucleotide analogs may also comprise modifications to the sugar portion of the nucleotides.
  • the 2' OH-group may be replaced by a group selected from H, OR, R, F, CI, Br, I, SH, SR, NH 2 , NHR, NR 2 , COOR, or OR, wherein R is substituted or unsubstituted C.sub. l-C.sub.6 alkyl, alkenyl, alkynyl, aryl, etc.
  • R is substituted or unsubstituted C.sub. l-C.sub.6 alkyl, alkenyl, alkynyl, aryl, etc.
  • Other possible modifications include those described in U.S. Pat. Nos. 5,858,988, and 6,291,438.
  • a locked nucleic acid (LNA) often referred to as inaccessible RNA, is a modified RNA nucleotide.
  • the phosphate group of the nucleotide may also be modified, e.g. , by substituting one or more of the oxygens of the phosphate group with sulfur (e.g. , phosphorothioates), or by making other substitutions which allow the nucleotide to perform its intended function such as described in, for example, Eckstein, Antisense Nucleic Acid Drug Dev. 2000 Apr. 10(2): 117-21,
  • the inhibitory oligonucleotide is a modified inhibitory oligonucleotide.
  • the modified inhibitory oligonucleotide comprises a locked nucleic acid (LNA), phosphorothioate backbone , and/or a 2' -OMe modification.
  • LNA locked nucleic acid
  • phosphorothioate backbone phosphorothioate backbone
  • 2' -OMe modification a 2' -OMe modification. Table 1 below provides examples of interfering RNA that are modulators of DUX4 expression.
  • the disclosure provides a method for inhibiting DUX4 gene expression in a cell, the method comprising: contacting the cell with an effective amount of a recombinant gene editing complex, wherein the gene editing complex inhibits expression of a lysine- specific demethylase, a BRD protein, a methyltransferase, or a chromatin remodeling protein in the cell.
  • gene editing complex refers to a biologically active molecule (e.g. , a protein, one or more proteins, a nucleic acid, one or more nucleic acids, or any combination of the foregoing) configured for adding, disrupting or changing genomic sequences (e.g. , a gene sequence), for example by causing a double stranded break (DSB) in a target DNA, or for inhibiting transcription of a target DNA sequence (e.g., using one or more components of a CRISPR/Cas system or similar system).
  • DSB double stranded break
  • a gene editing complex examples include but are not limited to Transcription Activator-like Effector Nucleases (TALENs), Zinc Finger Nucleases (ZFNs), engineered meganuclease re-engineered homing endonucleases, the CRISPR/Cas system, and meganucleases (e.g. , Meganuclease I-Scel).
  • TALENs Transcription Activator-like Effector Nucleases
  • ZFNs Zinc Finger Nucleases
  • engineered meganuclease re-engineered homing endonucleases e.g. , Meganuclease I-Scel
  • a gene editing complex comprises proteins or molecules (e.g. , components) related to the CRISPR/Cas system, including but not limited to Cas9,Cas6, dCas9, Cpfl, CRISPR RNA (crRNA), trans-activating crRNA (tracrRNA),
  • nucleases refer to an enzyme that cleaves a phosphodiester bond or bonds within a polynucleotide chain.
  • Nucleases may be naturally occurring or genetically engineered. Genetically engineered nucleases are particularly useful for genome editing and are generally classified into four families: zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), meganucleases (e.g. , engineered meganucleases) and CRISPR-associated proteins (Cas nucleases).
  • ZFNs zinc finger nucleases
  • TALENs transcription activator-like effector nucleases
  • meganucleases e.g. , engineered meganucleases
  • CRISPR-associated proteins Cas nucleases.
  • the nuclease is a ZFN.
  • the ZFN comprises a Fokl cleavage domain.
  • the ZFN comprises Cys 2 His 2 fold group.
  • the nuclease is a TALEN.
  • the TALEN comprises a Fokl cleavage domain.
  • the nuclease is a meganuclease. Examples of meganucleases include but are not limited to I-Scel, I-Crel, I-Dmol, and combinations thereof (e.g. , E-Drel, DmoCre).
  • CRISPR refers to "clustered regularly interspaced short palindromic repeats", which are DNA loci containing short repetitions of base sequences.
  • CRISPR loci form a portion of a prokaryotic adaptive immune system that confers resistance to foreign genetic material.
  • Each CRISPR loci is flanked by short segments of "spacer DNA", which are derived from viral genomic material.
  • spacer DNA hybridizes to transactivating RNA (tracrRNA) and is processed into CRISPR-RNA (crRNA) and
  • the nuclease is a CRISPR-associated nucleases (Cas nuclease).
  • CRISPR nucleases include, but are not limited to Cas9, dCas9, Cas6, Cpfl, and variants thereof.
  • the nuclease is Cas9.
  • the Cas9 is derived from the bacteria Streptococcus pyogenes ⁇ e.g., SpCas9) or Staphylococcus aureus ⁇ e.g., SaCas9, for example SEQ ID NO: 28).
  • a Cas protein is modified ⁇ e.g. genetically engineered) to lack nuclease activity.
  • dead Cas9 (dCas9) protein binds to a target locus but does not cleave said locus.
  • a dCas9 protein comprises the sequence set forth in SEQ ID NO: 31.
  • a Cas protein or variant thereof does not exceed the packaging capacity of a viral vector, such as a lentiviral vector or an adeno-associated virus (AAV) vector, for example as described by Ran et al. (2015) Nature. 520(7546); 186-91.
  • a viral vector such as a lentiviral vector or an adeno-associated virus (AAV) vector, for example as described by Ran et al. (2015) Nature. 520(7546); 186-91.
  • a nucleic acid encoding a Cas protein is less than about 4.6 kb in length.
  • aspects of the disclosure relate to the use of CRISPR- mediated regulation of
  • a catalytically dead Cas9 protein ⁇ e.g., dead Cas9, "dCas9"
  • a transcriptional regulator domain to modulate ⁇ e.g., inhibit) expression of a target gene ⁇ e.g., a regulatory factor of DUX4 gene expression, e.g., chromatin modifiers such as KDM4C, ASH1L, BRD2, BAZ1A, SMARCA5, etc.), as described by Qi et al. (2013) Cell. 152(5); 1173-1183 and Gilbert et al.
  • dCas9 comprises a sequence set forth in SEQ ID NO: 31.
  • dCas9 or another catalytically dead Cas protein
  • mediates transcriptional repression in some embodiments, by sterically hindering the binding of transcriptional machinery ⁇ e.g., a RNA polymerase complex) to a target sequence.
  • a CRISPR Cas protein ⁇ e.g., dCas9) is fused to a transcriptional regulator domain.
  • a "transcriptional regulator domain” is a protein domain that catalyzes structural or chemical changes in a chromatin molecule that results in altered transcriptional activity (e.g. , transcriptional activation or transcriptional repression).
  • the transcriptional regulator domain is a transcriptional repressor domain.
  • the repressive domain comprises a Kruppel associated box domain (KRAB domain).
  • KRAB domains include KOX1 KRAB domain, KOX8
  • the KRAB domain is a KOX1 KRAB domain.
  • the gene editing protein comprises a sequence set forth in SEQ ID NO: 29 or SEQ ID NO: 30.
  • repressive domains include Chromo Shadow (CS) domain (e.g. , CS domain of HP la) and WRPW domain (e.g. , WRPW domain of Hesl).
  • the transcriptional regulator domain is a transcriptional activator domain.
  • the transcriptional activator domain comprises a transcriptional activation domain of Herpes simplex virus, such as VP16, or a variant thereof.
  • a transcription factor may contain multiple activation domains, for example as described by Beerli et al. (1998) Proc. Natl. Acad. Sci. U.S.A. 95(25); 14628-33. Accordingly, in some
  • the transcriptional activator domain comprises 2, 3, 4, 5, 6, 7, 8, 9, or 10 activation domains. In some embodiments, the transcriptional activator domain is VP64, VP96, or VP 160.
  • a Cas protein is not fused to a transcriptional regulator domain, and is capable of modulating (e.g. , inhibiting) gene expression via nuclease activity (e.g. , DNA cleavage).
  • Cas9 cleaves DNA at a site targeted by the guide RNA and then repaired by either non-homologous end joining (NHEJ), which is imprecise and often results in a small insertion or deletion (InDel) that disrupts the targeted sequence, or homology directed DNA repair, which allows for the insertion of a changed or new DNA sequence into the genome at a specific location.
  • NHEJ non-homologous end joining
  • InDel small insertion or deletion
  • homology directed DNA repair which allows for the insertion of a changed or new DNA sequence into the genome at a specific location.
  • the disclosure relates to a gene editing complex comprising a functional nuclease and a guide RNA that hybridizes to and/or is complementary with a gene encoding a regulatory factor of DUX4 gene expression (e.g. , KDM4C, ASH1L, BAZ1A, BRD2, SMARCA5, etc.) that is capable of inhibiting expression of the factor thus inhibiting expression of DUX4 in a subject (e.g. , a cell of a subject).
  • a regulatory factor of DUX4 gene expression e.g. , KDM4C, ASH1L, BAZ1A, BRD2, SMARCA5, etc.
  • the CRISPR system can be modified to combine the tracrRNA and crRNA in to a single guide RNA (sgRNA) or just (gRNA).
  • sgRNA single guide RNA
  • gRNA guide RNA
  • gRNA guide RNA
  • sgRNA single guide RNA
  • gRNA gRNA
  • sgRNA a polynucleotide sequence that is complementary to a target sequence in a cell and associates with a Cas nuclease, thereby directing the Cas nuclease to the target sequence.
  • a gRNA e.g. , sgRNA
  • a gRNA e.g.
  • sgRNA ranges between 5 and 25 nucleotides in length. In some embodiments, a gRNA (e.g. , sgRNA) ranges between 10 and 22 nucleotides in length. In some embodiments, a gRNA (e.g. , sgRNA) ranges between 14 and 24 nucleotides in length.
  • a Cas protein and a guide RNA e.g. , sgRNA
  • a guide RNA hybridizes (e.g. , binds specifically by Watson-Crick base pairing) to a target sequence and thus directs the CRISPR/Cas protein to the target sequence.
  • a guide RNA hybridizes to (e.g. , targets) a gene (e.g. , a nucleic acid sequence) encoding a chromatin modifier of DUX4.
  • a guide strand hybridizes to a gene encoding a histone demethylase (e.g.
  • lysine demethylase enzyme histone methlytransferase, histone deacetylase, histone acetyltransferase, bromodomain-containing protein, kinase (e.g. , kinase that phosphorylates histone proteins), or an actin-dependent regulator of chromatin.
  • a guide strand hybridizes to a gene (e.g. , a nucleic acid sequence) encoding a histone demethylase.
  • the guide strand hybridizes to a lysine-specific histone demethylase, such as KDM4A, KDM4B, KDM4C, KDM4D, KDM6A, KDM6B, or PHF2.
  • the guide strand comprises a sequence set forth by SEQ ID NO: 12 (CGTTACCGGGGTGGAGCCTCGGAAT; PAM in bold) or SEQ ID NO: 13 (CTTGCCCGGAAGCGCTGGCTGGGGT; PAM in bold).
  • a guide strand hybridizes to a gene (e.g. , a nucleic acid sequence) encoding a BRD protein, such as BRD2, BRD3, BRD4, BRDT, BRPF1, BRPF3, BPTF, BAZIA, BAZIB, or BAZ2A.
  • the guide strand comprises a sequence set forth by SEQ ID NO: 14 (GCCAAAGCAGGGAAACGGGAGGGGT; PAM in bold).
  • the guide strand comprises a sequence set forth by SEQ ID NO: 15
  • a guide strand hybridizes to a gene (e.g. , a nucleic acid sequence) encoding an actin-dependent regulator of chromatin, such as SMARCA5, SMARCB 1,
  • the guide strand comprises a sequence set forth by SEQ ID NO: 17
  • a guide strand hybridizes to a gene (e.g. , a nucleic acid sequence) encoding a lysine- specific methyltransferase, such as ASH1L, DOT1L, EHMT1, EHMT2, EZH1, EZH2, MLL, MLL2, MLL3, MLL4, MLL5, NSD1, PRDM1, KMT2A, KMT2C, KMT2E, SET, SETBPl, SETDIA, SETD2, SETD3, SETD4, SETD5, SETD6, SETD7, SETD9, SETD1B, SMYD1, SMYD2, SMYD3, SMYD4, SMYD5, SUV39H1, SUV39H2, SUV420H1, or SUV420H2.
  • the guide strand comprises a sequence set forth by SEQ ID NO: 19 (GCCCTCACGCGTACCTTCAACGG; PAM in bold).
  • a guide strand hybridizes to a gene (e.g. , a nucleic acid sequence) encoding an arginine- specific methyltransferase, such as PRMT1, PRMT3, CARM1, PRMT4, Rmtl/Hmtl, JBP1, or PRMT5.
  • a gene e.g. , a nucleic acid sequence
  • an arginine-specific methyltransferase such as PRMT1, PRMT3, CARM1, PRMT4, Rmtl/Hmtl, JBP1, or PRMT5.
  • a guide strand hybridizes to a gene (e.g. , a nucleic acid sequence) encoding a kinase (e.g. a serine-threonine kinase, for example NEK6), deacetylase enzyme (e.g. , a histone deacetylase, for example HDAC1), splicing factor protein (e.g. , a member of the splicing factor 3b protein complex, for example SF3B 1), polymerase (e.g. , PARP1, PARP2, PARP3, etc.), ligase (e.g. , UFL1), hydrolase (e.g.
  • a gene e.g. , a nucleic acid sequence
  • a kinase e.g. a serine-threonine kinase, for example NEK6
