US20230250407A1 - Silencing of dux4 by recombinant gene editing complexes - Google Patents
Silencing of dux4 by recombinant gene editing complexes Download PDFInfo
- Publication number
- US20230250407A1 US20230250407A1 US18/065,255 US202218065255A US2023250407A1 US 20230250407 A1 US20230250407 A1 US 20230250407A1 US 202218065255 A US202218065255 A US 202218065255A US 2023250407 A1 US2023250407 A1 US 2023250407A1
- Authority
- US
- United States
- Prior art keywords
- dux4
- domain
- nucleic acid
- expression
- subject
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 238000010362 genome editing Methods 0.000 title claims description 78
- 230000030279 gene silencing Effects 0.000 title description 6
- 102100021158 Double homeobox protein 4 Human genes 0.000 claims abstract description 105
- 101000968549 Homo sapiens Double homeobox protein 4 Proteins 0.000 claims abstract description 105
- 208000037149 Facioscapulohumeral dystrophy Diseases 0.000 claims abstract description 69
- 208000008570 facioscapulohumeral muscular dystrophy Diseases 0.000 claims abstract description 69
- 238000000034 method Methods 0.000 claims abstract description 42
- 108090000623 proteins and genes Proteins 0.000 claims description 93
- 102000004169 proteins and genes Human genes 0.000 claims description 61
- 150000007523 nucleic acids Chemical class 0.000 claims description 53
- 108020005004 Guide RNA Proteins 0.000 claims description 49
- 108091033409 CRISPR Proteins 0.000 claims description 37
- 102000039446 nucleic acids Human genes 0.000 claims description 35
- 108020004707 nucleic acids Proteins 0.000 claims description 35
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 24
- 230000002103 transcriptional effect Effects 0.000 claims description 23
- 238000010354 CRISPR gene editing Methods 0.000 claims description 18
- 210000000107 myocyte Anatomy 0.000 claims description 18
- 210000000663 muscle cell Anatomy 0.000 claims description 14
- 238000002347 injection Methods 0.000 claims description 8
- 239000007924 injection Substances 0.000 claims description 8
- 210000003098 myoblast Anatomy 0.000 claims description 8
- 102100025169 Max-binding protein MNT Human genes 0.000 claims description 7
- 108091006107 transcriptional repressors Proteins 0.000 claims description 7
- 108091006106 transcriptional activators Proteins 0.000 claims description 6
- 241000193996 Streptococcus pyogenes Species 0.000 claims description 3
- 101150092640 HES1 gene Proteins 0.000 claims description 2
- 241000191967 Staphylococcus aureus Species 0.000 claims description 2
- 238000010255 intramuscular injection Methods 0.000 claims description 2
- 239000007927 intramuscular injection Substances 0.000 claims description 2
- 238000010253 intravenous injection Methods 0.000 claims description 2
- 125000003275 alpha amino acid group Chemical group 0.000 claims 1
- 230000014509 gene expression Effects 0.000 abstract description 94
- 239000000203 mixture Substances 0.000 abstract description 40
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 abstract description 22
- 201000010099 disease Diseases 0.000 abstract description 19
- 230000001594 aberrant effect Effects 0.000 abstract description 10
- 230000001105 regulatory effect Effects 0.000 abstract description 10
- 210000004027 cell Anatomy 0.000 description 69
- 239000013598 vector Substances 0.000 description 35
- 150000001875 compounds Chemical class 0.000 description 31
- 230000008685 targeting Effects 0.000 description 28
- 101150054841 DUX4 gene Proteins 0.000 description 25
- 101710163270 Nuclease Proteins 0.000 description 24
- 230000007115 recruitment Effects 0.000 description 24
- 230000000694 effects Effects 0.000 description 19
- 239000003795 chemical substances by application Substances 0.000 description 18
- 239000008194 pharmaceutical composition Substances 0.000 description 16
- 239000002502 liposome Substances 0.000 description 14
- 239000013612 plasmid Substances 0.000 description 14
- 150000003839 salts Chemical class 0.000 description 14
- 210000000349 chromosome Anatomy 0.000 description 13
- 230000001225 therapeutic effect Effects 0.000 description 13
- 108020004414 DNA Proteins 0.000 description 12
- 230000002829 reductive effect Effects 0.000 description 12
- 208000024891 symptom Diseases 0.000 description 12
- 238000001890 transfection Methods 0.000 description 12
- 230000004913 activation Effects 0.000 description 11
- 239000000546 pharmaceutical excipient Substances 0.000 description 11
- 238000011282 treatment Methods 0.000 description 11
- 108020004999 messenger RNA Proteins 0.000 description 10
- 241000702421 Dependoparvovirus Species 0.000 description 9
- 101000648995 Homo sapiens Tripartite motif-containing protein 43 Proteins 0.000 description 9
- 101000785573 Homo sapiens Zinc finger and SCAN domain-containing protein 4 Proteins 0.000 description 9
- 102100028018 Tripartite motif-containing protein 43 Human genes 0.000 description 9
- 102100026569 Zinc finger and SCAN domain-containing protein 4 Human genes 0.000 description 9
- 239000000969 carrier Substances 0.000 description 9
- 238000002487 chromatin immunoprecipitation Methods 0.000 description 9
- 239000003814 drug Substances 0.000 description 9
- 208000015181 infectious disease Diseases 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- 210000003205 muscle Anatomy 0.000 description 9
- 230000001114 myogenic effect Effects 0.000 description 9
- 239000002245 particle Substances 0.000 description 9
- 108091026890 Coding region Proteins 0.000 description 8
- 239000002775 capsule Substances 0.000 description 8
- 239000003937 drug carrier Substances 0.000 description 8
- 239000012636 effector Substances 0.000 description 8
- 238000001727 in vivo Methods 0.000 description 8
- 239000000725 suspension Substances 0.000 description 8
- 239000003826 tablet Substances 0.000 description 8
- 210000001519 tissue Anatomy 0.000 description 8
- 238000013518 transcription Methods 0.000 description 8
- 230000035897 transcription Effects 0.000 description 8
- 239000012096 transfection reagent Substances 0.000 description 8
- 241000700605 Viruses Species 0.000 description 7
- 101150063416 add gene Proteins 0.000 description 7
- 238000009472 formulation Methods 0.000 description 7
- 230000005764 inhibitory process Effects 0.000 description 7
- 239000007788 liquid Substances 0.000 description 7
- 229920000642 polymer Polymers 0.000 description 7
- 230000009467 reduction Effects 0.000 description 7
- 230000001718 repressive effect Effects 0.000 description 7
- 241001430294 unidentified retrovirus Species 0.000 description 7
- 239000003981 vehicle Substances 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- 108010077544 Chromatin Proteins 0.000 description 6
- 238000010459 TALEN Methods 0.000 description 6
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 6
- 239000012190 activator Substances 0.000 description 6
- 210000003483 chromatin Anatomy 0.000 description 6
- 238000005056 compaction Methods 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 230000029279 positive regulation of transcription, DNA-dependent Effects 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 229940124597 therapeutic agent Drugs 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- 108091079001 CRISPR RNA Proteins 0.000 description 5
- 108010010803 Gelatin Proteins 0.000 description 5
- 101000962966 Homo sapiens Methyl-CpG-binding domain protein 3-like 2 Proteins 0.000 description 5
- 102100039576 Methyl-CpG-binding domain protein 3-like 2 Human genes 0.000 description 5
- 229920002472 Starch Chemical class 0.000 description 5
- 239000013543 active substance Substances 0.000 description 5
- -1 coatings Substances 0.000 description 5
- 230000007423 decrease Effects 0.000 description 5
- 230000003247 decreasing effect Effects 0.000 description 5
- 230000004069 differentiation Effects 0.000 description 5
- 239000002552 dosage form Substances 0.000 description 5
- 239000008273 gelatin Substances 0.000 description 5
- 229920000159 gelatin Polymers 0.000 description 5
- 235000019322 gelatine Nutrition 0.000 description 5
- 235000011852 gelatine desserts Nutrition 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 150000002632 lipids Chemical class 0.000 description 5
- 238000004806 packaging method and process Methods 0.000 description 5
- 230000001717 pathogenic effect Effects 0.000 description 5
- 108090000765 processed proteins & peptides Proteins 0.000 description 5
- 239000007787 solid Substances 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 108700028369 Alleles Proteins 0.000 description 4
- 238000010453 CRISPR/Cas method Methods 0.000 description 4
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 4
- 101001061028 Homo sapiens Protein FRG2 Proteins 0.000 description 4
- 102000005604 Myosin Heavy Chains Human genes 0.000 description 4
- 108010084498 Myosin Heavy Chains Proteins 0.000 description 4
- 102100028382 Protein FRG2 Human genes 0.000 description 4
- 108091028113 Trans-activating crRNA Proteins 0.000 description 4
- 241000700618 Vaccinia virus Species 0.000 description 4
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 4
- 239000004480 active ingredient Substances 0.000 description 4
- 230000002411 adverse Effects 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 238000000576 coating method Methods 0.000 description 4
- 230000002950 deficient Effects 0.000 description 4
- 239000008298 dragée Substances 0.000 description 4
- 239000000839 emulsion Substances 0.000 description 4
- 239000013604 expression vector Substances 0.000 description 4
- 230000006870 function Effects 0.000 description 4
- 238000000338 in vitro Methods 0.000 description 4
- 239000004615 ingredient Substances 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 238000007918 intramuscular administration Methods 0.000 description 4
- 230000006780 non-homologous end joining Effects 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 4
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 4
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 4
- 239000000843 powder Substances 0.000 description 4
- 238000002360 preparation method Methods 0.000 description 4
- 230000010076 replication Effects 0.000 description 4
- 239000002904 solvent Substances 0.000 description 4
- 239000003381 stabilizer Substances 0.000 description 4
- 235000019698 starch Nutrition 0.000 description 4
- 235000000346 sugar Nutrition 0.000 description 4
- 230000037426 transcriptional repression Effects 0.000 description 4
- 239000013603 viral vector Substances 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- UHOVQNZJYSORNB-UHFFFAOYSA-N Benzene Chemical compound C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 description 3
- 108090000565 Capsid Proteins Proteins 0.000 description 3
- 102100023321 Ceruloplasmin Human genes 0.000 description 3
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 3
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101001061041 Homo sapiens Protein FRG1 Proteins 0.000 description 3
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 241000699670 Mus sp. Species 0.000 description 3
- 102100028387 Protein FRG1 Human genes 0.000 description 3
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 239000000443 aerosol Substances 0.000 description 3
- 239000003242 anti bacterial agent Substances 0.000 description 3
- 239000011230 binding agent Substances 0.000 description 3
- 239000001506 calcium phosphate Substances 0.000 description 3
- 229910000389 calcium phosphate Inorganic materials 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 230000008602 contraction Effects 0.000 description 3
- 208000035475 disorder Diseases 0.000 description 3
- 239000000945 filler Substances 0.000 description 3
- 239000000499 gel Substances 0.000 description 3
- 238000003780 insertion Methods 0.000 description 3
- 230000037431 insertion Effects 0.000 description 3
- 239000008101 lactose Substances 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 239000004005 microsphere Substances 0.000 description 3
- 239000000825 pharmaceutical preparation Substances 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 102000040430 polynucleotide Human genes 0.000 description 3
- 108091033319 polynucleotide Proteins 0.000 description 3
- 239000002157 polynucleotide Substances 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 239000000523 sample Substances 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000000600 sorbitol Substances 0.000 description 3
- 125000006850 spacer group Chemical group 0.000 description 3
- 239000000829 suppository Substances 0.000 description 3
- 238000010361 transduction Methods 0.000 description 3
- 230000026683 transduction Effects 0.000 description 3
- 241000701161 unidentified adenovirus Species 0.000 description 3
- 238000011144 upstream manufacturing Methods 0.000 description 3
- KWVJHCQQUFDPLU-YEUCEMRASA-N 2,3-bis[[(z)-octadec-9-enoyl]oxy]propyl-trimethylazanium Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC(C[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC KWVJHCQQUFDPLU-YEUCEMRASA-N 0.000 description 2
- 239000013607 AAV vector Substances 0.000 description 2
- 241000702423 Adeno-associated virus - 2 Species 0.000 description 2
- 241001634120 Adeno-associated virus - 5 Species 0.000 description 2
- 241000972680 Adeno-associated virus - 6 Species 0.000 description 2
- 241001164823 Adeno-associated virus - 7 Species 0.000 description 2
- 241001164825 Adeno-associated virus - 8 Species 0.000 description 2
- 101100107610 Arabidopsis thaliana ABCF4 gene Proteins 0.000 description 2
- 101710172824 CRISPR-associated endonuclease Cas9 Proteins 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- 230000007018 DNA scission Effects 0.000 description 2
- 102100031780 Endonuclease Human genes 0.000 description 2
- 108010042407 Endonucleases Proteins 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 2
- 102100031181 Glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 108010033040 Histones Proteins 0.000 description 2
- 101001046596 Homo sapiens Krueppel-like factor 14 Proteins 0.000 description 2
- 101000818735 Homo sapiens Zinc finger protein 10 Proteins 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- 108091029795 Intergenic region Proteins 0.000 description 2
- 101150094019 MYOG gene Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 102000009572 RNA Polymerase II Human genes 0.000 description 2
- 108010009460 RNA Polymerase II Proteins 0.000 description 2
- 238000011529 RT qPCR Methods 0.000 description 2
- 101100068078 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GCN4 gene Proteins 0.000 description 2
- 241000710961 Semliki Forest virus Species 0.000 description 2
- 241000710960 Sindbis virus Species 0.000 description 2
- 108091027967 Small hairpin RNA Proteins 0.000 description 2
- GWEVSGVZZGPLCZ-UHFFFAOYSA-N Titan oxide Chemical compound O=[Ti]=O GWEVSGVZZGPLCZ-UHFFFAOYSA-N 0.000 description 2
- 101001023030 Toxoplasma gondii Myosin-D Proteins 0.000 description 2
- 102100022012 Transcription intermediary factor 1-beta Human genes 0.000 description 2
- 102000003442 UBR4 Human genes 0.000 description 2
- 102100021112 Zinc finger protein 10 Human genes 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 229940088710 antibiotic agent Drugs 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 230000002238 attenuated effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000006172 buffering agent Substances 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 210000000234 capsid Anatomy 0.000 description 2
- 239000001768 carboxy methyl cellulose Substances 0.000 description 2
- 125000002091 cationic group Chemical group 0.000 description 2
- 108091092356 cellular DNA Proteins 0.000 description 2
- 239000001913 cellulose Chemical class 0.000 description 2
- 229920002678 cellulose Chemical class 0.000 description 2
- 235000010980 cellulose Nutrition 0.000 description 2
- 238000005119 centrifugation Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000001246 colloidal dispersion Methods 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000012377 drug delivery Methods 0.000 description 2
- 229940112141 dry powder inhaler Drugs 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 239000010685 fatty oil Substances 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 230000009395 genetic defect Effects 0.000 description 2
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 238000002513 implantation Methods 0.000 description 2
- 210000004263 induced pluripotent stem cell Anatomy 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- VNWKTOKETHGBQD-UHFFFAOYSA-N methane Chemical compound C VNWKTOKETHGBQD-UHFFFAOYSA-N 0.000 description 2
- 108091070501 miRNA Proteins 0.000 description 2
- 239000000693 micelle Substances 0.000 description 2
- 239000002679 microRNA Substances 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 210000001087 myotubule Anatomy 0.000 description 2
- 238000007911 parenteral administration Methods 0.000 description 2
- 239000006187 pill Substances 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 239000013608 rAAV vector Substances 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 210000002027 skeletal muscle Anatomy 0.000 description 2
- 239000004055 small Interfering RNA Substances 0.000 description 2
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- PUZPDOWCWNUUKD-UHFFFAOYSA-M sodium fluoride Chemical compound [F-].[Na+] PUZPDOWCWNUUKD-UHFFFAOYSA-M 0.000 description 2
- 210000001082 somatic cell Anatomy 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 239000006188 syrup Substances 0.000 description 2
- 235000020357 syrup Nutrition 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 235000012222 talc Nutrition 0.000 description 2
- 150000003626 triacylglycerols Chemical class 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- DDMOUSALMHHKOS-UHFFFAOYSA-N 1,2-dichloro-1,1,2,2-tetrafluoroethane Chemical compound FC(F)(Cl)C(F)(F)Cl DDMOUSALMHHKOS-UHFFFAOYSA-N 0.000 description 1
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 1
- LDGWQMRUWMSZIU-LQDDAWAPSA-M 2,3-bis[(z)-octadec-9-enoxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCCOCC(C[N+](C)(C)C)OCCCCCCCC\C=C/CCCCCCCC LDGWQMRUWMSZIU-LQDDAWAPSA-M 0.000 description 1
- BFSVOASYOCHEOV-UHFFFAOYSA-N 2-diethylaminoethanol Chemical compound CCN(CC)CCO BFSVOASYOCHEOV-UHFFFAOYSA-N 0.000 description 1
- HZLCGUXUOFWCCN-UHFFFAOYSA-N 2-hydroxynonadecane-1,2,3-tricarboxylic acid Chemical compound CCCCCCCCCCCCCCCCC(C(O)=O)C(O)(C(O)=O)CC(O)=O HZLCGUXUOFWCCN-UHFFFAOYSA-N 0.000 description 1
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 description 1
- FVFVNNKYKYZTJU-UHFFFAOYSA-N 6-chloro-1,3,5-triazine-2,4-diamine Chemical group NC1=NC(N)=NC(Cl)=N1 FVFVNNKYKYZTJU-UHFFFAOYSA-N 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 241001655883 Adeno-associated virus - 1 Species 0.000 description 1
- 241000202702 Adeno-associated virus - 3 Species 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 206010003694 Atrophy Diseases 0.000 description 1
- 238000010446 CRISPR interference Methods 0.000 description 1
- 108010040467 CRISPR-Associated Proteins Proteins 0.000 description 1
- 238000010356 CRISPR-Cas9 genome editing Methods 0.000 description 1
- 102000018059 CS domains Human genes 0.000 description 1