  • deacetylase enzyme e.g. , a histone deacetylase, for example
  • BAP1 BAP1
  • peptidase e.g. , a ubiquitin specific peptidase, for example USP3, USP7, USP16, USP21, or USP22
  • protease e.g. , a histone deubiquitinase, for example MYSM1.
  • the disclosure provides methods for treating a subject having facioscapulohumeral muscular dystrophy (FSHD).
  • FSHD facioscapulohumeral muscular dystrophy
  • a subject is interchangeable with a "subject in need thereof", both of which may refer to a subject having FSHD, or a subject having an increased risk of developing such a disorder relative to the population at large.
  • a subject has a D4Z array comprising 11 or fewer repeat units at chromosome 4q35 but does not exhibit signs or symptoms of FSHD.
  • a subject in need thereof may be a subject having a transcriptionally active DUX4 gene (e.g. , a subject expressing DUX4-A protein).
  • a subject can be a human, non-human primate, rat, mouse, cat, dog, or other mammal.
  • treatment refers to therapeutic treatment and prophylactic or preventative manipulations.
  • therapy refers to therapeutic treatment and prophylactic or preventative manipulations.
  • the terms further include
  • ameliorating existing symptoms preventing additional symptoms, ameliorating or preventing the underlying causes of symptoms, preventing or reversing causes of symptoms, for example, symptoms associated with FSHD.
  • the terms denote that a beneficial result has been conferred on a subject having FSHD, or with the potential to develop such a disorder.
  • treatment is defined as the application or administration of an agent (e.g. , therapeutic agent or a therapeutic composition) to a subject, or an isolated tissue or cell line from a subject, who may have a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
  • an agent e.g. , therapeutic agent or a therapeutic composition
  • Therapeutic agents or therapeutic compositions may include a compound in a
  • a therapeutic composition may be a pharmaceutical composition that prevents and/or reduces the symptoms of a particular disease (e.g. , FSHD).
  • a therapeutic composition may be a pharmaceutical composition that prevents and/or reduces the symptoms of FSHD.
  • the therapeutic composition of the present invention will be provided in any suitable form. The form of the therapeutic composition will depend on a number of factors, including the mode of administration as described herein.
  • the therapeutic composition may contain diluents, adjuvants and excipients, among other ingredients as described herein.
  • the disclosure provides a method for inhibiting (e.g. , silencing) a transcriptionally active DUX4 gene in a cell, the method comprising: contacting the cell with an effective amount of an epigenetic modulator of DUX4, wherein the epigenetic modulator reduces DUX4 expression in the cell.
  • the cell is in vitro or ex vivo.
  • ex vivo modified cell refers to a cell (e.g. , a mammalian cell) that is removed from a subject, genetically modified (e.g. , transfected or transduced with exogenous nucleic acids, or genetically reprogrammed), cultured or expanded, and optionally, returned to a subject (e.g. , either the same subject, or a different subject).
  • ex vivo modified cells are useful for autologous cell therapy, or allogeneic cell therapy.
  • cells may be removed from a subject having a disease associated with a particular genetic defect (e.g. , FSHD), transfected with a gene editing complex that corrects the genetic defect (e.g. reduces expression of DUX4), and reintroduced into the subject.
  • cells are removed from a subject, genetically reprogrammed (e.g. , dedifferentiated or
  • transdifferentiated into muscle cells transdifferentiated into muscle cells
  • expanded transdifferentiated into muscle cells
  • the cell contacted with the effective amount of an epigenetic modulator of DUX4 can be any cell that has a transcriptionally active DUX4 gene.
  • the cell can be a muscle cell (e.g. , a myoblast, a terminally differentiated muscle cell, a muscle satellite cell, or muscle stem cell).
  • a cell having a transcriptionally active DUX4 gene can also comprise a contraction of a D4Z4 repeat array at chromosome 4q35 of the DUX4 gene.
  • the number of repeat units in the array can vary. In some embodiments, the number of repeat units in the contraction is 11 or fewer (e.g. , 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, or 0) repeat units.
  • compositions comprising an epigenetic modulator of DUX4.
  • the composition comprises an epigenetic modulator of DUX4 and a pharmaceutically acceptable carrier.
  • pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
  • Pharmaceutical compositions can be prepared as described below. The active ingredients may be admixed or compounded with any conventional, pharmaceutically acceptable carrier or excipient. The compositions may be sterile.
  • compositions are formulated for delivering an effective amount of an agent (e.g. , an epigenetic modulator of DUX4).
  • an "effective amount" of an active agent refers to an amount sufficient to elicit the desired biological response (e.g., transcriptional repression, such as silencing or inhibition, of the active DUX4 gene).
  • An effective amount of an agent may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the disease being treated (e.g. , FSHD), the mode of administration, and the patient.
  • a composition is said to be a "pharmaceutically acceptable carrier" if its administration can be tolerated by a recipient patient.
  • Sterile phosphate-buffered saline is one example of a pharmaceutically acceptable carrier.
  • Other suitable carriers are well-known in the art. See, for example, REMINGTON'S PHARMACEUTICAL SCIENCES, 18th Ed. (1990).
  • any mode of administration, vehicle or carrier conventionally employed and which is inert with respect to the active agent may be utilized for preparing and administering the pharmaceutical compositions of the present disclosure.
  • Illustrative of such methods, vehicles and carriers are those described, for example, in Remington's Pharmaceutical Sciences, 4th ed. (1970), the disclosure of which is incorporated herein by reference.
  • Those skilled in the art, having been exposed to the principles of the disclosure, will experience no difficulty in determining suitable and appropriate vehicles, excipients and carriers or in compounding the active ingredients therewith to form the pharmaceutical compositions of the disclosure.
  • an effective amount, also referred to as a therapeutically effective amount, of a compound is an amount sufficient to ameliorate at least one adverse effect associated with activation (e.g. , transcriptional activation), or increased expression, of the gene in a cell or in an individual in need of such modulation.
  • an effective amount is an amount sufficient to inhibit (e.g. , transcriptionally repress) DUX4 gene in a cell or in an individual in need of DUX4 inhibition.
  • therapeutically effective amount to be included in pharmaceutical compositions depends, in each case, upon several factors, e.g. , the type, size and condition of the patient to be treated, the intended mode of administration, the capacity of the patient to incorporate the intended dosage form, etc. Generally, an amount of active agent is included in each dosage form to provide from about 0.1 to about 250 mg/kg, and preferably from about 0.1 to about 100 mg/kg. One of ordinary skill in the art would be able to determine empirically an appropriate therapeutically effective amount.
  • an effective prophylactic or therapeutic treatment regimen can be planned which does not cause substantial toxicity and yet is entirely effective to treat the particular subject.
  • the effective amount for any particular application can vary depending on such factors as the disease or condition being treated, the particular therapeutic agent being administered, the size of the subject, or the severity of the disease or condition.
  • One of ordinary skill in the art can empirically determine the effective amount of a particular nucleic acid and/or other therapeutic agent without necessitating undue experimentation .
  • colloidal dispersion systems include lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
  • a colloidal system of the disclosure is a liposome.
  • Liposomes are artificial membrane vessels which are useful as a delivery vector in vivo or in vitro. It has been shown that large unilamellar vesicles (LUVs), which range in size from 0.2 - 4.0 ⁇ can encapsulate large macromolecules. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form. Fraley et al. (1981) Trends Biochem Sci 6:77.
  • Liposomes may be targeted to a particular tissue by coupling the liposome to a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein.
  • Ligands which may be useful for targeting a liposome to, for example, an smooth muscle cell include, but are not limited to: intact or fragments of molecules which interact with smooth muscle cell specific receptors and molecules, such as antibodies, which interact with the cell surface markers of cancer cells. Such ligands may easily be identified by binding assays well known to those of skill in the art.
  • the liposome may be targeted to a tissue by coupling it to an antibody known in the art.
  • Lipid formulations for transfection are commercially available from QIAGEN, for example, as EFFECTENETM (a non-liposomal lipid with a special DNA condensing enhancer) and SUPERFECTTM (a novel acting dendrimeric technology).
  • EFFECTENETM a non-liposomal lipid with a special DNA condensing enhancer
  • SUPERFECTTM a novel acting dendrimeric technology
  • Liposomes are commercially available from Gibco BRL, for example, as
  • LIPOFECTINTM and LIPOFECTACETM which are formed of cationic lipids such as N-[l-(2, 3 dioleyloxy)-propyl]-N, N, N-trimethylammonium chloride (DOTMA) and dimethyl
  • DDAB dioctadecylammonium bromide
  • compaction agents may also be desirable.
  • Compaction agents also can be used alone, or in combination with, a biological or
  • a "compaction agent”, as used herein, refers to an agent, such as a histone, that neutralizes the negative charges on the nucleic acid and thereby permits compaction of the nucleic acid into a fine granule. Compaction of the nucleic acid facilitates the uptake of the nucleic acid by the target cell.
  • the compaction agents can be used alone, e.g. , to deliver an epigenetic modulator of DUX4 in a form that is more efficiently taken up by the cell or, in combination with one or more of the above-described carriers.
  • the compounds may be administered alone (e.g. , in saline or buffer) or using any delivery vehicle known in the art.
  • delivery vehicles have been described: cochleates; Emulsomes; ISCOMs; liposomes; live bacterial vectors (e.g. , Salmonella, Escherichia coli, Bacillus Calmette-Guerin, Shigella, Lactobacillus); live viral vectors (e.g. , Vaccinia, adenovirus, Herpes Simplex, Lentiviral); microspheres; nucleic acid vaccines;
  • epigenetic modulators of DUX4 described by the disclosure are delivered by lentiviral vector.
  • compositions of the disclosure are administered in pharmaceutically acceptable solutions, which may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, adjuvants, and optionally other therapeutic ingredients.
  • pharmaceutically-acceptable carrier means one or more compatible solid or liquid filler, diluents or encapsulating substances which are suitable for administration to a human or other vertebrate animal.
  • carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application.
  • the components of the pharmaceutical compositions also are capable of being commingled with the compounds of the present disclosure, and with each other, in a manner such that there is no interaction which would substantially impair the desired pharmaceutical efficiency.
  • Dragee cores are provided with suitable coatings.
  • suitable coatings For this purpose, concentrated sugar solutions may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures.
  • Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
  • the compounds may also be formulated as a depot preparation.
  • Such long-acting formulations may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
  • compositions also may comprise suitable solid or gel phase carriers or excipients.
  • suitable solid or gel phase carriers or excipients include but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols.
  • Suitable liquid or solid pharmaceutical preparation forms are, for example, aqueous or saline solutions for inhalation, microencapsulated, encochleated, coated onto microscopic gold particles, contained in liposomes, nebulized, aerosols, pellets for implantation into the skin, or dried onto a sharp object to be scratched into the skin.
  • the pharmaceutical compositions also include granules, powders, tablets, coated tablets, (micro)capsules, suppositories, syrups, emulsions, suspensions, creams, drops or preparations with protracted release of active compounds, in whose preparation excipients and additives and/or auxiliaries such as disintegrants, binders, coating agents, swelling agents, lubricants, flavorings, sweeteners or solubilizers are customarily used as described above.
  • the pharmaceutical compositions are suitable for use in a variety of drug delivery systems. For a brief review of methods for drug delivery, see Langer R (1990) Science 249: 1527-1533, which is incorporated herein by reference.
  • the compounds may be administered per se (neat) or in the form of a pharmaceutically acceptable salt.
  • the salts should be pharmaceutically acceptable, but non-pharmaceutically acceptable salts may conveniently be used to prepare pharmaceutically acceptable salts thereof.
  • Such salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulphuric, nitric, phosphoric, maleic, acetic, salicylic, p-toluene sulphonic, tartaric, citric, methane sulphonic, formic, malonic, succinic, naphthalene-2-sulphonic, and benzene sulphonic.
  • such salts can be prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts of the carboxylic acid group.
  • Suitable buffering agents include: acetic acid and a salt (1-2% w/v); citric acid and a salt (1-3% w/v); boric acid and a salt (0.5-2.5% w/v); and phosphoric acid and a salt (0.8-2% w/v).
  • Suitable preservatives include benzalkonium chloride (0.003-0.03% w/v); chlorobutanol (0.3- 0.9% w/v); parabens (0.01-0.25% w/v) and thimerosal (0.004-0.02% w/v).
  • compositions may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the compounds into association with a carrier which constitutes one or more accessory ingredients. In general, the compositions are prepared by uniformly and intimately bringing the compounds into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product.
  • Liquid dose units are vials or ampoules. Solid dose units are tablets, capsules and suppositories.
  • compositions of the present disclosure preferably contain a pharmaceutically acceptable carrier or excipient suitable for rendering the compound or mixture administrable orally as a tablet, capsule or pill, or parenterally, intravenously, intradermally, intramuscularly or subcutaneously, or transdermally.
  • a therapeutically effective amount of an epigenetic modulator of DUX4 is delivered to a target tissue or a target cell.
  • DUX4 e.g., DUX4- fl
  • an effective amount of epigenetic modulator of DUX4 is delivered to the muscle cells of a subject.
  • the muscle cells are terminally differentiated muscle cells.
  • differentiated muscle cells include myocytes and myotubes.
  • compositions containing an epigenetic modulator of DUX4 and/or other compounds can be administered by any suitable route for administering medications.
  • routes for administering medications A variety of administration routes are available. The particular mode selected will depend, of course, upon the particular agent or agents selected, the particular condition being treated, and the dosage required for therapeutic efficacy.
  • the methods of this disclosure may be practiced using any mode of administration that is medically acceptable, meaning any mode that produces therapeutic effect without causing clinically unacceptable adverse effects.
  • modes of administration are discussed herein.
  • an effective amount of the epigenetic modulator of DUX4 and/or other therapeutic agent can be administered to a subject by any mode that delivers the agent to the desired surface, e.g., systemic, intramuscular, etc.
  • Administering the pharmaceutical composition of the present disclosure may be accomplished by any means known to the skilled artisan.
  • Routes of administration include but are not limited to oral, parenteral, intravenous, intramuscular, intraperitoneal, intranasal, sublingual, intratracheal, inhalation, subcutaneous, ocular, vaginal, and rectal.
  • Systemic routes include oral and parenteral.
  • Several types of devices are regularly used for administration by inhalation. These types of devices include metered dose inhalers (MDI), breath-actuated MDI, dry powder inhaler (DPI), spacer/holding chambers in combination with MDI, and nebulizers.
  • MDI metered dose inhalers
  • DPI dry powder inhaler
  • spacer/holding chambers in combination with MDI and nebulizers.
  • the compounds can be formulated readily by combining the active compound(s) with pharmaceutically acceptable carriers well known in the art.
  • Such carriers enable the compounds of the disclosure to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a subject to be treated.
  • Pharmaceutical preparations for oral use can be obtained as solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
  • Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium
  • carboxymethylcellulose and/or polyvinylpyrrolidone (PVP).
  • disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
  • the oral formulations may also be formulated in saline or buffers for neutralizing internal acid conditions or may be administered without any carriers.
  • compositions which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol.
  • the push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
  • the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols.
  • stabilizers may be added.
  • Microspheres formulated for oral administration may also be used. Such microspheres have been well defined in the art. All formulations for oral administration should be in dosages suitable for such administration.
  • compositions may take the form of tablets or lozenges formulated in conventional manner.
  • the compounds for use according to the present disclosure may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g. ,
  • the dosage unit may be determined by providing a valve to deliver a metered amount.
  • Capsules and cartridges of e.g., gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
  • the compounds when it is desirable to deliver them systemically, may be formulated for parenteral administration by injection, e.g. , by bolus injection or continuous infusion.
  • Formulations for injection may be presented in unit dosage form, e.g. , in ampoules or in multi- dose containers, with an added preservative.
  • the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
  • compositions for parenteral administration include aqueous solutions of the active compounds in water-soluble form.
  • suspensions of the active compounds may be prepared as appropriate oily injection suspensions.
  • Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes.
  • Aqueous injection suspensions may contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran.
  • the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
  • the active compounds may be in powder form for constitution with a suitable vehicle, e.g. , sterile pyrogen-free water, before use.
  • the compounds may also be formulated in rectal or vaginal compositions such as suppositories or retention enemas, e.g. , containing conventional suppository bases such as cocoa butter or other glycerides.
  • Other delivery systems can include time-release, delayed release or sustained release delivery systems. Such systems can avoid repeated administrations of the compounds, increasing convenience to the subject and the physician.
  • Many types of release delivery systems are available and known to those of ordinary skill in the art. They include polymer base systems such as poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polyanhydrides. Microcapsules of the foregoing polymers containing drugs are described in, for example, U.S. Pat. No. 5,075, 109.
  • Delivery systems also include non-polymer systems that are: lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-, di-, and tri-glycerides; hydrogel release systems; silastic systems; peptide-based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like.
  • Specific examples include, but are not limited to: (a) erosional systems in which an agent of the disclosure is contained in a form within a matrix such as those described in U.S. Pat. Nos. 4,452,775, 4,675, 189, and 5,736,152, and (b) diffusional systems in which an active component permeates at a controlled rate from a polymer such as described in U.S. Pat. Nos. 3,854,480, 5,133,974 and 5,407,686.
  • pump-based hardware delivery systems can be used, some of which are adapted for implantation.
  • an inhibitory oligonucleotide e.g. , interfering RNA
  • An expression vector is one into which a desired sequence may be inserted, e.g. , by restriction and ligation, such that it is operably joined to regulatory sequences and may be expressed as an RNA transcript.
  • An expression vector typically contains an insert that is a coding sequence for a protein or for a inhibitory oligonucleotide such as an shRNA, a miRNA, or an miRNA.
  • Vectors may further contain one or more marker sequences suitable for use in the identification of cells that have or have not been transformed or transfected with the vector.
  • Markers include, for example, genes encoding proteins that increase or decrease either resistance or sensitivity to antibiotics or other compounds, genes that encode enzymes whose activities are detectable by standard assays or fluorescent proteins, etc.
  • a coding sequence e.g. , protein coding sequence, miRNA sequence, shRNA sequence
  • regulatory sequences are said to be "operably” joined when they are covalently linked in such a way as to place the expression or transcription of the coding sequence under the influence or control of the regulatory sequences.
  • coding sequences be translated into a functional protein
  • two DNA sequences are said to be operably joined if induction of a promoter in the 5' regulatory sequences results in the transcription of the coding sequence and if the nature of the linkage between the two DNA sequences does not (1) result in the introduction of a frame- shift mutation, (2) interfere with the ability of the promoter region to direct the transcription of the coding sequences, or (3) interfere with the ability of the corresponding RNA transcript to be translated into a protein.
  • a promoter region would be operably joined to a coding sequence if the promoter region were capable of effecting transcription of that DNA sequence such that the resulting transcript might be translated into the desired protein or polypeptide.
  • a coding sequence may encode an miRNA, shRNA or miRNA.
  • regulatory sequences needed for gene expression may vary between species or cell types, but shall in general include, as necessary, 5' non-transcribed and 5' non-translated sequences involved with the initiation of transcription and translation respectively, such as a TATA box, capping sequence, CAAT sequence, and the like.
  • 5' non-transcribed regulatory sequences will include a promoter region that includes a promoter sequence for transcriptional control of the operably joined gene.
  • Regulatory sequences may also include enhancer sequences or upstream activator sequences as desired.
  • the vectors of the disclosure may optionally include 5' leader or signal sequences.
  • a virus vector for delivering a nucleic acid molecule is selected from the group consisting of adenoviruses, adeno-associated viruses, poxviruses including vaccinia viruses and attenuated poxviruses, Semliki Forest virus, Venezuelan equine
  • viruses and virus-like particles which have been used to deliver exogenous nucleic acids include:
  • replication-defective adenoviruses a modified retrovirus, a nonreplicating retrovirus, a replication defective Semliki Forest virus, canarypox virus and highly attenuated vaccinia virus derivative, non-replicative vaccinia virus, replicative vaccinia virus, Venzuelan equine encephalitis virus, Sindbis virus, lentiviral vectors and Ty virus-like particle.