- 108050007176 CS domains Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000178270 Canarypox virus Species 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- 108010060434 Co-Repressor Proteins Proteins 0.000 description 1
- 102000008169 Co-Repressor Proteins Human genes 0.000 description 1
- 208000003322 Coinfection Diseases 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 235000005956 Cosmos caudatus Nutrition 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- 102000053602 DNA Human genes 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 206010011878 Deafness Diseases 0.000 description 1
- 108010008532 Deoxyribonuclease I Proteins 0.000 description 1
- 102000007260 Deoxyribonuclease I Human genes 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 239000004338 Dichlorodifluoromethane Substances 0.000 description 1
- 101100441545 Drosophila melanogaster Cfp1 gene Proteins 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 102000004533 Endonucleases Human genes 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- 208000000832 Equine Encephalomyelitis Diseases 0.000 description 1
- 241000283073 Equus caballus Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 108700039887 Essential Genes Proteins 0.000 description 1
- 206010051267 Facial paresis Diseases 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 229930186217 Glycolipid Natural products 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 108010068250 Herpes Simplex Virus Protein Vmw65 Proteins 0.000 description 1
- 108010034791 Heterochromatin Proteins 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- 102000008157 Histone Demethylases Human genes 0.000 description 1
- 108010074870 Histone Demethylases Proteins 0.000 description 1
- 101000807547 Homo sapiens E3 ubiquitin-protein ligase UBR4 Proteins 0.000 description 1
- 101000868883 Homo sapiens Transcription factor Sp6 Proteins 0.000 description 1
- 101000753286 Homo sapiens Transcription intermediary factor 1-beta Proteins 0.000 description 1
- 101000964725 Homo sapiens Zinc finger protein 184 Proteins 0.000 description 1
- 101000760180 Homo sapiens Zinc finger protein 43 Proteins 0.000 description 1
- 101000964755 Homo sapiens Zinc finger protein 708 Proteins 0.000 description 1
- 102100022329 Krueppel-like factor 14 Human genes 0.000 description 1
- 241000186660 Lactobacillus Species 0.000 description 1
- 235000019759 Maize starch Nutrition 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 208000010428 Muscle Weakness Diseases 0.000 description 1
- 206010028372 Muscular weakness Diseases 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108700001237 Nucleic Acid-Based Vaccines Proteins 0.000 description 1
- 206010034701 Peroneal nerve palsy Diseases 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- OAICVXFJPJFONN-UHFFFAOYSA-N Phosphorus Chemical compound [P] OAICVXFJPJFONN-UHFFFAOYSA-N 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920002873 Polyethylenimine Polymers 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 238000011530 RNeasy Mini Kit Methods 0.000 description 1
- 238000010240 RT-PCR analysis Methods 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108091081062 Repeated sequence (DNA) Proteins 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 108020004459 Small interfering RNA Proteins 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- 101000910035 Streptococcus pyogenes serotype M1 CRISPR-associated endonuclease Cas9/Csn1 Proteins 0.000 description 1
- 108091081400 Subtelomere Proteins 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 206010042566 Superinfection Diseases 0.000 description 1
- 108700026226 TATA Box Proteins 0.000 description 1
- 238000012338 Therapeutic targeting Methods 0.000 description 1
- YXFVVABEGXRONW-UHFFFAOYSA-N Toluene Chemical compound CC1=CC=CC=C1 YXFVVABEGXRONW-UHFFFAOYSA-N 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 108091023040 Transcription factor Proteins 0.000 description 1
- 102000040945 Transcription factor Human genes 0.000 description 1
- 101710177718 Transcription intermediary factor 1-beta Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 241000710959 Venezuelan equine encephalitis virus Species 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 108020000999 Viral RNA Proteins 0.000 description 1
- 102100040715 Zinc finger protein 184 Human genes 0.000 description 1
- 102100024666 Zinc finger protein 43 Human genes 0.000 description 1
- 102100040660 Zinc finger protein 708 Human genes 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 239000003070 absorption delaying agent Substances 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000000205 acacia gum Substances 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 210000005006 adaptive immune system Anatomy 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 235000010419 agar Nutrition 0.000 description 1
- 229940040563 agaric acid Drugs 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 238000000246 agarose gel electrophoresis Methods 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 238000011129 allogeneic cell therapy Methods 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 238000000137 annealing Methods 0.000 description 1
- 230000000844 anti-bacterial effect Effects 0.000 description 1
- 230000001857 anti-mycotic effect Effects 0.000 description 1
- 229940121375 antifungal agent Drugs 0.000 description 1
- 239000003429 antifungal agent Substances 0.000 description 1
- 239000002543 antimycotic Substances 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000008135 aqueous vehicle Substances 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 239000000823 artificial membrane Substances 0.000 description 1
- 230000037444 atrophy Effects 0.000 description 1
- 238000011130 autologous cell therapy Methods 0.000 description 1
- 229960000190 bacillus calmette–guérin vaccine Drugs 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 208000013404 behavioral symptom Diseases 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000008512 biological response Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 238000005422 blasting Methods 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- KGBXLFKZBHKPEV-UHFFFAOYSA-N boric acid Chemical compound OB(O)O KGBXLFKZBHKPEV-UHFFFAOYSA-N 0.000 description 1
- 239000004327 boric acid Substances 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 235000011148 calcium chloride Nutrition 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 159000000007 calcium salts Chemical class 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 239000001569 carbon dioxide Substances 0.000 description 1
- 229910002092 carbon dioxide Inorganic materials 0.000 description 1
- 229960004424 carbon dioxide Drugs 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 125000002843 carboxylic acid group Chemical group 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 210000003837 chick embryo Anatomy 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 235000012000 cholesterol Nutrition 0.000 description 1
- 150000001840 cholesterol esters Chemical class 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 229940110456 cocoa butter Drugs 0.000 description 1
- 235000019868 cocoa butter Nutrition 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 239000007891 compressed tablet Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000006071 cream Substances 0.000 description 1
- 230000000120 cytopathologic effect Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 239000003405 delayed action preparation Substances 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- PXBRQCKWGAHEHS-UHFFFAOYSA-N dichlorodifluoromethane Chemical compound FC(F)(Cl)Cl PXBRQCKWGAHEHS-UHFFFAOYSA-N 0.000 description 1
- 235000019404 dichlorodifluoromethane Nutrition 0.000 description 1
- 229940042935 dichlorodifluoromethane Drugs 0.000 description 1
- 229940087091 dichlorotetrafluoroethane Drugs 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- PSLWZOIUBRXAQW-UHFFFAOYSA-M dimethyl(dioctadecyl)azanium;bromide Chemical compound [Br-].CCCCCCCCCCCCCCCCCC[N+](C)(C)CCCCCCCCCCCCCCCCCC PSLWZOIUBRXAQW-UHFFFAOYSA-M 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000002612 dispersion medium Substances 0.000 description 1
- 239000006196 drop Substances 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 108010050663 endodeoxyribonuclease CreI Proteins 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940079360 enema for constipation Drugs 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 239000003925 fat Substances 0.000 description 1
- 235000019197 fats Nutrition 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 239000004503 fine granule Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 102000034287 fluorescent proteins Human genes 0.000 description 1
- 108091006047 fluorescent proteins Proteins 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 125000005456 glyceride group Chemical group 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 238000000227 grinding Methods 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000010370 hearing loss Effects 0.000 description 1
- 231100000888 hearing loss Toxicity 0.000 description 1
- 208000016354 hearing loss disease Diseases 0.000 description 1
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 1
- 210000004458 heterochromatin Anatomy 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 239000000017 hydrogel Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000002743 insertional mutagenesis Methods 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000010189 intracellular transport Effects 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 239000003456 ion exchange resin Substances 0.000 description 1
- 229920003303 ion-exchange polymer Polymers 0.000 description 1
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 1
- 239000007951 isotonicity adjuster Substances 0.000 description 1
- 239000004922 lacquer Substances 0.000 description 1
- 229940039696 lactobacillus Drugs 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 229940057995 liquid paraffin Drugs 0.000 description 1
- 239000007937 lozenge Substances 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 238000002483 medication Methods 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 201000006938 muscular dystrophy Diseases 0.000 description 1
- ZLDPNFYTUDQDMJ-UHFFFAOYSA-N n-octadecyloctadecan-1-amine;hydrobromide Chemical compound Br.CCCCCCCCCCCCCCCCCCNCCCCCCCCCCCCCCCCCC ZLDPNFYTUDQDMJ-UHFFFAOYSA-N 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 239000006199 nebulizer Substances 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 229940023146 nucleic acid vaccine Drugs 0.000 description 1
- 230000009437 off-target effect Effects 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 239000003791 organic solvent mixture Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 239000012466 permeate Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- 239000000049 pigment Substances 0.000 description 1
- 239000004014 plasticizer Substances 0.000 description 1
- 229920001610 polycaprolactone Polymers 0.000 description 1
- 229920006149 polyester-amide block copolymer Polymers 0.000 description 1
- 229920001184 polypeptide Polymers 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000001566 pro-viral effect Effects 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 230000000750 progressive effect Effects 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 230000033764 rhythmic process Effects 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 229940100486 rice starch Drugs 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- 238000010008 shearing Methods 0.000 description 1
- 229920000260 silastic Polymers 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 210000001057 smooth muscle myoblast Anatomy 0.000 description 1
- 235000015424 sodium Nutrition 0.000 description 1
- 235000010413 sodium alginate Nutrition 0.000 description 1
- 239000000661 sodium alginate Substances 0.000 description 1
- 229940005550 sodium alginate Drugs 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000011775 sodium fluoride Substances 0.000 description 1
- 235000013024 sodium fluoride Nutrition 0.000 description 1
- 239000007901 soft capsule Substances 0.000 description 1
- 239000012439 solid excipient Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 238000012289 standard assay Methods 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 150000003432 sterols Chemical class 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000002511 suppository base Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 230000008961 swelling Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 239000003104 tissue culture media Substances 0.000 description 1
- 239000004408 titanium dioxide Substances 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- CYRMSUTZVYGINF-UHFFFAOYSA-N trichlorofluoromethane Chemical compound FC(Cl)(Cl)Cl CYRMSUTZVYGINF-UHFFFAOYSA-N 0.000 description 1
- 229940029284 trichlorofluoromethane Drugs 0.000 description 1
- 239000002691 unilamellar liposome Substances 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 230000003519 ventilatory effect Effects 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 210000002845 virion Anatomy 0.000 description 1
- 239000000277 virosome Substances 0.000 description 1
- 230000003313 weakening effect Effects 0.000 description 1
- 238000005303 weighing Methods 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 229940100445 wheat starch Drugs 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/14—Hydrolases (3)
- C12N9/16—Hydrolases (3) acting on ester bonds (3.1)
- C12N9/22—Ribonucleases RNAses, DNAses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4707—Muscular dystrophy
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/87—Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
- C12N15/90—Stable introduction of foreign DNA into chromosome
- C12N15/902—Stable introduction of foreign DNA into chromosome using homologous recombination
- C12N15/907—Stable introduction of foreign DNA into chromosome using homologous recombination in mammalian cells
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/20—Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPRs]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2750/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssDNA viruses
- C12N2750/00011—Details
- C12N2750/14011—Parvoviridae
- C12N2750/14111—Dependovirus, e.g. adenoassociated viruses
- C12N2750/14141—Use of virus, viral particle or viral elements as a vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2800/00—Nucleic acids vectors
- C12N2800/80—Vectors containing sites for inducing double-stranded breaks, e.g. meganuclease restriction sites
Definitions
- Facioscapulohumeral muscular dystrophy is caused by the aberrant expression of the DUX4 gene from an epigenetically dysregulated D424 array at chromosome 4q35. This gene is generally not expressed, or expressed at very low levels, in healthy individuals. In FSHD patients, DUX4 is aberrantly expressed at higher levels in the skeletal muscles. This aberrant expression ultimately leads to muscle pathology, atrophy, and clinical weakness. Most therapies being developed target the DUX4 mRNA or protein.
- compositions useful for the treatment of diseases associated with aberrant expression of DUX4 (e.g.. facioscapulohumeral muscular dystrophy. FSHD).
- diseases associated with aberrant expression of DUX4 e.g.. facioscapulohumeral muscular dystrophy. FSHD.
- compositions e.g., recombinant gene editing complexes
- FSHD muscular dystrophy.
- compositions (e.g., recombinant gene editing complexes) disclosed herein are useful because they transcriptionally regulate (e.g., inhibit) aberrant expression of DUX4.
- reduction of DUX4 expression by compositions described by the disclosure e.g...
- DUX4-fl expression e.g., reduced expression of the pathogenic DUX4-fl protein
- DUX4-fl expression e.g., reduced expression of the pathogenic DUX4-fl protein
- the disclosure provides a recombinant gene editing complex comprising: a recombinant gene editing protein; and, a nucleic acid encoding a guide RNA (gRNA) that specifically hybridizes to a target nucleic acid sequence encoding a D4Z4 macrosatellite repeat region, wherein binding of the complex to the target nucleic acid sequence results in inhibition of DUX4 gene expression.
- gRNA guide RNA
- the target nucleic acid sequence is located on chromosome 4 at position 4q35.
- the gRNA comprises or is encoded by the sequence set forth in any one of SEQ ID NOs: 1-11. In some embodiments, the gRNA specifically hybridizes to a nucleic acid sequence encoding a DUX4 promoter or exon 1 of DUX4. In some embodiments, the gRNA comprises or is encoded by the sequence set forth in any one of SEQ ID NOs: 3-8. In some embodiments, the recombinant gene editing complex comprises a plurality (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10. or more) of gRNA sequences (e.g. a plurality of a single gRNA sequence, or a plurality of different or unique gRNA sequences).
- a plurality e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10. or more
- the recombinant gene editing protein comprises a Cas protein, a Cfp1 protein, or a variant thereof.
- the Cas protein is a Streptococcus pyogenes Cas protein (SpCas) or a Staphylococcus aureus Cas protein (SaCas).
- the Cas protein is a Cas9 protein or a dead Cas9 (dCas,9) protein.
- the recombinant gene editing protein comprises the sequence set forth in SEQ ID NO: 42 or 45.
- the recombinant gene editing protein further comprises a transcriptional repressor domain.
- the transcriptional repressor domain is a KRAB domain.
- the gene editing protein comprises the sequence set forth in SEQ ID NO: 43 or 44.
- the disclosure provides a vector comprising a nucleic acid encoding one or more components of a recombinant gene editing complex (e.g.. a nucleic acid encoding a gene editing protein, a gRNA. or both) as described by the disclosure.
- the vector is a lentiviral vector or a recombinant adeno-associated virus vector (rAAV vector).
- the disclosure provides a host cell comprising a nucleic acid encoding one or more components of a gene editing complex as described by the disclosure.
- the disclosure provides a composition comprising a gene editing complex (e.g.. a nucleic acid encoding one or more components of a gene editing complex, or a vector comprising a nucleic acid encoding a gene editing complex) and a pharmaceutically acceptable excipient.
- a gene editing complex e.g.. a nucleic acid encoding one or more components of a gene editing complex, or a vector comprising a nucleic acid encoding a gene editing complex
- a pharmaceutically acceptable excipient e.g.. a nucleic acid encoding one or more components of a gene editing complex, or a vector comprising a nucleic acid encoding a gene editing complex
- the disclosure relates, in part, to the discovery that, in some embodiments a gene editing complex as described by the disclosure is capable of reducing aberrant expression of DUX4.
- the disclosure provides a method for inhibiting expression of DUX4 in a cell, the method comprising: contacting a cell with a nucleic acid encoding the recombinant gene editing complex as described by the disclosure, a vector as described by the disclosure, in an amount sufficient to inhibit expression of DUX4 gene in the cell.
- the cell comprises a D4Z4 repeat array having 11 or less repeat units.