  • the adeno-associated virus is capable of infecting a wide range of cell types and species and can be engineered to be replication-deficient. It further has advantages, such as heat and lipid solvent stability, high transduction frequencies in cells of diverse lineages, including hematopoietic cells, and lack of superinfection inhibition thus allowing multiple series of transductions.
  • the adeno-associated virus can integrate into human cellular DNA in a site-specific manner, thereby minimizing the possibility of insertional mutagenesis and variability of inserted gene expression.
  • adeno-associated virus infections have been followed in tissue culture for greater than 100 passages in the absence of selective pressure, implying that the adeno- associated virus genomic integration is a relatively stable event.
  • the adeno-associated virus can also function in an extrachromosomal fashion.
  • Non-cytopathic viruses include certain retroviruses, the life cycle of which involves reverse transcription of genomic viral RNA into DNA with subsequent proviral integration into host cellular DNA.
  • the retroviruses are replication-deficient (e.g., capable of directing synthesis of the desired transcripts, but incapable of manufacturing an infectious particle).
  • retroviral expression vectors have general utility for the high-efficiency transduction of genes in vivo.
  • an epigenetic modulator of DUX4 e.g., an interfering RNA or a gene editing complex
  • a cell e.g. a cell of a subject
  • nucleic acid molecules of the disclosure may be introduced into cells, depending on whether the nucleic acid molecules are introduced in vitro or in vivo in a host.
  • Such techniques include transfection of nucleic acid molecule-calcium phosphate precipitates, transfection of nucleic acid molecules associated with DEAE, transfection or infection with the foregoing viruses including the nucleic acid molecule of interest, liposome-mediated transfection, and the like.
  • N-TERTM Nanoparticle Transfection System by Sigma- Aldrich FectoFlyTM transfection reagents for insect cells by Polyplus Transfection, Polyethylenimine "Max” by Polysciences, Inc., Unique, Non- Viral Transfection Tool by Cosmo Bio Co., Ltd., LipofectamineTM LTX Transfection Reagent by Invitrogen, SatisFectionTM Transfection Reagent by Stratagene, LipofectamineTM
  • the disclosure relates to methods of identifying agents that function as epigenetic modulators of DUX4. Accordingly, in some embodiments, the disclosure provides a method for identifying epigenetic modulators of DUX4, the method comprising: contacting a cell characterized by the expression of DUX4 (e.g.. DUX4-fl) with a candidate agent for modulating expression or activity of a putative chromatin modifier of DUX4
  • candidate agents include, but are not limited to small molecules, antibodies, antibody conjugates, peptides, proteins, antisense molecules (e.g. , interfering RNAs) or other nucleic acids.
  • methods described by the disclosure are useful for screening large libraries of candidate compounds (e.g. , compound libraries) to identify new epigenetic modulators of DUX4.
  • compound libraries consist of candidate agents specific for a particular target nucleic acid (e.g.
  • candidate agents are inhibitors of a histone demethylase (e.g. , lysine demethylase enzyme), histone
  • methlytransferase methlytransferase, histone deacetylase, histone acetyltransferase, bromodomain-containing protein, kinase (e.g. , kinase that phosphorylates histone proteins), or an actin-dependent regulator of chromatin.
  • automated liquid handling systems are generally utilized for high throughput drug screening.
  • Automated liquid handling systems utilize arrays of liquid dispensing vessels, controlled by a robotic arm, to distribute fixed volumes of liquid to the wells of an assay plate. Generally, the arrays comprise 96, 384 or 1536 liquid dispensing tips.
  • Non-limiting examples of automated liquid handling systems include digital dispensers (e.g., HP D300 Digital Dispenser) and pinning machines (e.g., MULTI- BLOTTM Replicator System, CyBio, Perkin Elmer Janus).
  • Non-automated methods are also contemplated by the disclosure, and include but are not limited to a manual digital repeat multichannel pipette.
  • screening methods described by the disclosure are carried out in a high throughput mode.
  • high-throughput screening is carried out in a multi- well cell culture plate.
  • the multi-well plate is plastic or glass.
  • the multi-well plate comprises an array of 6, 24, 96, 384 or 1536 wells.
  • the skilled artisan recognizes that multi-well plates may be constructed into a variety of other acceptable configurations, such as a multi-well plate having a number of wells that is a multiple of 6, 24, 96, 384 or 1536.
  • the multi-well plate comprises an array of 3072 wells (which is a multiple of 1536).
  • the expression level DUX4 in the cell can be measured by any suitable means known in the art.
  • expression level of DUX4 in a cell can be measured by a hybridization- based method.
  • hybridization-based assays include reverse transcription polymerase chain reaction (RT-PCR), quantitative RT-PCR (qRT-PCR), Northern blot, and Southern blot.
  • RT-PCR reverse transcription polymerase chain reaction
  • qRT-PCR quantitative RT-PCR
  • Northern blot e.g. , Northern blot
  • Southern blot e.g. , Southern blot.
  • the expression level DUX4 (e.g. , DUX4-fl) in the cell is measured by a protein-based method.
  • protein-based assays include, but are not limited to, Western blot, Bradford assay, Lowry protein assay, and spectroscopic methods (e.g.
  • expression level DUX4 (e.g. , DUX4-fl) in the cell is determined by a cell-based method.
  • cell-based assays include flow cytometry, fluorescent activated cell sorting (FACS), magnetic- activated cell sorting (MACS).
  • FACS fluorescent activated cell sorting
  • MCS magnetic- activated cell sorting
  • cells are modified such that DUX4 inhibition is operably linked to expression of a resistance gene, and thus inhibition (e.g. , transcriptional repression) of DUX4 allows growth and selection of cells in the presence of a selection media. Additional methods of quantifying expression level DUX4 in the cell will be readily apparent to those skilled in the art.
  • a candidate compound can be identified as an epigenetic modulator of DUX4 if the amount of DUX4 expressed in the presence of the candidate compound is less than (e.g. , reduced relative to) the amount expressed in the absence of candidate compound.
  • the amount of DUX4 expressed in the presence of an epigenetic modulator of DUX4 can range from about 1% to about 100% less, about 5% to about 50% less (e.g. , about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, or about 50% less), about 10% to about 40% less, or about 20% to about 30% less than the amount of DUX4 expressed in the absence of the epigenetic modulator of DUX4.
  • DUX4 is not expressed (e.g. , transcriptionally inactive, or silenced) in the presence of an epigenetic modulator of DUX4 and is expressed (e.g. , transcriptionally active) in the absence of an epigenetic modulator of DUX4.
  • This example describes targeting the regulatory mechanism governing the aberrant increase in DUX4 transcriptions for treatment of Facioscapulohumeral muscular dystrophy (FSHD).
  • FSHD Facioscapulohumeral muscular dystrophy
  • regulatory factors that are causing DUX4 to be ON in muscle of subjects having FSHD are described.
  • regulatory factors are, in some embodiments, targets for small molecule therapies to treat FSHD.
  • a screen to identify genes involved in DUX4 expression was performed. Briefly, primary differentiated myocytes derived from subjects having FSHD were treated with shRNA targeting candidate genes and the expression level of pathogenic DUX4-fl mRNA was quantified. The expression levels of other myogenic regulators (e.g. , Myogenin, MyoD, MyHD) and other targets (e.g. , FRG1, UTRN, and 18S) were also quantified to assess indirect effects of DUX4 knockdown.
  • a sample screening protocol is shown below: Example Screening Protocol
  • candidate genes A list providing non-limiting examples of candidate genes is provided in Table 2. In total, 39 candidate genes from Table 2 were screened; each candidate gene was infected with 2-3 different shRNAs, also shown in Table 2. Relative gene expression for DUX4, Myogenin, MyoD, MyHC, FRG1, UTRN, and 18S are shown in Table 3.
  • Fig. 1 shows effects of shRNA knockdown of BRD2, BRD3, BRD4, and BRDT, on expression of Dux4 (DUX4-fl), other myogenic factors (Myogenin, MyoD, MyHC), FRGl, UTRN, and 18S.
  • Data indicate that knockdown of BRD2 with two different shRNAs reduces 5 DUX4-fl expression. However, knockdown of BRD4 has little effect on DUX4 expression.
  • Fig. 2 shows effects of shRNA knockdown of CARM1, KMT2A, and KDM4A-4D, on expression of Dux4 (DUX4-fl) and a panel of additional genes of interest (Myogenin, MyoD, MyHC, FRG1, UTRN, and 18S).
  • BAZ2A Bromodomain Adjacent To Zinc Finger Domain 2A
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 SMARCA5
  • SMARCA5 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5
  • BAP1 BRCA1 Associated Protein 1
  • ASHIL ASHIL
  • Dux4 DUX4-fl
  • Myogenin MyoD
  • MyHC FSHD Region Gene 1
  • Utrophin Utrophin
  • Fig 4 shows from the screen described above, 5 candidate genes (SMARCA5, BRD2, KDM4C, ASHIL, and BAZIA) that fit the following criteria were identified: 1) candidate genes function in separate pathways, and knocking down each gene individually decreases DUX4 expression; 2) multiple shRNAs targeting each of these candidate genes yield a similar knockdown of DUX4 expression (e.g. , to minimize possible off-target effect); 3) targeting these candidate genes did not adversely affect cell morphology or the expression of muscle-specific genes; and, 4) the proteins encoded by the candidate genes contain small molecule druggable domains.
  • the inhibition or knockdown of any one or combination of these candidate genes (or another candidate gene identified by the screening method described above) using small molecules can inhibit or decrease transcription of DUX4 and/or induce a repressive chromatin environment at D4Z4 repeat arrays.
  • the genes identified in this screen are previously unrecognized regulators of DUX4 expression and therapeutic targets for FSHD.
  • the screen described in this example incorporates several important experimental aspects that are likely absent from other screens: 1) the use of primary muscle cells from an FSHD patient; 2) performing the screen on terminally differentiated muscle cells (as in a patient' s muscles); 3) directly assaying levels of the pathogenic mRNA isoform of DUX4 (DUX4-fl) rather than a reporter or a downstream target; 4) screening out candidates that affect myogenic genes; and, 5) reverting the D4Z4 repeat array chromatin back to a nonpathogenic state, which in some embodiments renders a therapy targeting the identified candidate gene more stable and long- term.
  • sgRNAs single guide RNAs targeting chromatin modifiers of DUX4 expression ⁇ e.g., KDM4C, ASH1L, SMARCA5,
  • BAZIA BRD2
  • Fig. 5 provides a graphic depiction of the CRISPR/dCas9/KRAB transcription modulation system described in this example.
  • Knockdowns were performed in 17ABic cells, which are myogenic cells derived from a FSHD patient. Between six and eight sgRNAs were tested for each candidate gene. Table 4 describes examples of guide RNAs targeting chromatin modifiers of DUX4.
  • gRNAs Guide RNAs
  • DUX4-fl D4-fl
  • FRG1 MyoG
  • MyHC MyHC
  • 18S MyoD
  • levels of gene-specific knockdown were consistent with CRISPR/Cas9-mediated knockdown reported in the field (e.g., as described by Radzisheuskaya et al. (2016) Nucleic Acids Research 1; doi: 10.1093/nar/gkw583).
  • Fig. 6 shows representative data for lentiviral-based dCas9-KRAB knockdown of KDM4C in 17ABic cells. Data from experiments using two different guide RNAs (gRNAs) are shown. Each guide strand mediated a decrease in DUX4-fl (D4-fl). Expression levels of KDM4C were approximately 80% after knockdown, indicating that DUX4 expression is very sensitive to changes in KDM4C expression level.
  • gRNAs guide RNAs
  • Fig. 7 shows representative data for lentiviral-based dCas9-KRAB knockdown of ASH1L in 17ABic cells. Data from experiments using a single guide RNA (gRNA) are shown. Knockdown of ASH1L (approximately 20%) resulted in a decrease of DUX4-fl expression. Expression levels of MyoG and MyoD were not significantly changed.
  • gRNA single guide RNA
  • Fig. 8 shows representative data for lentiviral-based dCas9-KRAB knockdown of SMARCA5 in 17ABic cells. Data from experiments using two different guide RNAs (gRNAs) are shown. Each guide strand mediated a decrease in DUX4-fl (D4-fl). Expression levels of SMARCA5 were approximately 75% after knockdown, indicating that DUX4 expression is very sensitive to changes in SMARCA5 expression level. Expression levels of MyoG and MyoD were not significantly changed.
  • Fig. 9 shows representative data for lentiviral-based dCas9-KRAB knockdown of BAZ1A in 17ABic cells. Data from experiments using two different guide RNAs (gRNAs) are shown. Each guide strand mediated a decrease in DUX4-fl (D4-fl), which correlates with reduction of BAZl A expression level. Knockdown of BAZl A resulted in the largest decrease in DUX4 expression level of any gene tested.
  • gRNAs guide RNAs
  • Fig. 10 shows representative data for lentiviral-based dCas9-KRAB knockdown of BRD2 in 17ABic cells. Data from experiments using a single guide RNA (gRNA) are shown. A decrease in DUX4 expression level was observed.
  • gRNA single guide RNA
  • knockdown of KDM4C, ASH1L, SMARCA5, BAZ1A, BRD2 using a gene editing complex confirms the RNAi results described Example 1 in the context of reducing DUX4 expression level by inhibiting a chromatin modifier of DUX4.
  • the pHAGE EFl-dCas9-KRAB (Addgene plasmid #50919) and pLKO.l-puro U6 sgRNA BfuAI stuffer lentiviral plasmids were obtained.
  • sgRNA design tool was used to identify candidate single-stranded guide RNAs (sgRNAs) targeting the promoter/exon 1 regions of human BAZ1A, BRD2,
  • sgRNAs that target sequences flanking dual protospacer adjacent motifs (PAMs) recognizable by both SaCas9 and SpCas9 were prioritized. Predicted off-target matches were determined using the CRISPR Design Tool (http://crispr.mit.edu). Six to eight sgRNAs for each target gene were cloned individually into BfuAI sites in the pLKO.l-puro U6 sgRNA BfuAI stuffer plasmid and sequence-verified.
  • PAMs dual protospacer adjacent motifs
  • 293T packaging cells were grown in DMEM + 10% FBS + 0.1% penicillin- strep tavidin.
  • 293T cells were transfected with lentiviral packaging plasmid (pCMV-dR8.91), envelope plasmid (VSV-G), and SIGMA MISSION shRNA expression plasmids. Lentiviral supernatants were harvested, aliquoted, and frozen at -80 °C.
  • FSHD1 skeletal myoblasts were seeded in collagen-coated 6-well plates (for gene expression analysis) or 10-cm plates (for ChIP) and grown to confluence, then allowed to self-differentiate in growth medium for -48 h.
  • Cells were subjected to two rounds of infection. Briefly, lentiviral supernatants + 8 g/ml polybrene were added to cultures and the plates were incubated for 15 min at 37 °C, then wrapped well with parafilm before centrifuging for 30 min at 1100 g (32 °C). Following centrifugation, the viral supernatants were replaced with growth medium. Cells were maintained in growth medium and harvested 4 d after the last round of infection.
  • dCas9- KRAB infections 293T cells were transfected with lentiviral packaging plasmid (pCMV- dR8.91), envelope plasmid (VSV-G), and either dCas9-KRAB expression plasmid (#50919) or sgRNA expression plasmid using the TransIT-LTl transfection reagent.
  • Lentiviral supematants were harvested at 11-h intervals from 72-108 h post-transfection.
  • FSHD1 skeletal myoblasts were seeded in collagen-coated 6-well plates and grown to -80% confluency, then subjected to four serial infections over two days. Cells were allowed to recover for -8 h in growth medium prior to the next round of infection. Following the last infection, these self-differentiated cultures were maintained in growth medium for 72 h prior to harvesting.
  • Quantitative reverse transcriptase PCR Quantitative reverse transcriptase PCR
  • RNAs were extracted using TRIzol (Invitrogen) and purified using the RNeasy Mini kit (Qiagen) after on-column DNase I digestion. Total RNA (2 ⁇ g) was used for cDNA synthesis using Superscript III Reverse Transcriptase (Invitrogen), and 200 ng of cDNA were used for qPCR analysis. Oligonucleotide primer sequences are provided in Table 5.
  • G at this position is specific to chromosome 4 (G) vs chromosome 10 (T)
  • Chromatin immunoprecipitation (ChIP).
  • ChIP assays were performed with lentiviral-infected 17Abic differentiated myocytes using the Fast ChIP method (Nelson) with some modifications. Cells were fixed in 1% formaldehyde in DMEM for 10 min and dounced 10X prior to sonication. Cells were sonicated for 12 rounds of 15-sec pulses at 65% power output on a Branson Sonifier 450 (VWR Scientific) to shear the DNA to a ladder of -200-800 bp, and efficiency of shearing was verified by agarose gel electrophoresis. Chromatin was immunoprecipitated using 2 ⁇ g of specific antibodies.
  • SYBR green quantitative PCR assays were performed for 40 cycles of: 94 °C for 15 sec, 55 °C for 30 sec, and 72 °C for 30 sec. PCR products were analyzed on a 1.5% agarose gel to verify correct size of products and specificity of primer annealing. Oligonucleotide primer sequences are provided in Table 5.
  • the D4Z4 macrosatellite array that encodes DUX4 is normally under strong epigenetic repression in adult somatic cells.
  • FSHD patients exhibit a loss of this repression, displaying DNA hypomethylation at the 4q D4Z4 array and chromatin relaxation (reduced enrichment of the repressive H3K9me3 mark, ⁇ , and cohesin) at the D4Z4 arrays on both 4q and lOq.
  • Thirty-six candidate activators of DUX4-fl were investigated as potential drug targets (Table 3). These candidates include transcriptional regulators, chromatin remodelers, and histone modifying enzymes.
  • skeletal myocytes from an FSHD1 patient (05 Abie) which express consistent and relatively high levels of DUX4-fl when terminally differentiated were used.
  • lentivirus -encoded shRNAs each candidate was knocked down in terminally differentiated cultures, then cells were harvested four days later and assessed for expression of DUX4-fl and other genes.
  • ASH1L the mammalian homologue of the Drosophila Trithorax group protein that counteracts Polycomb-mediated gene silencing
  • ASH1L is a histone methyltransferase that is capable of activating DUX4 expression in FSHD.
  • ASH1L is recruited proximal to the D4Z4 array by the DBE-T IncRNA, resulting in H3K36me2 enrichment and de-repression of the FSHD locus. It was observed that knockdown of ASH1L with three different shRNAs reduced DUX4-fl expression by -70-80% ( Figure 11A).
  • knockdown of the epigenetic reader BRD2 Figure 11C
  • the lysine-specific histone demethylase KDM4C Figure 1 ID
  • shRNA knockdowns iASHIL, BRD2, KDM4C, and SMARCA5 were tested in myocytes from two other unrelated FSHD1 patients (18Abic and 17Abic), with similar results.
  • Transcriptional repression of candidate regulators by dCas9-KRAB reduces DUX4-fl expression in FSHD myocytes.
  • Five of the candidates, ASH1L, BAZ1A, BRD2, KDM4C, and SMARCA5 were selected for investigation by a second gene silencing modality.
  • the enzymatically inactive dCas9 fused to transcriptional effectors (KRAB, LSD1, VP64, p300) can modulate endogenous target gene expression in mammalian cells.
  • dCas9-KRAB When recruited to regions near the transcriptional start site (TSS) of active genes ⁇ e.g., -50 to +250 base pairs), dCas9-KRAB can be an effective transcriptional repressor.
  • TSS transcriptional start site
  • 6-8 sgRNAs targeting the promoter or exon 1 were designed.
  • the sgRNAs and dCas9-KRAB were transduced into 17Abic myocytes using four serial co-infections with centrifugation. Cells were harvested 72 h later and assayed for changes in gene expression.
  • Chromatin immunoprecipitation was performed for several histone modifications following shRNA knockdown of either ASH1L (Figure 13 A), BRD2 (Figure 13B), KDM4C (Figure 13C), or SMARCA5 ( Figure 13D) in 17Abic FSHD myocytes.
  • shRNAs that gave strong, consistent knockdowns of each target gene across all FSHD cohorts tested were assessed.
  • Levels of enrichment were ⁇ 40%-2-fold, and indicate an increase in repression at the distal de-repressed pathogenic repeat among a background of heterochromatic 4q repeats.
  • patient 17 A has ⁇ 5 repeat units on the contracted 4A161 allele and -26 repeat units on the non-contracted 4A-L161 allele.
  • Relative occupancy of H3K36me3 at 4-specific D4Z4 (e.g., chromosome 4 vs 10 specific polymorphism at 3' end of R primer), D4Z4 5' flank (upstream of array), Myogenin promoter (active, muscle-specific gene promoter), and 4p array (another heterochromatic array on ch 4) was also assessed after knockdown of BRD2 ( Figure 14A), ASH1L ( Figure 14B), SMARCA5 ( Figure 14C), and KDM4C ( Figure 14D). Data indicate a significant enrichment at 4-specific D4Z4 in BRD2 and KDMC4 knockdown cells ( Figures 14A and 14D). Enrichment at the Myogenin promoter was not significant compared to empty vector controls, and there was little to no enrichment at the heterochromatic 4p array.
  • D4Z4 e.g., chromosome 4 vs 10 specific polymorphism at 3' end of R primer
  • D4Z4 5' flank upstream of array
  • data described in this example indicate that independent knockdown of multiple chromatin regulators results in chromatin repression at D4Z4 and a substantial decrease in DUX4-fl expression in FSHD myocytes, and that modest inhibition of certain epigenetic pathways can substantially reduce levels of DUX4-fl, demonstrating their potential as novel drug targets for FSHD.
  • Trichostatin A is a histone deacetylase inhibitor
  • 5-aza-2'- deoxycytidine 5 'ADC
  • chaetocin CH
  • Treatment of primary myoblasts isolated from FSHD 1 -affected e.g., Cohort 28 A, 29A, 30A, and 15 A
  • FSHD-asymptomatic e.g., Cohort 28B, 29B, 30B, and 15B
  • Small molecules that affect DUX4 expression by altering myogenic differentiation are acting indirectly and are not viable candidates for FSHD.
  • JQ1 is a small molecule epigenetic drug that appears to inhibit DUX4 expression and downstream genes TRIM43 and ZSCAN4 in primary FSHD muscle cells (09 Abie).
  • JQ1 regulation of DUX4 is indirect and achieved by inhibiting the expression of several key myogenic regulatory genes myogenin (Myog), myoD, myosin heavy chain (MyHC), and myostatin (Myost) (Figure 16).
  • DUX4 expression is induced during myogenic differentiation, and blocking or slowing down this process, as the case with JQ1, give the appearance of inhibiting DUX4 expression, when in fact it is merely altering the kinetics of myoginc differentiation.
  • JQ1 is an example of a non-specific small molecule and not appropriate for use as an FSHD therapeutic.
  • ZSCAN4 plays a role in telomere maintenance and regulation of embryonic stem cell pluripotency. Briefly, FSHD skeletal muscle myotubes were treated with antisense oligonucleotides that target DUX-4, SMARCA5, or KDM4C and the relative expression of the indicated gene was determined using RT-PCR.
  • Example 5 The following materials were used in Example 5.
  • Pen/Strep (Gibco, 15140148). Skeletal Muscle Cell Differentiation Medium (PromoCell, C- 23061) supplemented with 20% KnockOut Serum Replacement (Gibco, 10828010) and
  • Pen/Strep (Differentiation media). EmbryoMax 0.1% Gelatin Solution (EMDmiUipore ES-006- B). PBS (Gibco, 10010023),Tissue culture treated 96-well microplate (Corning, CLS3595),TC- Treated Multiwell Cell Culture Plat (Falcon, 353046).
  • Real Time PCR reagents included: Lysis buffer-Roche Realtime Ready lysis buffer 19.5uL.(for 20uL) (Roche, 07248431001), DNAse I (Ambion, AM2222) 0.25 uL, Protector RNase Inhibitor (Roche, 3335402001) 0.25 uL,.
  • RNeasy Micro Kit Qiagen, 74004
  • Taqman Preamp Master Mix ThermoFisher Scientific, 4391128
  • Taqman Multiplex Master Mix ThermoFisher Scientific, 4484262
  • ZSCAN4 Taqman Assay ThermoFisher Scientific, Hs00537549_ml, FAM-MGB
  • MYOG Taqman Assay ThermoFisher Scientific,
  • Hs99999902_ml LEUTX Taqman Assay (ThermoFisher Scientific, Hs00418470_ml).
  • Antisense oligonucleotide sequences are shown in Table 5.
  • Non-targeting 27 AACACGTCTATACGC Fig. 11 shows that ZSCAN4 expression in FSHD skeletal muscle myotubes was reduced by knockdown of DUX-4 using antisense oligonucleotides.
  • DMSO treated FSHD skeletal muscle myotubes and wild type myotubes were used as controls.
  • Fig. 12 shows that ZSCAN4 expression in FSHD skeletal muscle myotubes was reduced by knockdown of SMARCA5 and KDM4C.
  • Non-targeting antisense oligonucleotides were used as a control.
  • KPAFLS GEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDS VEIS G VEDRFN AS LGT Y