- the cell is obtained from a subject having or at risk of having facioscapulohumeral muscular dystrophy (FSHD).
- FSHD facioscapulohumeral muscular dystrophy
- the cell is in vitro or ex vivo.
- the disclosure provides a method for treating facioscapulohumeral muscular dystrophy (FSHD) in a subject in need thereof, the method comprising: administering to the subject a therapeutically effective amount of (i) a nucleic acid encoding the recombinant gene editing complex as described by the disclosure; or, (ii) a vector as described by the disclosure.
- FSHD facioscapulohumeral muscular dystrophy
- the subject is a mammal, optionally a human.
- chromosome 4 of the subject comprises a D4Z4 repeat array having 11 or less repeat units.
- the administration is by injection, optionally intramuscular injection or intravenous injection.
- the recombinant gene editing complex is administered to muscle cells of the subject, optionally myogenic precursor satellite cells, myoblasts, myocytes, or terminally differentiated muscle cells of the subject.
- the recombinant gene editing complex is administered to one or more somatic cells of the subject, optionally fibroblasts or leukocytes.
- the one or more somatic cells are isolated from the subject and reprogrammed into a myogenic lineage, for example using induced pluripotent stem cell (iPS) technology.
- iPS induced pluripotent stem cell
- FIG. 1 shows a schematic depiction of CRISPR/Cas9 Tools for Genome Editing or Transcription Modulation in Skeletal Myocytes.
- the Cas9 enzyme forms a complex with a sequence-specific single guide RNA (sgRNA), which guides binding to a genomic target.
- Cas9 cuts DNA, generating double-stranded breaks that are repaired by non-homologous end joining (NHEJ) to produce various insertions and deletions (indels) at the target sequence.
- NHEJ non-homologous end joining
- indels insertions and deletions
- Catalytically inactive dCas9 is fused to transcriptional modulators (e.g., the KRAB repressor domain), to alter gene expression at defined loci.
- transcriptional modulators e.g., the KRAB repressor domain
- FIGS. 2 A- 2 B show identification of single guide RNAs (sgRNAs) that target the D4Z4 region and affect expression of DUX4.
- FIG. 2 A shows a schematic depiction of the D4Z4 repeat region of chromosome 10q and chromosome 4q.
- FIG. 2 B shows data relating to the effects of using specific sgRNAs (#1-9) to target dCas9-VP64 to the FSHD locus on DUX4-fl expression.
- FIGS. 3 A- 3 C show recruitment of dCas9-KRAB to the DUX4 promoter or exon 1 represses DUX4-fl in FSHD.
- FIG. 3 A shows data relating to relative expression of DUX4-fl after targeting of dCas9-KRAB to the FSHD locus using specific sgRNAs (#1-11).
- FIG. 3 B shows recruitment of dCas9-KRAB to the FSHD locus does not impair skeletal myocyte differentiation, as measured by relative expression level of MyHC.
- FIG. 3 C shows recruitment of dCas9-KRAB to the FSHD locus does not repress expression of FRG1 and FRG2. as measured by relative mRNA expression.
- FIG. 4 shows recruitment of dCas9-KRAB to the DUX4 promoter or exon 1 represses DUX4-fl target genes in FSHD myocytes. Data relating to relative expression levels of TRIM43. ZSCAN4, and MBD3L2 are shown.
- FIG. 5 shows targeting a transcriptional effector to the DUX4 promoter or exon 1 has no effect on expression of several off-target genes.
- Relative expression levels of Jumonji, KLF14, and UBR4 were assessed by quantitative RT-PCR after targeting of dCas9 fused to a transcriptional activator using sgRNA #3 (DUX4 promoter) or sgRNA #6 (DUX4 exon 1).
- FIGS. 6 A- 6 F show recruitment of dCas9-KRAB to the DUX4 promoter or exon 1 represses the D4Z4 locus in FSHD myocytes.
- Chromatin was immunoprecipitated using antibodies specific for ( FIG. 6 A ) KAP1, ( FIG. 6 B ) HP1 ⁇ , ( FIG. 6 C ) HP1 ⁇ , ( FIG. 6 D ) H3K27ac, or ( FIG. 6 E ) the elongating form of RNA Pol II (Pol II-PS2), and analyzed by qPCR using primers to the ( FIG.
- FIG. 7 shows data relating to repression of DUX4-fl expression in vivo by recruitment of dCas9-KRAB to the FSHD locus by sgRNAs in a mouse model of FSHD.
- FIG. 8 shows Cas9 nuclease targeted to DUX4 exon 3 decreases expression of DUX4-fl and target genes (e.g.. TRIM43, ZSCAN4) but not MyoG or MyoD. Relative expression of GAPDH is also shown as a control.
- target genes e.g.. TRIM43, ZSCAN4
- the disclosure relates to recombinant gene editing complexes useful for the treatment of diseases associated with aberrant expression of DUX4 (e.g.. facioscapulohumeral muscular dystrophy. FSHD).
- DUX4 e.g. facioscapulohumeral muscular dystrophy.
- the disclosure is based, in part, on the surprising discovery that recruitment of recombinant gene editing complexes to certain loci of the D4Z4 macrosatellite repeat region (e.g.. at position 4q35) and/or the DUX4 gene results in decreased production of DUX4-fl, the pathogenic mRNA isoform associated with FSHD. as well as reduced expression of certain genes (e.g., TRIM43. ZSCAN4, etc.) that are downstream targets of DUX4-fl.
- D4Z4 macrosatellite repeat region e.g. at position 4q35
- DUX4 gene results in decreased production of DUX4-f
- FSHD Facioscapulohumeral Muscular Dystrophy
- facioscapulohumeral muscular dystrophy refers to a disease or disorder that results from transcriptional activation of the DUX4 gene.
- activation of the DUX4 gene results in a toxic gain of function in the DUX4 gene (e.g., production of pathogenic DUX4-f1) and causes a range of symptoms including progressive skeletal muscle weakness (e.g.. facial muscle weakness, shoulder weakness, etc.), hearing loss, abnormal heart rhythm, unequal weakening of biceps, triceps, deltoids and lower arm muscles, loss of strength in abdominal and/or leg muscles, a foot drop.
- FSHD results in a subject requiring ventilatory support or wheelchair confinement.
- FSHD is associated with a contraction of the D4Z4 repeat sequence at the subtelomeric region 4q35 on Chromosome 4 of the human genome.
- chromosome 4 of a healthy subject e.g., a subject not having FSHD
- the DUX4 gene of a subject having a contracted D4Z4 repeat becomes transcriptionally activated due to the loss of repeat-mediated repression, resulting in production of pathogenic full-length DUX4 (DUX4-f1) mRNA and protein.
- the invention relates to the discovery that recruitment of recombinant gene editing molecules to certain loci of the D4Z4 macrosatellite repeat region and/or the DUX4 gene results in decreased production of DUX4-f1 protein in a subject (e.g., in a cell of a subject).
- D4Z4 macrosatellite repeat region refers to a chromosomal locus comprising at least one of the following genomic features: a p13E-I1 probe hybridizing sequence, a non-deleted element (NDE) sequence (e.g., a NDE sequence that functions as a transcriptional start site for a DBE-T transcript), a nucleic acid sequence encoding DUX4 (e.g., a nucleic acid sequence encoding exon 1, exon 2 and exon 3 of DUX4).
- NDE non-deleted element
- DUX4 e.g., a nucleic acid sequence encoding exon 1, exon 2 and exon 3 of DUX4
- chromosome 4 comprises a D4Z4 macrosatellite repeat region, for example at locus 4q35.
- reduced DUX4 expression refers to a change in state of a DUX4 gene from a transcriptionally active (e.g., expressed or transcribed) state to a reduced state of transcriptional activity, for example, a transcriptionally inactive (e.g., silenced) state.
- a subject e.g., a cell in a subject having a transcriptionally active (e.g., expressed) DUX4 gene produces DUX4-f1; knockdown (e.g., silencing) of DUX4 expression in the subject (e.g., cell in the subject), for example by administration of a recombinant gene editing complex targeting a D4Z4 macrosatellite repeat region, leads to reduced (or inhibited) expression and production of DUX4-f1 in the subject
- the disclosure relates to the discovery that inhibition of DUX4 expression by a recombinant gene editing complex as described by the disclosure results in reduced expression of certain genes that are downstream targets of DUX4-f1.
- inhibition of DUX4 expression by a recombinant gene editing complex as described by the disclosure results in reduced expression of TRIM43, ZSCAN4, MBD3L2, or any combination of the foregoing, as described further in the Examples section.
- reduction of target gene (e.g., DUX4, TRIM43, ZSCAN4) expression can be measured as expression level of the target gene (e.g., DUX4) in a sample (e.g., a cell or a subject) after treatment with a recombinant gene editing complex relative to expression level of target gene (e.g., DUX4) in the sample prior to treatment with the recombinant gene editing complex.
- the expression level of a target gene can be measured by any suitable method known in the art, for example by hybridization-based assay (e.g., RT-PCR, qRT-PCR, Northern Blot), protein-based methods (e.g., Western blot), spectroscopic methods (e.g., mass spectrometry), and cell-based methods (e.g., flow cytometry, fluorescence activated cell sorting (FACS)).
- hybridization-based assay e.g., RT-PCR, qRT-PCR, Northern Blot
- protein-based methods e.g., Western blot
- spectroscopic methods e.g., mass spectrometry
- cell-based methods e.g., flow cytometry, fluorescence activated cell sorting (FACS)
- the disclosure is based, in part, on the discovery of recombinant gene editing complexes that inhibit-for example, through transcriptional repression or generation of double-stranded DNA breaks- expression of the DUX4 gene.
- the disclosure provides a recombinant gene editing complex comprising: a recombinant gene editing protein; and, a nucleic acid encoding a guide RNA (gRNA) that specifically hybridizes to a target nucleic acid sequence encoding a D4Z4 macrosatellite repeat region, wherein binding of the complex to the target nucleic acid sequence results in inhibition of DUX4 gene expression.
- gRNA guide RNA
- gene editing complex refers to a biologically active molecule (e.g., a protein, one or more proteins, a nucleic acid, one or more nucleic acids, or any combination of the foregoing) configured for adding, disrupting or changing genomic sequences (e.g. a gene sequence), for example by causing a double stranded break (DSB) in a target DNA or inhibiting transcription of a target DNA sequence.
- a biologically active molecule e.g., a protein, one or more proteins, a nucleic acid, one or more nucleic acids, or any combination of the foregoing
- genomic sequences e.g. a gene sequence
- gene editing complexes include but are not limited to Transcription Activator-like Effector Nucleases (TALENs), Zinc Finger Nucleases (ZFNs), engineered meganuclease re-engineered homing endonucleases, the CRISPR/Cas system, and meganucleases (e.g., Meganuclease I-SceI).
- TALENs Transcription Activator-like Effector Nucleases
- ZFNs Zinc Finger Nucleases
- meganucleases e.g., Meganuclease I-SceI
- a gene editing complex comprizes proteins or molecules (e.g., recombinant gene editing proteins) related to the CRISPR/Cas system, including but not limited to Cas9, Cas6, dCas9, Cpf1, CRISPR RNA (crRNA), trans-activating crRNA (tracrRNA), and variants thereof.
- proteins or molecules e.g., recombinant gene editing proteins related to the CRISPR/Cas system, including but not limited to Cas9, Cas6, dCas9, Cpf1, CRISPR RNA (crRNA), trans-activating crRNA (tracrRNA), and variants thereof.
- a recombinant gene editing protein is a nuclease.
- nuclease refers to an enzyme that cleaves a phosphodiester bond or bonds within a polynucleotide chain.
- Nucleases may be naturally occurring or genetically engineered. Genetically engineered nucleases are particularly useful for genome editing and are generally classified into four families: zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), meganucleases (e.g., engineered meganucleases) and CRISPR-associated proteins (Cas nucleases).
- ZFNs zinc finger nucleases
- TALENs transcription activator-like effector nucleases
- meganucleases e.g., engineered meganucleases
- CRISPR-associated proteins Cas nucleases
- the nuclease is a ZFN. In some embodiments, the ZFN comprises a FokI cleavage domain. In some embodiments, the ZFN comprises Cys 2 His 2 fold group. In some embodiments, the nuclease is a TALEN. In some embodiments, the TALEN comprises a FokI cleavage domain. In some embodiments, the nuclease is a meganuclease. Examples of meganucleases include but are not limited to I-Scel, I-CreI, I-DmoI, and combinations thereof (e.g., E-DreI, DmoCre).
- CRISPR refers to “clustered regularly interspaced short palindromic repeats”, which are DNA loci containing short repetitions of base sequences. CRISPR loci form a portion of a prokaryotic adaptive immune system that confers resistance to foreign genetic material. Each CRISPR loci is flanked by short segments of “spacer DNA”, which are derived from viral genomic material. In the Type II CRISPR system, spacer DNA hybridizes to transactivating RNA (tracrRNA) and is processed into CRISPR-RNA (crRNA) and subsequently associates with CRISPR-associated nucleases (Cas nucleases) to form complexes that recognize and degrade foreign DNA.
- tracrRNA transactivating RNA
- crRNA CRISPR-RNA
- Cas nucleases CRISPR-associated nucleases
- the nuclease is a CRISPR-associated nuclease (Cas nuclease).
- CRISPR nucleases include, but are not limited to Cas9, dCas9, Cas6, Cpf1, and variants thereof.
- the nuclease is Cas9.
- the Cas9 is derived from the bacteria Streptococcus pyogenes (e.g., SpCas9) or Staphylocaccus aureus (e.g., SaCas9, for example SEQ ID NO: 42).
- a Cas protein is modified (e.g. genetically engineered) to lack nuclease activity.
- dead Cas9 (dCas9) protein binds to a target locus but does not cleave said locus.
- a dCas9 protein comprises the sequence set forth in SEQ ID NO: 45.
- a Cas protein or variant thereof does not exceed the packaging capacity of a viral vector, such as a lentiviral vector or an adeno-associated virus (AAV) vector, for example as described by Ran et al. (2015) Nature. 520(7546): 186-91.
- a nucleic acid encoding a Cas protein is less than about 4.6 kb in length.
- a catalytically dead Cas9 protein e.g., dead Cas9. “dCas9”
- a transcriptional regulator domain to modulate (e.g., inhibit) expression of a target gene (e.g., DUX4), as described by Qi et al. (2013) Cell. 152(5); 1173-1183 and Gilbert et al. (2013) Cell. 154(2); 442-45 1.
- dCas9 comprises a sequence set forth in SEQ ID NO: 45.
- dCas9 or another catalytically dead Cas protein
- transcriptional machinery e.g., a RNA polymerase complex
- a CRISPR Cas protein (e.g., dCas9) is fused to a transcriptional regulator domain.
- a “transcriptional regulator domain” is a protein domain that catalyzes structural or chemical changes in a chromatin molecule that results in altered transcriptional activity (e.g., transcriptional activation or transcriptional repression).
- the transcriptional regulator domain is a transcriptional repressor domain.
- the repressive domain comprises a Kruppel associated box domain (KRAB domain).
- KRAB domains include KOX1 KRAB domain. KOX8 KRAB domain, ZNF43 KRAB domain, and ZNF184 KRAB domain.
- the KRAB domain is a KOX1 KRAB domain.
- the gene editing protein comprises a sequence set forth in SEQ ID NO: 43 or 44.
- repressive domains include Chromo Shadow (CS) domain (e.g., CS domain of HP1 ⁇ ) and WRPW domain (e.g., WRPW domain of Hes1).
- the transcriptional regulator domain is a transcriptional activator domain.
- the transcriptional activator domain comprises a transcriptional activation domain of Herpes simplex virus, such as VP16, or a variant thereof.
- a transcription factor may contain multiple activation domains, for example as described by Beerli et al. (1998) Proc. Natl. Acad. Sci. U.S.A. 95(25); 14628-33.
- the transcriptional activator domain comprises 2, 3, 4, 5, 6, 7, 8, 9, or 10 activation domains.
- the transcriptional activator domain is VP64, VP96, or VP160.
- a Cas protein is not fused to a transcriptional regulator domain, and is capable of modulating (e.g., inhibiting) gene expression via nuclease activity (e.g.. DNA cleavage).
- Cas9 cleaves DNA at a site targeted by the guide RNA and then repaired by either non-homologous end joining (NHEJ), which is imprecise and often results in a small insertion or deletion (InDel) that disrupts the targeted sequence, or homology directed DNA repair, which allows for the insertion of a changed or new DNA sequence into the genome at a specific location.
- NHEJ non-homologous end joining
- InDel small insertion or deletion
- homology directed DNA repair which allows for the insertion of a changed or new DNA sequence into the genome at a specific location.
- the disclosure relates to a gene editing complex comprising a functional nuclease and a guide RNA that hybridizes to a D4Z4 macrosatellite repeat region that is capable of reducing expression of DUX4 in a subject (e.g., a cell of a subject).