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Molecular Biology (AREA)
  • Biomedical Technology (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Organic Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Zoology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Physics & Mathematics (AREA)
  • Microbiology (AREA)
  • Immunology (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Cell Biology (AREA)
  • Biophysics (AREA)
  • Plant Pathology (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Mycology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Toxicology (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Neurology (AREA)
  • General Chemical & Material Sciences (AREA)
PCT/US2017/060410 2016-11-07 2017-11-07 Therapeutic targets for facioscapulohumeral muscular dystrophy Ceased WO2018085842A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
EP21161592.7A EP3896451B1 (en) 2016-11-07 2017-11-07 Carm1 inhibitors for facioscapulohumeral muscular dystrophy
JP2019523836A JP7231226B2 (ja) 2016-11-07 2017-11-07 顔面肩甲上腕型筋ジストロフィーのための治療標的
EP17867141.8A EP3535588A4 (en) 2016-11-07 2017-11-07 THERAPEUTIC TARGET MOLECULES FOR FACIO-CAPULOHUMERAL MUSCLE DYSTROPHY
CA3042700A CA3042700A1 (en) 2016-11-07 2017-11-07 Therapeutic targets for facioscapulohumeral muscular dystrophy
AU2017355712A AU2017355712B2 (en) 2016-11-07 2017-11-07 Therapeutic targets for facioscapulohumeral muscular dystrophy
US16/347,688 US11160823B2 (en) 2016-11-07 2017-11-07 Therapeutic targets for facioscapulohumeral muscular dystrophy
US17/489,983 US11963975B2 (en) 2016-11-07 2021-09-30 Therapeutic targets for facioscapulohumeral muscular dystrophy
US17/714,349 US20220226364A1 (en) 2016-11-07 2022-04-06 Therapeutic targets for facioscapulohumeral muscular dystrophy
JP2023018459A JP2023071691A (ja) 2016-11-07 2023-02-09 顔面肩甲上腕型筋ジストロフィーのための治療標的