- the guide RNA that directs the activity of the functional nuclease targets exon 3 of the DUX4 gene.
- the CRISPR system can be modified to combine the tracrRNA and crRNA in to a single guide RNA (sgRNA) or just (gRNA).
- guide RNA gRNA
- gRNA guide RNA
- gRNA sgRNA
- sgRNA refer to a polynucleotide sequence that is complementary to a target sequence in a cell and associates with a Cas nuclease, thereby directing the Cas nuclease to the target sequence.
- a gRNA e.g., sgRNA
- a gRNA e.g., sgRNA
- a gRNA ranges between 10 and 22 nucleotides in length. In some embodiments, a gRNA (e.g., sgRNA) ranges between 14 and 24 nucleotides in length.
- a Cas protein and a guide RNA are expressed from the same vector. In some embodiments, a Cas protein and a guide RNA (e.g., sgRNA) are expressed from separate vectors (e.g., two or more vectors).
- a guide RNA e.g., a gRNA or sgRNA
- hybridizes e.g., binds specifically to, for example by Watson-Crick base pairing
- a guide RNA hybridizes to (e.g., targets) a nucleic acid sequence encoding a D4Z4 macrosatellite repeat region or a nucleic acid sequence encoding DUX4 gene.
- the gRNA hybridizes to a p13E-11 sequence or a NDE sequence.
- the gRNA hybridizes to exon 1, exon 2 or exon 3 of a DUX4 gene.
- the gRNA comprises or is encoded by the sequence set forth in any one of SEQ ID NOs: 1-11, for example as described in Table 1.
- the disclosure provides methods for treating a subject having facioscapulohumeral muscular dystrophy (FSHD).
- FSHD facioscapulohumeral muscular dystrophy
- transcriptional activation of the DUX4 gene may lead to FSHD in a subject.
- a “subject” is interchangeable with a “subject in need thereof”, both of which may refer to a subject having FSHD, or a subject having an increased risk of developing such a disorder relative to the population at large.
- a subject has a D4Z4 array comprising 11 or fewer repeat units at chromosome 4q35 but does not exhibit signs or symptoms of FSHD.
- a subject in need thereof may be a subject having a transcriptionally active DUX4 gene (e.g., a subject expressing DUX4-fl protein).
- a subject can be a human, non-human primate, rat, mouse, cat, dog, or other mammal.
- treatment refers to therapeutic treatment and prophylactic or preventative manipulations.
- the terms further include ameliorating existing symptoms, preventing additional symptoms, ameliorating or preventing the underlying causes of symptoms, preventing or reversing causes of symptoms, for example, symptoms associated with FSHD.
- the terms denote that a beneficial result has been conferred on a subject having FSHD. or with the potential to develop such a disorder.
- treatment is defined as the application or administration of an agent (e.g., therapeutic agent or a therapeutic composition) to a subject, or an isolated tissue or cell line from a subject, who may have a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
- an agent e.g., therapeutic agent or a therapeutic composition
- Therapeutic agents or therapeutic compositions may include a compound in a pharmaceutically acceptable form that prevents and/or reduces the symptoms of a particular disease (e.g.. FSHD).
- a therapeutic composition may be a pharmaceutical composition that prevents and/or reduces the symptoms of FSHD.
- the disclosure provides a composition (e.g.. a therapeutic composition) comprising a gene editing complex as described by the disclosure or a vector as described by the disclosure.
- the composition further comprises a pharmaceutically acceptable excipient. It is contemplated that the therapeutic composition of the present invention will be provided in any suitable form. The form of the therapeutic composition will depend on a number of factors, including the mode of administration as described herein.
- the therapeutic composition may contain diluents, adjuvants and excipients, among other ingredients as described herein.
- the disclosure provides a method for inhibiting (e.g., silencing) a transcriptionally active DUX4 gene in a cell, the method comprising: delivering to the cell an effective amount of gene editing complex, wherein the gene editing complex reduces DUX4 expression in the cell.
- the cell containing an effective amount of a gene editing complex can be any cell that has a transcriptionally active DUX4 gene.
- the cell can be a muscle cell (e.g., a myoblast, myocyte, or terminally differentiated muscle cell).
- a cell having a transcriptionally active DUX4 gene can also comprise a contraction of a D4Z4 repeat array at chromosome 4q35 of the DUX4 gene.
- the number of repeat units in the array can vary. In some embodiments, the number of repeat units in the contraction is 11 or fewer (e.g., 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, or 0) repeat units. In some embodiments, the cell is in vitro or ex vivo.
- ex vivo modified cell refers to a cell (e.g.. a mammalian cell) that is removed from a subject, genetically modified (e.g., transfected or transduced with exogenous nucleic acids, or genetically reprogrammed), cultured or expanded, and optionally, returned to a subject (e.g.. either the same subject, or a different subject).
- ex vivo modified cells are useful for autologous cell therapy, or allogeneic cell therapy.
- cells may be removed from a subject having a disease associated with a particular genetic defect (e.g., FSHD), transfected with a gene editing complex that corrects the genetic defect (e.g. reduces expression of DUX4), and reintroduced into the subject.
- a gene editing complex that corrects the genetic defect (e.g. reduces expression of DUX4)
- cells are removed from a subject, genetically reprogrammed (e.g., dedifferentiated or transdifferentiated into muscle cells), expanded, and reintroduced into the subject.
- ex vivo modified cells produced by transfection with a nucleic acid as described by the disclosure have an improved safety profile compared to ex vivo cells produced by currently available gene therapy vectors.
- the disclosure relates to pharmaceutical compositions comprising a gene editing complex.
- the composition comprises gene editing complex and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
- Pharmaceutical compositions can be prepared as described below. The active ingredients may be admixed or compounded with any conventional, pharmaceutically acceptable carrier or excipient. The compositions may be sterile.
- compositions are formulated for delivering an effective amount of an agent (e.g., gene editing complex).
- an “effective amount” of an active agent refers to an amount sufficient to elicit the desired biological response (e.g.. transcriptional repression, such as silencing or inhibition, of the active DUX4 gene).
- An effective amount of an agent may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the disease being treated (e.g.. FSHD), the mode of administration, and the patient.
- a composition is said to be a “pharmaceutically acceptable carrier” if its administration can he tolerated by a recipient patient.
- Sterile phosphate-buffered saline is one example of a pharmaceutically acceptable carrier.
- Other suitable carriers are well-known in the art. See, for example, REMINGTON’S PHARMACEUTICAL SCIENCES. 18th Ed. (1990).
- any mode of administration, vehicle or carrier conventionally employed and which is inert with respect to the active agent may be utilized for preparing and administering the pharmaceutical compositions of the present disclosure.
- Illustrative of such methods, vehicles and carriers are those described, for example, in Remington’s Pharmaceutical Sciences, 4th ed. (1970), the disclosure of which is incorporated herein by reference.
- Those skilled in the art, having been exposed to the principles of the disclosure, will experience no difficulty in determining suitable and appropriate vehicles, excipients and carriers or in compounding the active ingredients therewith to form the pharmaceutical compositions of the disclosure.
- an effective amount, also referred to as a therapeutically effective amount, of a compound is an amount sufficient to ameliorate at least one adverse effect associated with activation (e.g., transcriptional activation), or increased expression, of the gene in a cell or in an individual in need of such modulation.
- an effective amount is an amount sufficient to inhibit (e.g., transcriptionally repress) DUX4 gene in a cell or in an individual in need of DUX4 inhibition.
- the therapeutically effective amount to be included in pharmaceutical compositions depends, in each case, upon several factors, e.g., the type, size and condition of the patient to be treated, the intended mode of administration, the capacity of the patient to incorporate the intended dosage form, etc.
- an amount of active agent is included in each dosage form to provide from about 0.1 to about 250 mg/kg, and preferably from about 0.1 to about 100 mg/kg.
- an amount of active agent can be included in each dosage form to provide between about 10 10 , 10 11 , 10 12 , 10 13 , 10 14 , or 10 15 genome copies per subject.
- One of ordinary skill in the art would be able to determine empirically an appropriate therapeutically effective amount.
- an effective prophylactic or therapeutic treatment regimen can be planned which does not cause substantial toxicity and yet is entirely effective to treat the particular subject.
- the effective amount for any particular application can vary depending on such factors as the disease or condition being treated, the particular therapeutic agent being administered, the size of the subject, or the severity of the disease or condition.
- One of ordinary skill in the art can empirically determine the effective amount of a particular nucleic acid and/or other therapeutic agent without necessitating undue experimentation.
- colloidal dispersion systems include lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes.
- a colloidal system of the disclosure is a liposome.
- Liposomes are artificial membrane vessels which are useful as a delivery vector in vivo or in vitro. It has been shown that large unilamellar vesicles (LUVs), which range in size from 0.2 - 4.0 ⁇ m can encapsulate large macromolecules, RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form. Fraley et al. (1981) Trends Biochem Sci 6:77.
- LUVs large unilamellar vesicles
- Liposomes may be targeted to a particular tissue by coupling the liposome to a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein.
- Ligands which may be useful for targeting a liposome to, for example, an smooth muscle cell include, but are not limited to: intact or fragments of molecules which interact with smooth muscle cell specific receptors and molecules, such as antibodies, which interact with the cell surface markers of cancer cells. Such ligands may easily be identified by binding assays well known to those of skill in the art.
- the liposome may be targeted to a tissue by coupling it to an antibody known in the art.
- Lipid formulations for transfection are commercially available from QIAGEN, for example, as EFFECTENETM (a non-liposomal lipid with a special DNA condensing enhancer) and SUPERFECTTM (a novel acting dendrimeric technology).
- EFFECTENETM a non-liposomal lipid with a special DNA condensing enhancer
- SUPERFECTTM a novel acting dendrimeric technology
- Liposomes are commercially available from Gibco BRL, for example, as LIPOFECTINTM and LIPOFECTACETM, which are formed of cationic lipids such as N-[1-(2,3 dioleyloxy)-propyl]-N, N,N-trimethylammonium chloride (DOTMA) and dimethyl dioctadecylammonium bromide (DDAB).
- LIPOFECTINTM LIPOFECTINTM
- LIPOFECTACETM LIPOFECTINTM and LIPOFECTACETM, which are formed of cationic lipids such as N-[1-(2,3 dioleyloxy)-propyl]-N, N,N-trimethylammonium chloride (DOTMA) and dimethyl dioctadecylammonium bromide (DDAB).
- DOTMA N,N-trimethylammonium chloride
- DDAB dimethyl dioctadecylammonium bromide
- Certain cationic lipids including in particular N-[1-(2,3 dioleoyloxy)-propyl]-N,N,N-trimethylammonium methyl-sulfate (DOTAP), may be advantageous when combined with the gene editing complexes and vectors of the disclosure.
- DOTAP N-[1-(2,3 dioleoyloxy)-propyl]-N,N,N-trimethylammonium methyl-sulfate
- compaction agents may also be desirable.
- Compaction agents also can be used alone, or in combination with, a biological or chemical/physical vector.
- a “compaction agent”, as used herein, refers to an agent, such as a histone, that neutralizes the negative charges on the nucleic acid and thereby permits compaction of the nucleic acid into a fine granule. Compaction of the nucleic acid facilitates the uptake of the nucleic acid by the target cell.
- the compaction agents can be used alone, e.g., to deliver a gene editing complex or a vector as described by the disclosure in a form that is more efficiently taken up by the cell or, in combination with one or more of the above-described carriers.
- the compounds may be administered alone (e.g., in saline or buffer) or using any delivery vehicle known in the art.
- delivery vehicles have been described: cochleates; Emulsomes: ISCOMs; liposomes: live bacterial vectors (e.g., Salmonella. Escherichia coli.
- viral vectors e.g., Vaccinia, adenovirus, Herpes Simplex, Lentiviral
- microspheres nucleic acid vaccines
- polymers e.g., carboxymethylcellulose, chitosan
- proteosomes sodium fluoride
- transgenic plants virosomes
- virus-like particles e.g., virus-like particles
- gene editing complexes described by the disclosure are delivered by lentiviral vector or recombinant adeno-associated virus (rAAV) vector.
- rAAV recombinant adeno-associated virus
- compositions of the disclosure are administered in pharmaceutically acceptable solutions, which may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, adjuvants, and optionally other therapeutic ingredients.
- pharmaceutically-acceptable carrier means one or more compatible solid or liquid filler, diluents or encapsulating substances which are suitable for administration to a human or other vertebrate animal.
- carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application.
- the components of the pharmaceutical compositions also are capable of being commingled with the compounds of the present disclosure, and with each other, in a manner such that there is no interaction which would substantially impair the desired pharmaceutical efficiency.
- Dragee cores are provided with suitable coatings.
- suitable coatings For this purpose, concentrated sugar solutions may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures.
- Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
- the compounds may also be formulated as a depot preparation.
- Such long-acting formulations may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- compositions also may comprise suitable solid or gel phase carriers or excipients.
- suitable solid or gel phase carriers or excipients include but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols.
- Suitable liquid or solid pharmaceutical preparation forms are, for example, aqueous or saline solutions for inhalation, microencapsulated, encochleated, coated onto microscopic gold particles, contained in liposomes, nebulized, aerosols, pellets for implantation into the skin, or dried onto a sharp object to be scratched into the skin.
- the pharmaceutical compositions also include granules, powders, tablets, coated tablets, (micro)capsules, suppositories, syrups, emulsions, suspensions, creams, drops or preparations with protracted release of active compounds, in whose preparation excipients and additives and/or auxiliaries such as disintegrants, binders, coating agents, swelling agents, lubricants, flavorings, sweeteners or solubilizers are customarily used as described above.
- the pharmaceutical compositions are suitable for use in a variety of drug delivery systems. For a brief review of methods for drug delivery, see Langer R (1990) Science 249:1527-1533, which is incorporated herein by reference.
- the compounds may be administered per se (neat) or in the form of a pharmaceutically acceptable salt.
- the salts should be pharmaceutically acceptable, but non-pharmaceutically acceptable salts may conveniently be used to prepare pharmaceutically acceptable salts thereof.
- Such salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulphuric, mitric, phosphoric, maleic, acetic, salicylic, p-toluene sulphonic, tartaric, citric, methane sulphonic, formic, malonic, succinic, naphthalene-2-sulphonic, and benzene sulphonic.
- such salts can the prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts of the carboxylic acid group.
- Suitable buffering agents include: acetic acid and a salt (1-2% w/v); citric acid and a salt (1-3% w/v); boric acid and a salt (0.5-2.5% w/v); and phosphoric acid and a salt (0.8-2% w/v).
- Suitable preservatives include benzalkonium chloride (0.003-0.03% w/v); chlorobutanol (0.3-0.9% w/v); parabens (0.01-0.25% w/v) and thimerosal (0.004-0.02% w/v).
- compositions may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the compounds into association with a carrier which constitutes one or more accessory ingredients. In general, the compositions are prepared by uniformly and intimately bringing the compounds into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product.
- Liquid dose units are vials or ampoules. Solid dose units are tablets, capsules and suppositories.
- compositions of the present disclosure preferably contain a pharmaceutically acceptable carrier or excipient suitable for rendering the compound or mixture administrable orally as a tablet, capsule or pill, or parenterally, intravenously, intradermally, intramuscularly or subcutaneously, or transdermally.
- a therapeutically effective amount of a gene editing complex or vector as described by the disclosure is delivered to a target tissue or a target cell.
- DUX4 e.g., DUX4-fl
- an effective amount of gene editing complex or vector is delivered to the muscle cells of a subject.
- the muscle cells are myoblasts.
- the muscle cells are terminally differentiated muscle cells. Examples of differentiated muscle cells include myocytes and myotubes.
- compositions containing gene editing complex or vector, and/or other compounds can be administered by any suitable route for administering medications.
- a variety of administration routes are available. The particular mode selected will depend, of course, upon the particular agent or agents selected, the particular condition being treated, and the dosage required for therapeutic efficacy.
- the methods of this disclosure may be practiced using any mode of administration that is medically acceptable, meaning any mode that produces therapeutic effect without causing clinically unacceptable adverse effects.
- modes of administration are discussed herein.
- an effective amount of the gene editing complex or vector, and/or other therapeutic agent can be administered to a subject by any mode that delivers the agent to the desired surface, e.g., systemic, intramuscular, etc.
- the gene editing complex or vector as described by the disclosure is administered to a subject via intramuscular (IM) injection.
- IM intramuscular
- administering the pharmaceutical composition of the present disclosure may be accomplished by any means known to the skilled artisan.
- Additional routes of administration include but are not limited to oral, parenteral, intravenous, intraperitoneal, intranasal, sublingual, intratracheal, inhalation, subcutaneous, ocular, vaginal, and rectal.
- Systemic routes include oral and parenteral.
- Several types of devices are regularly used for administration by inhalation. These types of devices include metered dose inhalers (MDI), breath-actuated MDI, dry powder inhaler (DPI), spacer/holding chambers in combination with MDI, and nebulizers.