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201662418694P 2016-11-07 2016-11-07
US62/418,694 2016-11-07
US201762490783P 2017-04-27 2017-04-27
US62/490,783 2017-04-27

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/347,688 A-371-Of-International US11160823B2 (en) 2016-11-07 2017-11-07 Therapeutic targets for facioscapulohumeral muscular dystrophy
US17/489,983 Continuation US11963975B2 (en) 2016-11-07 2021-09-30 Therapeutic targets for facioscapulohumeral muscular dystrophy

Publications (1)

Publication Number Publication Date
WO2018085842A1 true WO2018085842A1 (en) 2018-05-11

Family

ID=62076463

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/060410 Ceased WO2018085842A1 (en) 2016-11-07 2017-11-07 Therapeutic targets for facioscapulohumeral muscular dystrophy

Country Status (6)

Country Link
US (3) US11160823B2 (cg-RX-API-DMAC7.html)
EP (2) EP3896451B1 (cg-RX-API-DMAC7.html)
JP (2) JP7231226B2 (cg-RX-API-DMAC7.html)
AU (1) AU2017355712B2 (cg-RX-API-DMAC7.html)
CA (1) CA3042700A1 (cg-RX-API-DMAC7.html)
WO (1) WO2018085842A1 (cg-RX-API-DMAC7.html)

Cited By (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2020252455A1 (en) * 2019-06-13 2020-12-17 The General Hospital Corporation Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells
JP2022516515A (ja) * 2018-12-31 2022-02-28 リサーチ インスティチュート アット ネイションワイド チルドレンズ ホスピタル Rna標的化crispr-cas13bを使用するdux4 rna発現停止
CN115768487A (zh) * 2020-04-17 2023-03-07 内华达研究与创新公司 用于面肩肱型肌营养不良症的crispr抑制
EP4204556A4 (en) * 2020-08-31 2024-10-02 Modalis Therapeutics Corporation Method for treating facioscapulohumeral muscular dystrophy (fshd) by targeting dux4 gene
US12319938B2 (en) 2020-07-24 2025-06-03 The General Hospital Corporation Enhanced virus-like particles and methods of use thereof for delivery to cells
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
US12359218B2 (en) 2017-07-28 2025-07-15 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
US12473573B2 (en) 2013-09-06 2025-11-18 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US12509680B2 (en) 2019-03-19 2025-12-30 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12516308B2 (en) 2017-03-09 2026-01-06 President And Fellows Of Harvard College Suppression of pain by gene editing
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11160823B2 (en) 2016-11-07 2021-11-02 University Of Massachusetts Therapeutic targets for facioscapulohumeral muscular dystrophy
WO2019060432A2 (en) * 2017-09-19 2019-03-28 Children's National Medical Center GAPMERS AND METHODS OF USING THE SAME FOR THE TREATMENT OF MUSCLE DYSTROPHY
KR102922694B1 (ko) 2018-04-19 2026-02-03 더 리젠츠 오브 더 유니버시티 오브 캘리포니아 유전자 편집을 위한 조성물 및 방법
JP2022055361A (ja) * 2020-09-28 2022-04-07 田辺三菱製薬株式会社 Dux4の発現を調節するための医薬組成物
CN120092093A (zh) * 2022-08-25 2025-06-03 富士胶片株式会社 靶病毒的制造方法及培养组合物
CN115896223A (zh) * 2022-10-19 2023-04-04 中国医学科学院基础医学研究所 一种表观调节因子dot1l在肌肉分化中的应用