- MDI metered dose inhalers
- DPI dry powder inhaler
- spacer/holding chambers in combination with MDI and nebulizers.
- the compounds can be formulated readily by combining the active compound(s) with pharmaceutically acceptable carriers well known in the art.
- Such carriers enable the compounds of the disclosure to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a subject to be treated.
- Pharmaceutical preparations for oral use can be obtained as solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores.
- Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcellulose, and/or polyvinylpyrrolidone (PVP).
- disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate.
- the oral formulations may also be formulated in saline or buffers for neutralizing internal acid conditions or may be administered without any carriers.
- compositions which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol.
- the push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers.
- the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols.
- stabilizers may be added.
- Microspheres formulated for oral administration may also be used. Such microspheres have been well defined in the art. All formulations for oral administration should be in dosages suitable for such administration.
- compositions may take the form of tablets or lozenges formulated in conventional manner.
- the compounds for use according to the present disclosure may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g.. dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g.. dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g... dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas.
- a suitable propellant e.g... dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane,
- the compounds when it is desirable to deliver them systemically, may be formulated for parenteral administration by injection, e.g.. by bolus injection or continuous infusion.
- Formulations for injection may be presented in unit dosage form, e.g.. in ampoules or in multidose containers, with an added preservative.
- the compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- compositions for parenteral administration include aqueous solutions of the active compounds in water-soluble form. Additionally, suspensions of the active compounds may he prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes. Aqueous injection suspensions may contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Optionally, the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
- the active compounds may be in powder form for constitution with a suitable vehicle. e.g., sterile pymgen-free water, before use.
- a suitable vehicle e.g., sterile pymgen-free water
- the compounds may also be formulated in rectal or vaginal compositions such as suppositories or retention enemas, e.g.. containing conventional suppository bases such as cocoa butter or other glycerides.
- Other delivery systems can include time-release, delayed release or sustained release delivery systems. Such systems can avoid repeated administrations of the compounds, increasing convenience to the subject and the physician.
- Many types of release delivery systems are available and known to those of ordinary skill in the art. They include polymer base systems such as poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polyanhydrides. Microcapsules of the foregoing polymers containing drugs are described in, for example. U.S. Pat. No. 5,075,109.
- Delivery systems also include non-polymer systems that are: lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-, di-, and tri-glycerides; hydrogel release systems; silastic systems; peptide-based systems; was coatings; compressed tablets using conventional binders and excipients: partially fused implants: and the like.
- Specific examples include, but are not limited to: (a) erosional systems in which an agent of the disclosure is contained in a form within a matrix such as those described in U.S. Pat. Nos. 4,452,775. 4,675,189, and 5,736,152, and (b) diffusional systems in which an active component permeates at a controlled rate from a polymer such as described in U.S. Pat. Nos. 3,854,480, 5,133,974 and 5,407,686.
- pump-based hardware delivery systems can be used, some of which are adapted for implantation.
- a gene editing complex (e.g.. a nucleic acid encoding one or more components of a gene editing complex) can be delivered to the cells via an expression vector engineered to express the gene editing complex.
- An expression vector is one into which a desired sequence may be inserted, e.g., by restriction and ligation, such that it is operably joined to regulatory sequences and may be expressed as an RNA transcript.
- An expression vector typically contains an insert that is a coding sequence for a protein (e.g. gene editing protein, such as a CRISPR/Cas protein) or for a polynucleotide, such as guide RNA (gRNA, sgRNA, etc.).
- Vectors may further contain one or more marker sequences suitable for use in the identification of cells that have or have not been transformed or transfected with the vector.
- Markers include, for example, genes encoding proteins that increase or decrease either resistance or sensitivity to antibiotics or other compounds, genes that encode enzymes whose activities are detectable by standard assays or fluorescent proteins, etc.
- a coding sequence e.g.. protein coding sequence, miRNA sequence, shRNA sequence
- regulatory sequences are said to be “operably” joined when they are covalently linked in such a way as to place the expression or transcription of the coding sequence under the influence or control of the regulatory sequences.
- coding sequences be translated into a functional protein
- two DNA sequences are said to be operably joined if induction of a promoter in the 5′ regulatory sequences results in the transcription of the coding sequence and if the nature of the linkage between the two DNA sequences does not (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the promoter region to direct the transcription of the coding sequences, or (3) interfere with the ability of the corresponding RNA transcript to be translated into a protein.
- a promoter region would be operably joined to a coding sequence if the promoter region were capable of effecting transcription of that DNA sequence such that the resulting transcript might be translated into the desired protein or polypeptide.
- a coding sequence may encode an miRNA. shRNA or siRNA.
- regulatory sequences needed for gene expression may vary between species or cell types, but shall in general include, as necessary, 5′ non-transcribed and 5′ non-translated sequences involved with the initiation of transcription and translation, respectively, such as a TATA box, capping sequence, CAAT sequence, and the like.
- 5′ non-transcribed regulatory sequences will include a promoter region that includes a promoter sequence for transcriptional control of the operably joined gene.
- a vector does not include a promoter sequence.
- Regulatory sequences may also include enhancer sequences, upstream activator sequences, internal ribosomal entry sites (IRES), and/or self-processing peptide sequences (e.g... 2A peptide), as desired.
- the vectors of the disclosure may optionally include 5′ leader or signal sequences.
- a virus vector for delivering a nucleic acid molecule is selected from the group consisting of adenoviruses, adeno-associated viruses, poxviruses including vaccinia viruses and attenuated poxviruses, Semliki Forest virus, Venezuelan equine encephalitis virus, retroviruses. Sindbis virus, and Ty virus-like particle.
- viruses and virus-like particles which have been used to deliver exogenous nucleic acids include: replication-defective adenoviruses, a modified retrovirus, a nonreplicating retrovirus, a replication defective Semliki Forest virus, canarypox virus and highly attenuated vaccinia virus derivative, non-replicative vaccinia virus, replicative vaccinia virus, Venzuelan equine encephalitis virus, Sindbis virus, lentiviral vectors and Ty virus-like particle.
- the adeno-associated virus is capable of infecting a wide range of cell types and species and can he engineered to be replication-deficient. It further has advantages, such as heat and lipid solvent stability, high transduction frequencies in cells of diverse lineages, including hematopoietic cells, and lack of superinfection inhibition thus allowing multiple series of transductions.
- the adeno-associated virus can integrate into human cellular DNA in a site-specific manner, thereby minimizing the possibility of insertional mutagenesis and variability of inserted gene expression.
- adeno-associated virus infections have been followed in tissue culture for greater than 100 passages in the absence of selective pressure, implying that the adeno-associated virus genomic integration is a relatively stable event.
- the adeno-associated virus can also function in an extrachromosomal fashion.
- a recombinant AAV vector comprises, at a minimum, a transgene coding sequence (e.g., a nucleic acid sequence encoding a gene editing protein, such as a Cas protein, or a gRNA) and its associated regulatory sequence flanked by two AAV inverted terminal repeat (ITR) sequences.
- a transgene coding sequence e.g., a nucleic acid sequence encoding a gene editing protein, such as a Cas protein, or a gRNA
- ITR inverted terminal repeat
- the ITR sequences are AAV1, AAV2, AAV5, AAV6. AAV7, AAV8. or AAV9 ITR sequences, or variants thereof.
- an rAAV vector comprising a nucleic acid encoding all or part of a gene editing complex (e.g., a nucleic acid sequence encoding a gene editing protein, a gRNA, or both) is packaged into a recombinant AAV (rAAV).
- a gene editing complex e.g., a nucleic acid sequence encoding a gene editing protein, a gRNA, or both
- rAAV recombinant AAV
- an AAV vector is packaged into viral particles by one or more AAV capsid proteins.
- the AAV capsid is an important element in determining these tissue-specific targeting capabilities.
- an rAAV having a capsid appropriate for the tissue being targeted can be selected.
- the capsid protein has a serotype selected from AAV2, AAV3, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAVrh.8, AAVrh.10, AAVrh.39, and AAVrh.43.
- the rAAV comprises a capsid protein that targets muscle cells.
- Non-cytopathic viruses include certain retroviruses, the life cycle of which involves reverse transcription of genomic viral RNA into DNA with subsequent proviral integration into host cellular DNA.
- the retroviruses are replication-deficient (e.g., capable of directing synthesis of the desired transcripts, but incapable of manufacturing an infectious particle).
- retroviral expression vectors have general utility for the high-efficiency transduction of genes in vivo
- Standard protocols for producing replication-deficient retroviruses including the steps of incorporation of exogenous genetic material into a plasmid, transfection of a packaging cell lined with plasmid, production of recombinant retroviruses by the packaging cell line, collection of viral particles from tissue culture media, and infection of the target cells with viral particles
- Kriegler, M. “Gene Transfer and Expression, A Laboratory Manual,” W.H. Freeman Co., New York (1990) and Murry, EJ. Ed. “Methods in Molecular Biology,” vol. 7, Humana Press, Inc., Clifton, New Jersey (1991).
- gene editing complex e.g.. a nucleic acid sequence encoding a gene editing protein, a gRNA. or both
- a cell e.g. a cell of a subject
- nucleic acid molecules of the disclosure may be introduced into cells, depending on whether the nucleic acid molecules are introduced in vitro or in vivo in a host.
- Such techniques include transfection of nucleic acid molecule-calcium phosphate precipitates, transfection of nucleic acid molecules associated with DEAE, transfection or infection with the foregoing viruses including the nucleic acid molecule of interest, liposome-mediated transfection, and the like.
- Other examples include: N-TERTM Nanoparticle Transfection System by Sigma-Aldrich, FectoFlyTM transfection reagents for insect cells by Polyplus Transfection. Polyethylenimine “Max” by Polysciences. Inc.. Unique.
- Non-Viral Transfection Tool by Cosmo Bio Co., Ltd. LipofectamineTM LTX Transfection Reagent by Invitrogen. SatisFectionTM Transfection Reagent by Stratagene, LipofectamineTM Transfection Reagent by Invitrogen, FuGENE® HD Transfection Reagent by Roche Applied Science, GMP compliant in vivo-jetPETTM transfection reagent by Polyplus Transfection, and Insect GeneJuice® Transfection Reagent by Novagen.
- pHAGE EF1.dCas9-VP64 (Addgene plasmid #50918), pHAGE EF1-dCas9-KRAB (Addgene plasmid#50919), pLKO.1-puro U6 sgRNA BfuAI stuffer (Addgene plasmid #50920), pHRdSV40-dCas9-10xGCN4-v4-P2A-BFP (Addgene plasmid #60903), and pHRdSV40-scFv-GCN4-sfGFP-VP64-GB1-NLS (Addgene plasmid #60904), pHR-scFv-GCN4-sfGFP-GB1-NLS-dWPRE (Addgene plasmid #60906).
- ChIP-grade antibodies used in this example include: ⁇ -KAP1(ab3831). ⁇ -HP1 ⁇ (ab77256), ⁇ -HP1 ⁇ (ab10811), ⁇ -histone H3 (ab1791). ⁇ -histone H3K27acetyl (ab4729), and ⁇ -RNA Polymerase II CTD phosphor S2 (ab5095).
- An sgRNA design tool was used to identify high-scoring candidate sgRNAs to four target regions within and flanking the D4Z4 repeat array ( FIG. 2 A ; Table 1). Predicted off-target matches were determined by BLASTing each sequence against the human genomic database (Table 1). High-scoring, non-overlapping candidates with the fewest CpGs and off target matches (four to five sgRNAs for each target region) were cloned individually into BfuAI sites in the pLKO.1-puro U6 sgRNA BfuAI stuffer plasmid and sequence-verified.
- Myogenic cultures derived from biceps muscle of an FSHD1 patient (17Abic) were used in this example.
- Patient 17A has two permissive 4qA alleles (-5 repeat units on a contracted 4A161 allele: -26 repeat units on the non-contracted 4A-L161 allele; each 10q allele has ⁇ 37 repeat units).
- 17Abic myoblasts were grown in Ham’s F-10 medium supplemented with 20% FBS (Hyclone), 0.5% chick embryo extract, 1% antibiotics and antimycotics, and 1.2 mmol/l CaCl2.
- 293T packaging cells were grown in DMEM + 10% FBS +0.1% penicillin-streptavidin. At ⁇ 80% confluency.
- 293T cells were transfected with lentiviral packaging plasmid (pCMV-dR8.91), envelope plasmid (VSV-G), and sgRNA expression plasmid using the TransIT-LT1 transfection reagent (Mirus).
- Lentiviral supernatants were harvested at 11-hour intervals from 72-108 hours post-transfection. At ⁇ 70-80% confluency. 17Abic myoblasts were subjected to four serial infections. Briefly, lentiviral supernatants + 8 ⁇ g/ml polybrene were added to myoblasts and the plates were incubated for 15 minutes at 37° C., then wrapped well with parafilm before centrifuging for 30 minutes at 1,100 g (32° C.).
- DM differentiation medium
- RNAs were extracted using TRIzol (Invitrogen) and purified using the RNeasy Mini kit (Qiagen) after on-column DNase I digestion. Total RNA (2 ⁇ g) was used for cDNA synthesis using Superscript III Reverse Transcriptase (Invitrogen), and 200 ng of cDNA were used for qPCR analysis. Oligonucleotide primer sequences are provided in Table 2.
- ChIP assays were performed with lentiviral-infected 17Abic differentiated myocytes using the Fast ChIP method. Cells were fixed in 1% formaldehyde in DMEM for 10 minutes and dounced 10x prior to sonication. Cells were sonicated for 12 rounds of 15-second pulses at 65% power output on a Branson Sonifier 450 (VWR Scientific) to shear the DNA to a ladder of -200-800 bp, and efficiency of shearing was verified by agarose gel electrophoresis. Chromatin was immunoprecipitated using 2 ⁇ g of specific antibodies or normal IgG. SYBR green quantitative PCR assays were performed for 40 cycles of: 94° C. for 15 seconds, 55° C. for 30 seconds, and 72° C. for 30 seconds. PCR products were analyzed on a 1.5% agarose gel to verify correct size of products and specificity of primer annealing. Oligonucleotide primer sequences are provided in Table 2.
- the CRISPR/dCas9 system was used to test several candidate regions in or flanking the 4q35 D4Z4/DUX4 locus for the ability to modulate gene expression in the D4Z4 array.
- Polyadenylated DUX4-fl mRNA levels in FSHD1 myocytes were used as a read-out for gene expression which is specifically derived from the contracted 4q35 D4Z4 array.
- sgRNAs small guide RNAs
- dCas9 transcriptional effector platforms are effective in modulating endogenous gene expression levels in mammalian cells.
- the SunTag system was used, which involves the dual activity of two constructs: (i) dCas9 fused to 10 copies of the GCN4 peptide and (ii) GCN4 antibody fused to the VP64 activator.
- the dCas9 fused directly to VP64 generally requires multiple, non-overlapping sgRNAs to achieve strong activation of gene expression.
- the SunTag system allows recruitment of multiple VP64 domains to a single dCas9, resulting in robust gene activation with only a single sgRNA.
- sgRNAs Single guide RNAs targeting two candidate regions upstream of the D4Z4 repeat ( FIG. 2 A ) were produced: the NDE (non-deleted element retained in FSHD patients) sequence and p13-E11, a region distinct in the genome that is used to identify D4Z4 arrays specific to chromosomes 4q35 and 10q26.
- sgRNAs targeting the promoter, exon 1, and exon 3 of DUX4 were produced.
- each D4Z4 repeat unit also contains repetitive sequences, and part of the DUX4 exon 1 is duplicated in the NDE. which lies proximal to the array.
- sgRNA #3-5 targets both the NDE and DUX4 exon 1.
- sgRNA #6 targets DUX4 intron 2 as well as the DUX4 promoter.
- sgRNA #6 targets DUX4 intron 2 as well as the DUX4 promoter.
- sgRNA #6 targets DUX4 intron 2 as well as the DUX4 promoter.
- four to five sgRNAs were tested for the ability to recruit dCas9-VP64-HA, as assessed by chromatin immunoprecipitation (ChIP) using HA antibodies.
- ChoIP chromatin immunoprecipitation
- At least two sgRNAs for each region demonstrated correct targeting of dCas9-VP64-HA (Table 1).
- VP64 recruitment to the DUX4 promoter or exon 1/NDE yielded robust activation of DUX4-fl in FSHD mayocytes ( FIG. 2 B , lanes 5-10).
- sgRNAs #3-5 the transcriptional effector is likely mediating its effects from DUX4 exon 1, and for simplicity, we will refer to these sgRNAs as targeting DUX4 exon 1.
- FIG. 2 B It was observed that when dCas9 lacking a transcriptional effector domain was recruited to DUX4 exon 1. it did not activate DUX4-fl expression ( FIG. 2 B , lanes 12-13).
- dCas9-KRAB Reducing the aberrant expression of DUX4-fl in FSHD by returning the chromatin at the disease locus to a nonpathogenic, repressed state is a viable avenue of therapy. Whether DUX4-fl expression could be reduced in FSHD myocytes using a dCas9-KRAB repressor was examined. When guided by multiple sgRNAs, dCas9-KRAB has proven effective in reducing target gene expression in mammalian cells. Since dCas9-mediated recruitment of VP64 to the DUX4 promoter or exon 1 strongly activated DUX4-fl expression, these regions were selected as candidates for therapeutic targeting with dCas9-KRAB.
- FSHD myogenic cultures Four serial coinfections of FSHD myogenic cultures were carried out. Cells were infected with various combinations of lentiviral supernatants expressing either dCas9-KRAB or individual sgRNAs targeting the candidate regions. After the final round of infection, the cells were induced to differentiate and harvested ⁇ 40 hours laser for analysis of DUX4-fl expression by qRT-PCR.
- dCas9 effectors often require targeting by multiple, non-overlapping sgRNAs to achieve significant transcriptional modulation, it was observed that in one case, a single sgRNA was effective in reducing DUX4 -fl expression ( FIG. 3 A , lane 4), and the combination of all six sgRNAs targeting these regions showed no enhanced effect ( FIG. 3 A , lane 7).
- dCas9 can inhibit transcription through steric hindrance of target regions.
- the effect of a dCas9 variant lacking an effector domain e.g. KRAB was tested.
- Recruitment of dCas9 alone to any of the target regions did not reduce levels of DUX4-fl ( FIG. 3 A , lanes 9-13), demonstrating the importance of the KRAB domain for mediating DUX4-fl repression at the target regions.
- DUX4-FL expression is restricted to terminally differentiated myocytes.
- MyHC Myosin heavy chain
- FRG1 and FRG2 two other FSHD candidate genes that lie proximal to the D4Z4 repeat, were also assayed. Although levels of FRG2 were variable, recruitment of the dCas9 repressor to any of the target regions did not reduce expression of either FRG1 or FRG2 mRNA ( FIG. 3 C ).
- DUX4-FL in FSHD myocytes causes the aberrant upregulation of many downstream targets, including genes expressed in the germline and in early development.
- TRIM43, ZSCAN4, and MBD3L2 are downstream targets of DUX4-FL that were also found to be upregulated in the myogenic cultures used in this example.
- expression levels of TRIM43, ZSCAN4, and MBD3L2 were measured by qRT-PCR in the cells.
- sgRNA #3 expression level of the histone demethylase Jumonji, which contains an off-target match (12-bp seed + PAM) in intron 7, was quantified. It was observed that expression of the untargeted SunTag system alone had a slight repressive effect on levels of Jumonji ( FIG. 5 lane 2). However, targeting the activator with sgRNA #3 did not alter these levels ( FIG. 5 , lane 3). For sgRNA #6, expression levels of the transcription factor KLF14 and the E3 ubiquitin ligase UBR4, which lie 28 and 76kb downstream of off-target matches (9bp seed + PAM), were quantified.
- FSHD myogenic cultures were infected with lentiviral supernatants expressing dCas9-KRAB and sgRNAs targeting the DUX4 promoter or exon 1, and cells were induced to differentiate, then fixed and harvested ⁇ 40 hours later for analysis by ChIP.
- Recruitment of the dCas9 repressor to the DUX4 promoter resulted in a trend toward increased levels of the KAPI/TRIM28 corepressor, which is recruited by the KRAB domain, as well as HP1 ⁇ and HP1 ⁇ , which are recruited by KAPI to heterochromatin ( FIGS. 6 A- 6 C , sgRNAs #6-8).
- FIG. 7 shows data indicating that recruitment of dCas9-KRAB by DUX4 sgRNA represses DUX4-fl expression in vivo.
- a 30% reduction in DUX4-fl expression level was observed in mice injected with DUX4 sgRNA and dCas9KRAB compared to control mice injected with dCas9KRAB alone.
- AAV-compatible, catalytically active SpCas9 was recruited to the FSHD locus in primary human myogenic cells by using sgRNA targeting exon 3 of the DUX4 gene.
- Targeting of the Cas9 nuclease to exon 3 of DUX4 resulted in reduction of DUX4 expression as quantified by relative mRNA expression ( FIG. 8 ).
- Decreased expression of DUX4 also resulted in reduced relative expression of DUX4 target genes, such as TRIM43 and ZSCAN4, but not the muscle-specific genes MyoG or MyoD ( FIG. 8 ).
- ⁇ Relative enrichment of dCas9-VP64-HA (Addgene plusmid #50918) at each target region measured by chromatin immunoprecipitation (ChIP) using HA antibodies normalized to mouse IgG.
- #Number of off-target (non-Ch 4/10) matches to 12-nt seed sequence + NGG in human genomic database. “Number of off-target (non-Ch 4/10) matches to 19-nt sequence + NGG in human genomic database (chromosomes in parentheses).
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Molecular Biology (AREA)
- Zoology (AREA)
- Biomedical Technology (AREA)
- Wood Science & Technology (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Microbiology (AREA)
- Public Health (AREA)
- Biophysics (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Plant Pathology (AREA)
- Physics & Mathematics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Neurology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Physical Education & Sports Medicine (AREA)
- Dermatology (AREA)
- Cell Biology (AREA)
- Mycology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
Abstract
Description
- This application claims the benefit under 35 U.S.C. 119(e) of the filing date of U.S. Provisional Application Serial No. 62/398,801, filed Sep. 23, 2016, entitled “SILENCING OF DUX4 BY RECOMBINANT GENE EDITING COMPLEXES”, the entire contents of which are incorporated herein by reference.
- This invention was made with government support under grant number AR062587, awarded by the National Institutes of Health. The government has certain rights in the invention.
- Facioscapulohumeral muscular dystrophy (FSHD) is caused by the aberrant expression of the DUX4 gene from an epigenetically dysregulated D424 array at chromosome 4q35. This gene is generally not expressed, or expressed at very low levels, in healthy individuals. In FSHD patients, DUX4 is aberrantly expressed at higher levels in the skeletal muscles. This aberrant expression ultimately leads to muscle pathology, atrophy, and clinical weakness. Most therapies being developed target the DUX4 mRNA or protein.
- Several therapeutic agents that target DUX4 mRNA or protein have been investigated for treatment of FSHD. However, effective human treatments remain needed. To date, no specific therapy exists for FSHD. and current treatments are only directed to improve behavioral symptoms. Thus, there is a general need for the development of novel compositions and methods for treating FSHD.
- In some aspects, the disclosure relates to compositions (e.g.. recombinant gene editing complexes) useful for the treatment of diseases associated with aberrant expression of DUX4 (e.g.. facioscapulohumeral muscular dystrophy. FSHD). In some embodiments, compositions (e.g., recombinant gene editing complexes) disclosed herein are useful because they transcriptionally regulate (e.g., inhibit) aberrant expression of DUX4. Without wishing to be bound by any particular theory, reduction of DUX4 expression by compositions described by the disclosure (e.g.. gene editing complexes) in subjects having diseases characterized by aberrant expression of DUX4 (e.g., FSHD) is expected to result in decreased DUX4-fl expression (e.g., reduced expression of the pathogenic DUX4-fl protein), and thereby decrease disease symptomatology or reverse disease symptoms. In some embodiments, reduction of DUX4-fl expression by compositions (e.g.. gene editing complexes) described by the disclosure results in reduction of certain genes that function as downstream targets of DUX4, for example TRIM43. ZSCAN4. and MBD3L2.
- Accordingly, in some aspects the disclosure provides a recombinant gene editing complex comprising: a recombinant gene editing protein; and, a nucleic acid encoding a guide RNA (gRNA) that specifically hybridizes to a target nucleic acid sequence encoding a D4Z4 macrosatellite repeat region, wherein binding of the complex to the target nucleic acid sequence results in inhibition of DUX4 gene expression.
- In some embodiments, the target nucleic acid sequence is located on
chromosome 4 at position 4q35. - In some embodiments, the gRNA comprises or is encoded by the sequence set forth in any one of SEQ ID NOs: 1-11. In some embodiments, the gRNA specifically hybridizes to a nucleic acid sequence encoding a DUX4 promoter or
exon 1 of DUX4. In some embodiments, the gRNA comprises or is encoded by the sequence set forth in any one of SEQ ID NOs: 3-8. In some embodiments, the recombinant gene editing complex comprises a plurality (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10. or more) of gRNA sequences (e.g. a plurality of a single gRNA sequence, or a plurality of different or unique gRNA sequences). - In some embodiments, the recombinant gene editing protein comprises a Cas protein, a Cfp1 protein, or a variant thereof. In some embodiments, the Cas protein is a Streptococcus pyogenes Cas protein (SpCas) or a Staphylococcus aureus Cas protein (SaCas). In some embodiments, the Cas protein is a Cas9 protein or a dead Cas9 (dCas,9) protein. In some embodiments, the recombinant gene editing protein comprises the sequence set forth in SEQ ID NO: 42 or 45.
- In some embodiments, the recombinant gene editing protein further comprises a transcriptional repressor domain. In some embodiments, the transcriptional repressor domain is a KRAB domain. In some embodiments, the gene editing protein comprises the sequence set forth in SEQ ID NO: 43 or 44.
- In some aspects, the disclosure provides a vector comprising a nucleic acid encoding one or more components of a recombinant gene editing complex (e.g.. a nucleic acid encoding a gene editing protein, a gRNA. or both) as described by the disclosure. In some embodiments, the vector is a lentiviral vector or a recombinant adeno-associated virus vector (rAAV vector).
- In some aspects, the disclosure provides a host cell comprising a nucleic acid encoding one or more components of a gene editing complex as described by the disclosure.
- In some aspects, the disclosure provides a composition comprising a gene editing complex (e.g.. a nucleic acid encoding one or more components of a gene editing complex, or a vector comprising a nucleic acid encoding a gene editing complex) and a pharmaceutically acceptable excipient.
- The disclosure relates, in part, to the discovery that, in some embodiments a gene editing complex as described by the disclosure is capable of reducing aberrant expression of DUX4. Thus in some aspects, the disclosure provides a method for inhibiting expression of DUX4 in a cell, the method comprising: contacting a cell with a nucleic acid encoding the recombinant gene editing complex as described by the disclosure, a vector as described by the disclosure, in an amount sufficient to inhibit expression of DUX4 gene in the cell.
- In some embodiments, the cell comprises a D4Z4 repeat array having 11 or less repeat units. In some embodiments, the cell is obtained from a subject having or at risk of having facioscapulohumeral muscular dystrophy (FSHD). In some embodiments, the cell is in vitro or ex vivo.
- In some aspects, the disclosure provides a method for treating facioscapulohumeral muscular dystrophy (FSHD) in a subject in need thereof, the method comprising: administering to the subject a therapeutically effective amount of (i) a nucleic acid encoding the recombinant gene editing complex as described by the disclosure; or, (ii) a vector as described by the disclosure.
- In some embodiments, the subject is a mammal, optionally a human. In some embodiments,
chromosome 4 of the subject comprises a D4Z4 repeat array having 11 or less repeat units. - In some embodiments, the administration is by injection, optionally intramuscular injection or intravenous injection.
- In some embodiments, the recombinant gene editing complex is administered to muscle cells of the subject, optionally myogenic precursor satellite cells, myoblasts, myocytes, or terminally differentiated muscle cells of the subject.
- In some embodiments, the recombinant gene editing complex is administered to one or more somatic cells of the subject, optionally fibroblasts or leukocytes. In some embodiments, the one or more somatic cells are isolated from the subject and reprogrammed into a myogenic lineage, for example using induced pluripotent stem cell (iPS) technology.
-
FIG. 1 shows a schematic depiction of CRISPR/Cas9 Tools for Genome Editing or Transcription Modulation in Skeletal Myocytes. (Upper panel) The Cas9 enzyme forms a complex with a sequence-specific single guide RNA (sgRNA), which guides binding to a genomic target. Cas9 cuts DNA, generating double-stranded breaks that are repaired by non-homologous end joining (NHEJ) to produce various insertions and deletions (indels) at the target sequence. (Lower panel) Catalytically inactive dCas9 is fused to transcriptional modulators (e.g., the KRAB repressor domain), to alter gene expression at defined loci. Gene editing strategies for DMD and FSHD. as described by Wojtal et al. (2016) Am. J. Hum. Genet. 98, 90-101, and Himeda et al. (2015) Mol. Ther. Doi:10.1038/mt.2015.200. respectively, are shown. -
FIGS. 2A-2B show identification of single guide RNAs (sgRNAs) that target the D4Z4 region and affect expression of DUX4.FIG. 2A shows a schematic depiction of the D4Z4 repeat region of chromosome 10q and chromosome 4q.FIG. 2B shows data relating to the effects of using specific sgRNAs (#1-9) to target dCas9-VP64 to the FSHD locus on DUX4-fl expression. -
FIGS. 3A-3C show recruitment of dCas9-KRAB to the DUX4 promoter orexon 1 represses DUX4-fl in FSHD.FIG. 3A shows data relating to relative expression of DUX4-fl after targeting of dCas9-KRAB to the FSHD locus using specific sgRNAs (#1-11).FIG. 3B shows recruitment of dCas9-KRAB to the FSHD locus does not impair skeletal myocyte differentiation, as measured by relative expression level of MyHC.FIG. 3C shows recruitment of dCas9-KRAB to the FSHD locus does not repress expression of FRG1 and FRG2. as measured by relative mRNA expression. -
FIG. 4 shows recruitment of dCas9-KRAB to the DUX4 promoter orexon 1 represses DUX4-fl target genes in FSHD myocytes. Data relating to relative expression levels of TRIM43. ZSCAN4, and MBD3L2 are shown. -
FIG. 5 shows targeting a transcriptional effector to the DUX4 promoter orexon 1 has no effect on expression of several off-target genes. Relative expression levels of Jumonji, KLF14, and UBR4 were assessed by quantitative RT-PCR after targeting of dCas9 fused to a transcriptional activator using sgRNA #3 (DUX4 promoter) or sgRNA #6 (DUX4 exon 1). -
FIGS. 6A-6F show recruitment of dCas9-KRAB to the DUX4 promoter orexon 1 represses the D4Z4 locus in FSHD myocytes. Chromatin was immunoprecipitated using antibodies specific for (FIG. 6A ) KAP1, (FIG. 6B ) HP1α, (FIG. 6C ) HP1β, (FIG. 6D ) H3K27ac, or (FIG. 6E ) the elongating form of RNA Pol II (Pol II-PS2), and analyzed by qPCR using primers to the (FIG. 6F ) p13-E11 region of 4q35 orexon 1,intron 1, orexon 3 of DUX4 (as shown from left to right in each ofFIGS. 6A-6E ). Location of primers is shown inFIG. 1 a . In cases where enrichment of the specific factor was observed across the DUX4 locus, an off-target region was also assessed. Data are presented as fold enrichment of the target region by each specific antibody normalized to α-histone H3. with enrichment for the mock-infected cells set to 1. -
FIG. 7 shows data relating to repression of DUX4-fl expression in vivo by recruitment of dCas9-KRAB to the FSHD locus by sgRNAs in a mouse model of FSHD. -
FIG. 8 shows Cas9 nuclease targeted toDUX4 exon 3 decreases expression of DUX4-fl and target genes (e.g.. TRIM43, ZSCAN4) but not MyoG or MyoD. Relative expression of GAPDH is also shown as a control. - In some aspects, the disclosure relates to recombinant gene editing complexes useful for the treatment of diseases associated with aberrant expression of DUX4 (e.g.. facioscapulohumeral muscular dystrophy. FSHD). The disclosure is based, in part, on the surprising discovery that recruitment of recombinant gene editing complexes to certain loci of the D4Z4 macrosatellite repeat region (e.g.. at position 4q35) and/or the DUX4 gene results in decreased production of DUX4-fl, the pathogenic mRNA isoform associated with FSHD. as well as reduced expression of certain genes (e.g., TRIM43. ZSCAN4, etc.) that are downstream targets of DUX4-fl.
- As used herein, the term “facioscapulohumeral muscular dystrophy” or “FSHD” refers to a disease or disorder that results from transcriptional activation of the DUX4 gene. In some embodiments, activation of the DUX4 gene results in a toxic gain of function in the DUX4 gene (e.g., production of pathogenic DUX4-f1) and causes a range of symptoms including progressive skeletal muscle weakness (e.g.. facial muscle weakness, shoulder weakness, etc.), hearing loss, abnormal heart rhythm, unequal weakening of biceps, triceps, deltoids and lower arm muscles, loss of strength in abdominal and/or leg muscles, a foot drop. In some embodiments, FSHD results in a subject requiring ventilatory support or wheelchair confinement.