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150087636A1 (en) * 2013-09-20 2015-03-26 Saint Louis University Inhibition of DUX4 Expression Using Bromodomain and Extra-Terminal Domain Protein Inhibitors (BETi)
WO2016115490A1 (en) * 2015-01-16 2016-07-21 Ionis Pharmaceuticals, Inc. Compounds and methods for modulation of dux4

Family Cites Families (20)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3854480A (en) 1969-04-01 1974-12-17 Alza Corp Drug-delivery system
US4675189A (en) 1980-11-18 1987-06-23 Syntex (U.S.A.) Inc. Microencapsulation of water soluble active polypeptides
US4452775A (en) 1982-12-03 1984-06-05 Syntex (U.S.A.) Inc. Cholesterol matrix delivery system for sustained release of macromolecules
US5075109A (en) 1986-10-24 1991-12-24 Southern Research Institute Method of potentiating an immune response
US5133974A (en) 1989-05-05 1992-07-28 Kv Pharmaceutical Company Extended release pharmaceutical formulations
US5407686A (en) 1991-11-27 1995-04-18 Sidmak Laboratories, Inc. Sustained release composition for oral administration of active ingredient
US6291438B1 (en) 1993-02-24 2001-09-18 Jui H. Wang Antiviral anticancer poly-substituted phenyl derivatized oligoribonucleotides and methods for their use
US5858988A (en) 1993-02-24 1999-01-12 Wang; Jui H. Poly-substituted-phenyl-oligoribo nucleotides having enhanced stability and membrane permeability and methods of use
US5736152A (en) 1995-10-27 1998-04-07 Atrix Laboratories, Inc. Non-polymeric sustained release delivery system
US5684143A (en) 1996-02-21 1997-11-04 Lynx Therapeutics, Inc. Oligo-2'-fluoronucleotide N3'->P5' phosphoramidates
WO2014071340A1 (en) * 2012-11-05 2014-05-08 University Of Washington Through Its Center For Commercialization Methods and assays for facioscapulohumeral muscular dystrophy
WO2014144455A1 (en) 2013-03-15 2014-09-18 Epizyme, Inc. 1 -phenoxy-3-(alkylamino)-propan-2-ol derivatives as carm1 inhibitors and uses thereof
CA2903813C (en) 2013-03-15 2023-08-29 Epizyme, Inc. Carm1 inhibitors and uses thereof
US20170283440A1 (en) 2014-09-17 2017-10-05 Epizyme, Inc. Carm1 inhibitors and uses thereof
WO2016044604A1 (en) 2014-09-17 2016-03-24 Epizyme, Inc. Carm1 inhibitors and uses thereof
WO2016044641A2 (en) 2014-09-17 2016-03-24 Epizyme, Inc. Carm1 inhibitors and uses thereof
ES2926785T3 (es) * 2015-06-02 2022-10-28 Academisch Ziekenhuis Leiden Medios y métodos para el tratamiento de la distrofia muscular facioescapulohumeral (FSHD)
WO2017201585A1 (en) 2016-05-26 2017-11-30 Genea Ip Holdings Pty Ltd Modulators of dux4 for regulation of muscle function
EP3515506B1 (en) * 2016-09-23 2023-09-13 University of Massachusetts Silencing of dux4 by recombinant gene editing complexes
US11160823B2 (en) 2016-11-07 2021-11-02 University Of Massachusetts Therapeutic targets for facioscapulohumeral muscular dystrophy

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150087636A1 (en) * 2013-09-20 2015-03-26 Saint Louis University Inhibition of DUX4 Expression Using Bromodomain and Extra-Terminal Domain Protein Inhibitors (BETi)
WO2016115490A1 (en) * 2015-01-16 2016-07-21 Ionis Pharmaceuticals, Inc. Compounds and methods for modulation of dux4

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
HIMEDA ET AL.: "CRISPR/dCas9-mediated Transcriptional Inhibition Ameliorates the Epigenetic Dysregulation at D4Z4 and Represses DUX4-fl in FSH Muscular Dystrophy", MOLECULAR THERAPY, vol. 24, no. 3, March 2016 (2016-03-01), pages 527 - 535, XP055497884 *

Cited By (18)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12473573B2 (en) 2013-09-06 2025-11-18 President And Fellows Of Harvard College Switchable Cas9 nucleases and uses thereof
US12516308B2 (en) 2017-03-09 2026-01-06 President And Fellows Of Harvard College Suppression of pain by gene editing
US12390514B2 (en) 2017-03-09 2025-08-19 President And Fellows Of Harvard College Cancer vaccine
US12359218B2 (en) 2017-07-28 2025-07-15 President And Fellows Of Harvard College Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE)
US12522807B2 (en) 2018-07-09 2026-01-13 The Broad Institute, Inc. RNA programmable epigenetic RNA modifiers and uses thereof
JP2022516515A (ja) * 2018-12-31 2022-02-28 リサーチ インスティチュート アット ネイションワイド チルドレンズ ホスピタル Rna標的化crispr-cas13bを使用するdux4 rna発現停止
US12351837B2 (en) 2019-01-23 2025-07-08 The Broad Institute, Inc. Supernegatively charged proteins and uses thereof
US12570972B2 (en) 2019-03-19 2026-03-10 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12509680B2 (en) 2019-03-19 2025-12-30 The Broad Institute, Inc. Methods and compositions for prime editing nucleotide sequences
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
US12351815B2 (en) 2019-06-13 2025-07-08 The General Hospital Corporation Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells
US12404525B2 (en) 2019-06-13 2025-09-02 The General Hospital Corporation Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells
WO2020252455A1 (en) * 2019-06-13 2020-12-17 The General Hospital Corporation Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells
US12351814B2 (en) 2019-06-13 2025-07-08 The General Hospital Corporation Engineered human-endogenous virus-like particles and methods of use thereof for delivery to cells
CN114258398A (zh) * 2019-06-13 2022-03-29 总医院公司 工程化的人内源性病毒样颗粒及使用其递送至细胞的方法
CN115768487A (zh) * 2020-04-17 2023-03-07 内华达研究与创新公司 用于面肩肱型肌营养不良症的crispr抑制
US12319938B2 (en) 2020-07-24 2025-06-03 The General Hospital Corporation Enhanced virus-like particles and methods of use thereof for delivery to cells
EP4204556A4 (en) * 2020-08-31 2024-10-02 Modalis Therapeutics Corporation Method for treating facioscapulohumeral muscular dystrophy (fshd) by targeting dux4 gene

Also Published As

Publication number Publication date
EP3896451B1 (en) 2024-06-26
JP2019534298A (ja) 2019-11-28
CA3042700A1 (en) 2018-05-11
EP3535588A1 (en) 2019-09-11
EP3896451A1 (en) 2021-10-20
US20220152083A1 (en) 2022-05-19
US20220226364A1 (en) 2022-07-21
AU2017355712A1 (en) 2019-05-16
AU2017355712B2 (en) 2024-01-11
JP2023071691A (ja) 2023-05-23
US11963975B2 (en) 2024-04-23
EP3535588A4 (en) 2020-09-16
US20190343865A1 (en) 2019-11-14
JP7231226B2 (ja) 2023-03-01
US11160823B2 (en) 2021-11-02

Similar Documents

Publication Publication Date Title
US11963975B2 (en) Therapeutic targets for facioscapulohumeral muscular dystrophy
US20230250407A1 (en) Silencing of dux4 by recombinant gene editing complexes
US11819554B2 (en) Compositions and methods for modulating FMR1 expression
CN115175991A (zh) 工程化肌肉靶向组合物
JP2016534125A (ja) Hiv感染のrnaガイド処置のための方法および組成物
US20220259654A1 (en) Compositions and methods for xi chromosome reactivation
CA3175625A1 (en) Crispr-inhibition for facioscapulohumeral muscular dystrophy
CN110643705A (zh) 人dgkz基因的用途及其相关药物
WO2018170290A1 (en) Compositions and methods for increasing fmr1 expression
CN120500343A (zh) 用于在治疗与雄激素受体(ar)的功能获得和/或ar辅激活物的过表达相关的疾病中使用的lsd1抑制剂和prmt6抑制剂
WO2022266287A1 (en) Compositions and methods to transfect, test, and treat skin cells

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17867141

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3042700

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019523836

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2017355712

Country of ref document: AU

Date of ref document: 20171107

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017867141

Country of ref document: EP

Effective date: 20190607