- FSHD is associated with a contraction of the D4Z4 repeat sequence at the subtelomeric region 4q35 on
Chromosome 4 of the human genome. Generally,chromosome 4 of a healthy subject (e.g., a subject not having FSHD) comprises a D4Z4 repeat region having between 12 and 150 repeat units, resulting in production of an altematively-spliced 3′-truncated DUX4 transcript (DUX4-s). Without wishing to be bound by any particular theory, the DUX4 gene of a subject having a contracted D4Z4 repeat (e.g., 11 or fewer repeat units) becomes transcriptionally activated due to the loss of repeat-mediated repression, resulting in production of pathogenic full-length DUX4 (DUX4-f1) mRNA and protein. - In some aspects, the invention relates to the discovery that recruitment of recombinant gene editing molecules to certain loci of the D4Z4 macrosatellite repeat region and/or the DUX4 gene results in decreased production of DUX4-f1 protein in a subject (e.g., in a cell of a subject). As used herein, the term “D4Z4 macrosatellite repeat region” refers to a chromosomal locus comprising at least one of the following genomic features: a p13E-I1 probe hybridizing sequence, a non-deleted element (NDE) sequence (e.g., a NDE sequence that functions as a transcriptional start site for a DBE-T transcript), a nucleic acid sequence encoding DUX4 (e.g., a nucleic acid
sequence encoding exon 1,exon 2 andexon 3 of DUX4). In some embodiments,chromosome 4 comprises a D4Z4 macrosatellite repeat region, for example at locus 4q35. - As used herein, the term “reduced DUX4 expression” refers to a change in state of a DUX4 gene from a transcriptionally active (e.g., expressed or transcribed) state to a reduced state of transcriptional activity, for example, a transcriptionally inactive (e.g., silenced) state. For example, in some embodiments, a subject (e.g., a cell in a subject) having a transcriptionally active (e.g., expressed) DUX4 gene produces DUX4-f1; knockdown (e.g., silencing) of DUX4 expression in the subject (e.g., cell in the subject), for example by administration of a recombinant gene editing complex targeting a D4Z4 macrosatellite repeat region, leads to reduced (or inhibited) expression and production of DUX4-f1 in the subject
- In some aspects, the disclosure relates to the discovery that inhibition of DUX4 expression by a recombinant gene editing complex as described by the disclosure results in reduced expression of certain genes that are downstream targets of DUX4-f1. For example, in some embodiments, inhibition of DUX4 expression by a recombinant gene editing complex as described by the disclosure results in reduced expression of TRIM43, ZSCAN4, MBD3L2, or any combination of the foregoing, as described further in the Examples section.
- In some embodiments, reduction of target gene (e.g., DUX4, TRIM43, ZSCAN4) expression can be measured as expression level of the target gene (e.g., DUX4) in a sample (e.g., a cell or a subject) after treatment with a recombinant gene editing complex relative to expression level of target gene (e.g., DUX4) in the sample prior to treatment with the recombinant gene editing complex. Generally, the expression level of a target gene (e.g., DUX4) can be measured by any suitable method known in the art, for example by hybridization-based assay (e.g., RT-PCR, qRT-PCR, Northern Blot), protein-based methods (e.g., Western blot), spectroscopic methods (e.g., mass spectrometry), and cell-based methods (e.g., flow cytometry, fluorescence activated cell sorting (FACS)).
- The disclosure is based, in part, on the discovery of recombinant gene editing complexes that inhibit-for example, through transcriptional repression or generation of double-stranded DNA breaks- expression of the DUX4 gene.
- Accordingly, in some aspects, the disclosure provides a recombinant gene editing complex comprising: a recombinant gene editing protein; and, a nucleic acid encoding a guide RNA (gRNA) that specifically hybridizes to a target nucleic acid sequence encoding a D4Z4 macrosatellite repeat region, wherein binding of the complex to the target nucleic acid sequence results in inhibition of DUX4 gene expression.
- As used herein, “gene editing complex” refers to a biologically active molecule (e.g., a protein, one or more proteins, a nucleic acid, one or more nucleic acids, or any combination of the foregoing) configured for adding, disrupting or changing genomic sequences (e.g. a gene sequence), for example by causing a double stranded break (DSB) in a target DNA or inhibiting transcription of a target DNA sequence. Examples of gene editing complexes include but are not limited to Transcription Activator-like Effector Nucleases (TALENs), Zinc Finger Nucleases (ZFNs), engineered meganuclease re-engineered homing endonucleases, the CRISPR/Cas system, and meganucleases (e.g., Meganuclease I-SceI). In some embodiments, a gene editing complex comprizes proteins or molecules (e.g., recombinant gene editing proteins) related to the CRISPR/Cas system, including but not limited to Cas9, Cas6, dCas9, Cpf1, CRISPR RNA (crRNA), trans-activating crRNA (tracrRNA), and variants thereof.
- In some embodiments, a recombinant gene editing protein is a nuclease. As used herein, the terms “endonuclease” and “nuclease” refer to an enzyme that cleaves a phosphodiester bond or bonds within a polynucleotide chain. Nucleases may be naturally occurring or genetically engineered. Genetically engineered nucleases are particularly useful for genome editing and are generally classified into four families: zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), meganucleases (e.g., engineered meganucleases) and CRISPR-associated proteins (Cas nucleases). In some embodiments, the nuclease is a ZFN. In some embodiments, the ZFN comprises a FokI cleavage domain. In some embodiments, the ZFN comprises Cys2His2 fold group. In some embodiments, the nuclease is a TALEN. In some embodiments, the TALEN comprises a FokI cleavage domain. In some embodiments, the nuclease is a meganuclease. Examples of meganucleases include but are not limited to I-Scel, I-CreI, I-DmoI, and combinations thereof (e.g., E-DreI, DmoCre).
- The term “CRISPR” refers to “clustered regularly interspaced short palindromic repeats”, which are DNA loci containing short repetitions of base sequences. CRISPR loci form a portion of a prokaryotic adaptive immune system that confers resistance to foreign genetic material. Each CRISPR loci is flanked by short segments of “spacer DNA”, which are derived from viral genomic material. In the Type II CRISPR system, spacer DNA hybridizes to transactivating RNA (tracrRNA) and is processed into CRISPR-RNA (crRNA) and subsequently associates with CRISPR-associated nucleases (Cas nucleases) to form complexes that recognize and degrade foreign DNA. In certain embodiments, the nuclease is a CRISPR-associated nuclease (Cas nuclease). Examples of CRISPR nucleases include, but are not limited to Cas9, dCas9, Cas6, Cpf1, and variants thereof. In some embodiments, the nuclease is Cas9. In some embodiments, the Cas9 is derived from the bacteria Streptococcus pyogenes (e.g., SpCas9) or Staphylocaccus aureus (e.g., SaCas9, for example SEQ ID NO: 42). In some embodiments, a Cas protein is modified (e.g. genetically engineered) to lack nuclease activity. For example, dead Cas9 (dCas9) protein binds to a target locus but does not cleave said locus. In some embodiments, a dCas9 protein comprises the sequence set forth in SEQ ID NO: 45. In some embodiments, a Cas protein or variant thereof does not exceed the packaging capacity of a viral vector, such as a lentiviral vector or an adeno-associated virus (AAV) vector, for example as described by Ran et al. (2015) Nature. 520(7546): 186-91. For example, in some embodiments, a nucleic acid encoding a Cas protein is less than about 4.6 kb in length.
- Aspects of the disclosure relate to the use of CRISPR-mediated regulation of tanscription, such as CRISPR interference, for the reduction (e.g. silencing) of DUX4 expression. For example, in some embodiments, a catalytically dead Cas9 protein (e.g., dead Cas9. “dCas9”) is fused (e.g., covalently bound) to a transcriptional regulator domain to modulate (e.g., inhibit) expression of a target gene (e.g., DUX4), as described by Qi et al. (2013) Cell. 152(5); 1173-1183 and Gilbert et al. (2013) Cell. 154(2); 442-45 1. In some embodiments, dCas9 comprises a sequence set forth in SEQ ID NO: 45. Without wishing to be bound by any particular theory, dCas9 (or another catalytically dead Cas protein) mediates transcriptional repression, in some embodiments, by sterically hindering the binding of transcriptional machinery (e.g., a RNA polymerase complex) to a target sequence.
- In some embodiments, a CRISPR Cas protein (e.g., dCas9) is fused to a transcriptional regulator domain. As used herein a “transcriptional regulator domain” is a protein domain that catalyzes structural or chemical changes in a chromatin molecule that results in altered transcriptional activity (e.g., transcriptional activation or transcriptional repression). In some embodiments, the transcriptional regulator domain is a transcriptional repressor domain. In some embodiments, the repressive domain comprises a Kruppel associated box domain (KRAB domain). Non-limiting examples of KRAB domains include KOX1 KRAB domain. KOX8 KRAB domain, ZNF43 KRAB domain, and ZNF184 KRAB domain. In some embodiments, the KRAB domain is a KOX1 KRAB domain. In some embodiments, the gene editing protein comprises a sequence set forth in SEQ ID NO: 43 or 44. Further non-limiting examples of repressive domains include Chromo Shadow (CS) domain (e.g., CS domain of HP1α) and WRPW domain (e.g., WRPW domain of Hes1).
- In some embodiments, the transcriptional regulator domain is a transcriptional activator domain. In some embodiments, the transcriptional activator domain comprises a transcriptional activation domain of Herpes simplex virus, such as VP16, or a variant thereof. Generally, a transcription factor may contain multiple activation domains, for example as described by Beerli et al. (1998) Proc. Natl. Acad. Sci. U.S.A. 95(25); 14628-33. Accordingly, in some embodiments, the transcriptional activator domain comprises 2, 3, 4, 5, 6, 7, 8, 9, or 10 activation domains. In some embodiments, the transcriptional activator domain is VP64, VP96, or VP160.
- In some embodiments, a Cas protein is not fused to a transcriptional regulator domain, and is capable of modulating (e.g., inhibiting) gene expression via nuclease activity (e.g.. DNA cleavage). Generally, Cas9 cleaves DNA at a site targeted by the guide RNA and then repaired by either non-homologous end joining (NHEJ), which is imprecise and often results in a small insertion or deletion (InDel) that disrupts the targeted sequence, or homology directed DNA repair, which allows for the insertion of a changed or new DNA sequence into the genome at a specific location. Without wishing to be bound by any particular theory, DNA cleavage by a Cas protein and subsequent repair introduce modifications into a target DNA sequence that may adversely affect (e.g.. inhibit) gene expression. Accordingly, in some aspects, the disclosure relates to a gene editing complex comprising a functional nuclease and a guide RNA that hybridizes to a D4Z4 macrosatellite repeat region that is capable of reducing expression of DUX4 in a subject (e.g., a cell of a subject). In some embodiments, the guide RNA that directs the activity of the functional
nuclease targets exon 3 of the DUX4 gene. - For the purpose of genome editing, the CRISPR system can be modified to combine the tracrRNA and crRNA in to a single guide RNA (sgRNA) or just (gRNA). As used herein, the terms “guide RNA”. “gRNA”, and “sgRNA” refer to a polynucleotide sequence that is complementary to a target sequence in a cell and associates with a Cas nuclease, thereby directing the Cas nuclease to the target sequence. In some embodiments, a gRNA (e.g., sgRNA) ranges between 1 and 30 nucleotides in length. In some embodiments, a gRNA (e.g., sgRNA) ranges between 5 and 25 nucleotides in length. In some embodiments, a gRNA (e.g., sgRNA) ranges between 10 and 22 nucleotides in length. In some embodiments, a gRNA (e.g., sgRNA) ranges between 14 and 24 nucleotides in length. In some embodiments, a Cas protein and a guide RNA (e.g., sgRNA) are expressed from the same vector. In some embodiments, a Cas protein and a guide RNA (e.g., sgRNA) are expressed from separate vectors (e.g., two or more vectors).
- Typically, a guide RNA (e.g., a gRNA or sgRNA) hybridizes (e.g., binds specifically to, for example by Watson-Crick base pairing) to a target sequence and thus directs the CRISPR/Cas protein to the target sequence. In some embodiments, a guide RNA hybridizes to (e.g., targets) a nucleic acid sequence encoding a D4Z4 macrosatellite repeat region or a nucleic acid sequence encoding DUX4 gene. In some embodiments, the gRNA hybridizes to a p13E-11 sequence or a NDE sequence. In some embodiments, the gRNA hybridizes to
exon 1,exon 2 orexon 3 of a DUX4 gene. In some embodiments, the gRNA comprises or is encoded by the sequence set forth in any one of SEQ ID NOs: 1-11, for example as described in Table 1. - In some aspects, the disclosure provides methods for treating a subject having facioscapulohumeral muscular dystrophy (FSHD). For example, transcriptional activation of the DUX4 gene may lead to FSHD in a subject. As used herein, a “subject” is interchangeable with a “subject in need thereof”, both of which may refer to a subject having FSHD, or a subject having an increased risk of developing such a disorder relative to the population at large. For example, in some embodiments, a subject has a D4Z4 array comprising 11 or fewer repeat units at chromosome 4q35 but does not exhibit signs or symptoms of FSHD. A subject in need thereof may be a subject having a transcriptionally active DUX4 gene (e.g., a subject expressing DUX4-fl protein). A subject can be a human, non-human primate, rat, mouse, cat, dog, or other mammal.
- As used herein, the terms “treatment”, “treating”, and “therapy” refer to therapeutic treatment and prophylactic or preventative manipulations. The terms further include ameliorating existing symptoms, preventing additional symptoms, ameliorating or preventing the underlying causes of symptoms, preventing or reversing causes of symptoms, for example, symptoms associated with FSHD. Thus, the terms denote that a beneficial result has been conferred on a subject having FSHD. or with the potential to develop such a disorder. Furthermore, the term “treatment” is defined as the application or administration of an agent (e.g., therapeutic agent or a therapeutic composition) to a subject, or an isolated tissue or cell line from a subject, who may have a disease, a symptom of disease or a predisposition toward a disease, with the purpose to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve or affect the disease, the symptoms of disease or the predisposition toward disease.
- Therapeutic agents or therapeutic compositions may include a compound in a pharmaceutically acceptable form that prevents and/or reduces the symptoms of a particular disease (e.g.. FSHD). For example a therapeutic composition may be a pharmaceutical composition that prevents and/or reduces the symptoms of FSHD. In some embodiments, the disclosure provides a composition (e.g.. a therapeutic composition) comprising a gene editing complex as described by the disclosure or a vector as described by the disclosure. In some embodiments, the composition further comprises a pharmaceutically acceptable excipient. It is contemplated that the therapeutic composition of the present invention will be provided in any suitable form. The form of the therapeutic composition will depend on a number of factors, including the mode of administration as described herein. The therapeutic composition may contain diluents, adjuvants and excipients, among other ingredients as described herein.
- In some aspects, the disclosure provides a method for inhibiting (e.g., silencing) a transcriptionally active DUX4 gene in a cell, the method comprising: delivering to the cell an effective amount of gene editing complex, wherein the gene editing complex reduces DUX4 expression in the cell.
- The cell containing an effective amount of a gene editing complex can be any cell that has a transcriptionally active DUX4 gene. For example, the cell can be a muscle cell (e.g., a myoblast, myocyte, or terminally differentiated muscle cell).
- A cell having a transcriptionally active DUX4 gene can also comprise a contraction of a D4Z4 repeat array at chromosome 4q35 of the DUX4 gene. The number of repeat units in the array can vary. In some embodiments, the number of repeat units in the contraction is 11 or fewer (e.g., 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1, or 0) repeat units. In some embodiments, the cell is in vitro or ex vivo.
- In some aspects, gene editing complexes described by the disclosure are useful for the production of modified cells, such as ex vivo modified cells. As used herein. “ex vivo modified cell” refers to a cell (e.g.. a mammalian cell) that is removed from a subject, genetically modified (e.g., transfected or transduced with exogenous nucleic acids, or genetically reprogrammed), cultured or expanded, and optionally, returned to a subject (e.g.. either the same subject, or a different subject). Generally, ex vivo modified cells are useful for autologous cell therapy, or allogeneic cell therapy. For example, cells may be removed from a subject having a disease associated with a particular genetic defect (e.g., FSHD), transfected with a gene editing complex that corrects the genetic defect (e.g. reduces expression of DUX4), and reintroduced into the subject. In another non-limiting example, cells are removed from a subject, genetically reprogrammed (e.g., dedifferentiated or transdifferentiated into muscle cells), expanded, and reintroduced into the subject. In some embodiments, ex vivo modified cells produced by transfection with a nucleic acid as described by the disclosure have an improved safety profile compared to ex vivo cells produced by currently available gene therapy vectors.
- In some aspects, the disclosure relates to pharmaceutical compositions comprising a gene editing complex. In some embodiments, the composition comprises gene editing complex and a pharmaceutically acceptable carrier. As used herein the term “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions. Pharmaceutical compositions can be prepared as described below. The active ingredients may be admixed or compounded with any conventional, pharmaceutically acceptable carrier or excipient. The compositions may be sterile.
- Typically, pharmaceutical compositions are formulated for delivering an effective amount of an agent (e.g., gene editing complex). In general an “effective amount” of an active agent refers to an amount sufficient to elicit the desired biological response (e.g.. transcriptional repression, such as silencing or inhibition, of the active DUX4 gene). An effective amount of an agent may vary depending on such factors as the desired biological endpoint, the pharmacokinetics of the compound, the disease being treated (e.g.. FSHD), the mode of administration, and the patient.
- A composition is said to be a “pharmaceutically acceptable carrier” if its administration can he tolerated by a recipient patient. Sterile phosphate-buffered saline is one example of a pharmaceutically acceptable carrier. Other suitable carriers are well-known in the art. See, for example, REMINGTON’S PHARMACEUTICAL SCIENCES. 18th Ed. (1990).
- It will be understood by those skilled in the art that any mode of administration, vehicle or carrier conventionally employed and which is inert with respect to the active agent may be utilized for preparing and administering the pharmaceutical compositions of the present disclosure. Illustrative of such methods, vehicles and carriers are those described, for example, in Remington’s Pharmaceutical Sciences, 4th ed. (1970), the disclosure of which is incorporated herein by reference. Those skilled in the art, having been exposed to the principles of the disclosure, will experience no difficulty in determining suitable and appropriate vehicles, excipients and carriers or in compounding the active ingredients therewith to form the pharmaceutical compositions of the disclosure.
- An effective amount, also referred to as a therapeutically effective amount, of a compound (for example, a gene editing complex or vector as described by the disclosure) is an amount sufficient to ameliorate at least one adverse effect associated with activation (e.g., transcriptional activation), or increased expression, of the gene in a cell or in an individual in need of such modulation. In some embodiments, an effective amount is an amount sufficient to inhibit (e.g., transcriptionally repress) DUX4 gene in a cell or in an individual in need of DUX4 inhibition. The therapeutically effective amount to be included in pharmaceutical compositions depends, in each case, upon several factors, e.g., the type, size and condition of the patient to be treated, the intended mode of administration, the capacity of the patient to incorporate the intended dosage form, etc. Generally, an amount of active agent is included in each dosage form to provide from about 0.1 to about 250 mg/kg, and preferably from about 0.1 to about 100 mg/kg. In the case of viral vectors, an amount of active agent can be included in each dosage form to provide between about 1010, 1011, 1012, 1013, 1014, or 1015 genome copies per subject. One of ordinary skill in the art would be able to determine empirically an appropriate therapeutically effective amount.
- Combined with the teachings provided herein, by choosing among the various active compounds and weighing factors such as potency, relative bioavailability, patient body weight, severity of adverse side-effects and selected mode of administration, an effective prophylactic or therapeutic treatment regimen can be planned which does not cause substantial toxicity and yet is entirely effective to treat the particular subject. The effective amount for any particular application can vary depending on such factors as the disease or condition being treated, the particular therapeutic agent being administered, the size of the subject, or the severity of the disease or condition. One of ordinary skill in the art can empirically determine the effective amount of a particular nucleic acid and/or other therapeutic agent without necessitating undue experimentation.
- In some cases, compounds of the disclosure are prepared in a colloidal dispersion system. Colloidal dispersion systems include lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. In some embodiments, a colloidal system of the disclosure is a liposome. Liposomes are artificial membrane vessels which are useful as a delivery vector in vivo or in vitro. It has been shown that large unilamellar vesicles (LUVs), which range in size from 0.2 - 4.0 µm can encapsulate large macromolecules, RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form. Fraley et al. (1981) Trends Biochem Sci 6:77.
- Liposomes may be targeted to a particular tissue by coupling the liposome to a specific ligand such as a monoclonal antibody, sugar, glycolipid, or protein. Ligands which may be useful for targeting a liposome to, for example, an smooth muscle cell include, but are not limited to: intact or fragments of molecules which interact with smooth muscle cell specific receptors and molecules, such as antibodies, which interact with the cell surface markers of cancer cells. Such ligands may easily be identified by binding assays well known to those of skill in the art. In still other embodiments, the liposome may be targeted to a tissue by coupling it to an antibody known in the art.
- Lipid formulations for transfection are commercially available from QIAGEN, for example, as EFFECTENE™ (a non-liposomal lipid with a special DNA condensing enhancer) and SUPERFECT™ (a novel acting dendrimeric technology).
- Liposomes are commercially available from Gibco BRL, for example, as LIPOFECTIN™ and LIPOFECTACE™, which are formed of cationic lipids such as N-[1-(2,3 dioleyloxy)-propyl]-N, N,N-trimethylammonium chloride (DOTMA) and dimethyl dioctadecylammonium bromide (DDAB). Methods for making liposomes are well known in the art and have been described in many publications. Liposomes also have been reviewed by Gregoriadis G (1985) Trends Biotechnol 3:235-241.
- Certain cationic lipids, including in particular N-[1-(2,3 dioleoyloxy)-propyl]-N,N,N-trimethylammonium methyl-sulfate (DOTAP), may be advantageous when combined with the gene editing complexes and vectors of the disclosure.
- In some aspects of the disclosure, the use of compaction agents may also be desirable. Compaction agents also can be used alone, or in combination with, a biological or chemical/physical vector. A “compaction agent”, as used herein, refers to an agent, such as a histone, that neutralizes the negative charges on the nucleic acid and thereby permits compaction of the nucleic acid into a fine granule. Compaction of the nucleic acid facilitates the uptake of the nucleic acid by the target cell. The compaction agents can be used alone, e.g., to deliver a gene editing complex or a vector as described by the disclosure in a form that is more efficiently taken up by the cell or, in combination with one or more of the above-described carriers.
- Other exemplary compositions that can be used to facilitate uptake of a gene editing complex or vector as described by the disclosure include calcium phosphate and other chemical mediators of intracellular transport, microinjection compositions, electroporation and homologous recombination compositions (e.g., for integrating a nucleic acid into a preselected location within the target cell chromosome).
- The compounds may be administered alone (e.g., in saline or buffer) or using any delivery vehicle known in the art. For instance the following delivery vehicles have been described: cochleates; Emulsomes: ISCOMs; liposomes: live bacterial vectors (e.g., Salmonella. Escherichia coli. Bacillus Calmette-Guérin, Shigella, Lactobacillus); live viral vectors (e.g., Vaccinia, adenovirus, Herpes Simplex, Lentiviral): microspheres: nucleic acid vaccines; polymers (e.g., carboxymethylcellulose, chitosan): polymer rings; proteosomes; sodium fluoride; transgenic plants: virosomes; and, virus-like particles, In some embodiments, gene editing complexes described by the disclosure are delivered by lentiviral vector or recombinant adeno-associated virus (rAAV) vector.
- The formulations of the disclosure are administered in pharmaceutically acceptable solutions, which may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, adjuvants, and optionally other therapeutic ingredients.
- The term pharmaceutically-acceptable carrier means one or more compatible solid or liquid filler, diluents or encapsulating substances which are suitable for administration to a human or other vertebrate animal. The term carrier denotes an organic or inorganic ingredient, natural or synthetic, with which the active ingredient is combined to facilitate the application. The components of the pharmaceutical compositions also are capable of being commingled with the compounds of the present disclosure, and with each other, in a manner such that there is no interaction which would substantially impair the desired pharmaceutical efficiency.
- Dragee cores are provided with suitable coatings. For this purpose, concentrated sugar solutions may be used, which may optionally contain gum arabic, talc, polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or titanium dioxide, lacquer solutions, and suitable organic solvents or solvent mixtures. Dyestuffs or pigments may be added to the tablets or dragee coatings for identification or to characterize different combinations of active compound doses.
- In addition to the formulations described herein, the compounds may also be formulated as a depot preparation. Such long-acting formulations may be formulated with suitable polymeric or hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives, for example, as a sparingly soluble salt.
- The pharmaceutical compositions also may comprise suitable solid or gel phase carriers or excipients. Examples of such carriers or excipients include but are not limited to calcium carbonate, calcium phosphate, various sugars, starches, cellulose derivatives, gelatin, and polymers such as polyethylene glycols.
- Suitable liquid or solid pharmaceutical preparation forms are, for example, aqueous or saline solutions for inhalation, microencapsulated, encochleated, coated onto microscopic gold particles, contained in liposomes, nebulized, aerosols, pellets for implantation into the skin, or dried onto a sharp object to be scratched into the skin. The pharmaceutical compositions also include granules, powders, tablets, coated tablets, (micro)capsules, suppositories, syrups, emulsions, suspensions, creams, drops or preparations with protracted release of active compounds, in whose preparation excipients and additives and/or auxiliaries such as disintegrants, binders, coating agents, swelling agents, lubricants, flavorings, sweeteners or solubilizers are customarily used as described above. The pharmaceutical compositions are suitable for use in a variety of drug delivery systems. For a brief review of methods for drug delivery, see Langer R (1990) Science 249:1527-1533, which is incorporated herein by reference.
- The compounds may be administered per se (neat) or in the form of a pharmaceutically acceptable salt. When used in medicine the salts should be pharmaceutically acceptable, but non-pharmaceutically acceptable salts may conveniently be used to prepare pharmaceutically acceptable salts thereof. Such salts include, but are not limited to, those prepared from the following acids: hydrochloric, hydrobromic, sulphuric, mitric, phosphoric, maleic, acetic, salicylic, p-toluene sulphonic, tartaric, citric, methane sulphonic, formic, malonic, succinic, naphthalene-2-sulphonic, and benzene sulphonic. Also, such salts can the prepared as alkaline metal or alkaline earth salts, such as sodium, potassium or calcium salts of the carboxylic acid group.
- Suitable buffering agents include: acetic acid and a salt (1-2% w/v); citric acid and a salt (1-3% w/v); boric acid and a salt (0.5-2.5% w/v); and phosphoric acid and a salt (0.8-2% w/v). Suitable preservatives include benzalkonium chloride (0.003-0.03% w/v); chlorobutanol (0.3-0.9% w/v); parabens (0.01-0.25% w/v) and thimerosal (0.004-0.02% w/v).
- The compositions may conveniently be presented in unit dosage form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the compounds into association with a carrier which constitutes one or more accessory ingredients. In general, the compositions are prepared by uniformly and intimately bringing the compounds into association with a liquid carrier, a finely divided solid carrier, or both, and then, if necessary, shaping the product. Liquid dose units are vials or ampoules. Solid dose units are tablets, capsules and suppositories.
- The pharmaceutical compositions of the present disclosure preferably contain a pharmaceutically acceptable carrier or excipient suitable for rendering the compound or mixture administrable orally as a tablet, capsule or pill, or parenterally, intravenously, intradermally, intramuscularly or subcutaneously, or transdermally.
- In some embodiments, a therapeutically effective amount of a gene editing complex or vector as described by the disclosure is delivered to a target tissue or a target cell. In some embodiments, DUX4 (e.g., DUX4-fl) is expressed in muscle cells of a subject having FSHD. Thus, in some embodiments, an effective amount of gene editing complex or vector is delivered to the muscle cells of a subject. In some embodiments, the muscle cells are myoblasts. In some embodiments, the muscle cells are terminally differentiated muscle cells. Examples of differentiated muscle cells include myocytes and myotubes.
- The pharmaceutical compositions containing gene editing complex or vector, and/or other compounds can be administered by any suitable route for administering medications. A variety of administration routes are available. The particular mode selected will depend, of course, upon the particular agent or agents selected, the particular condition being treated, and the dosage required for therapeutic efficacy. The methods of this disclosure, generally speaking, may be practiced using any mode of administration that is medically acceptable, meaning any mode that produces therapeutic effect without causing clinically unacceptable adverse effects. Various modes of administration are discussed herein. For use in therapy, an effective amount of the gene editing complex or vector, and/or other therapeutic agent can be administered to a subject by any mode that delivers the agent to the desired surface, e.g., systemic, intramuscular, etc. In some embodiments, the gene editing complex or vector as described by the disclosure is administered to a subject via intramuscular (IM) injection.
- However, it should be appreciated that administering the pharmaceutical composition of the present disclosure may be accomplished by any means known to the skilled artisan. Additional routes of administration include but are not limited to oral, parenteral, intravenous, intraperitoneal, intranasal, sublingual, intratracheal, inhalation, subcutaneous, ocular, vaginal, and rectal. Systemic routes include oral and parenteral. Several types of devices are regularly used for administration by inhalation. These types of devices include metered dose inhalers (MDI), breath-actuated MDI, dry powder inhaler (DPI), spacer/holding chambers in combination with MDI, and nebulizers.
- For oral administration, the compounds can be formulated readily by combining the active compound(s) with pharmaceutically acceptable carriers well known in the art. Such carriers enable the compounds of the disclosure to be formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions and the like, for oral ingestion by a subject to be treated. Pharmaceutical preparations for oral use can be obtained as solid excipient, optionally grinding a resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries, if desired, to obtain tablets or dragee cores. Suitable excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose preparations such as, for example, maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carboxymethylcelulose, and/or polyvinylpyrrolidone (PVP). If desired, disintegrating agents may be added, such as the cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt thereof such as sodium alginate. Optionally the oral formulations may also be formulated in saline or buffers for neutralizing internal acid conditions or may be administered without any carriers.
- Pharmaceutical preparations which can be used orally include push-fit capsules made of gelatin, as well as soft, sealed capsules made of gelatin and a plasticizer, such as glycerol or sorbitol. The push-fit capsules can contain the active ingredients in admixture with filler such as lactose, binders such as starches, and/or lubricants such as talc or magnesium stearate and, optionally, stabilizers. In soft capsules, the active compounds may be dissolved or suspended in suitable liquids, such as fatty oils, liquid paraffin, or liquid polyethylene glycols. In addition, stabilizers may be added. Microspheres formulated for oral administration may also be used. Such microspheres have been well defined in the art. All formulations for oral administration should be in dosages suitable for such administration.
- For buccal administration, the compositions may take the form of tablets or lozenges formulated in conventional manner.
- For administration by inhalation, the compounds for use according to the present disclosure may be conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant, e.g.. dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In the case of a pressurized aerosol the dosage unit may be determined by providing a valve to deliver a metered amount. Capsules and cartridges of e.g., gelatin for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
- The compounds, when it is desirable to deliver them systemically, may be formulated for parenteral administration by injection, e.g.. by bolus injection or continuous infusion. Formulations for injection may be presented in unit dosage form, e.g.. in ampoules or in multidose containers, with an added preservative. The compositions may take such forms as suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing and/or dispersing agents.
- Pharmaceutical formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble form. Additionally, suspensions of the active compounds may he prepared as appropriate oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes. Aqueous injection suspensions may contain substances which increase the viscosity of the suspension, such as sodium carboxymethyl cellulose, sorbitol, or dextran. Optionally, the suspension may also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions.
- Alternatively, the active compounds may be in powder form for constitution with a suitable vehicle. e.g., sterile pymgen-free water, before use.
- The compounds may also be formulated in rectal or vaginal compositions such as suppositories or retention enemas, e.g.. containing conventional suppository bases such as cocoa butter or other glycerides.
- Other delivery systems can include time-release, delayed release or sustained release delivery systems. Such systems can avoid repeated administrations of the compounds, increasing convenience to the subject and the physician. Many types of release delivery systems are available and known to those of ordinary skill in the art. They include polymer base systems such as poly(lactide-glycolide), copolyoxalates, polycaprolactones, polyesteramides, polyorthoesters, polyhydroxybutyric acid, and polyanhydrides. Microcapsules of the foregoing polymers containing drugs are described in, for example. U.S. Pat. No. 5,075,109. Delivery systems also include non-polymer systems that are: lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-, di-, and tri-glycerides; hydrogel release systems; silastic systems; peptide-based systems; was coatings; compressed tablets using conventional binders and excipients: partially fused implants: and the like. Specific examples include, but are not limited to: (a) erosional systems in which an agent of the disclosure is contained in a form within a matrix such as those described in U.S. Pat. Nos. 4,452,775. 4,675,189, and 5,736,152, and (b) diffusional systems in which an active component permeates at a controlled rate from a polymer such as described in U.S. Pat. Nos. 3,854,480, 5,133,974 and 5,407,686. In addition, pump-based hardware delivery systems can be used, some of which are adapted for implantation.
- In some embodiments, a gene editing complex (e.g.. a nucleic acid encoding one or more components of a gene editing complex) can be delivered to the cells via an expression vector engineered to express the gene editing complex. An expression vector is one into which a desired sequence may be inserted, e.g., by restriction and ligation, such that it is operably joined to regulatory sequences and may be expressed as an RNA transcript. An expression vector typically contains an insert that is a coding sequence for a protein (e.g. gene editing protein, such as a CRISPR/Cas protein) or for a polynucleotide, such as guide RNA (gRNA, sgRNA, etc.). Vectors may further contain one or more marker sequences suitable for use in the identification of cells that have or have not been transformed or transfected with the vector. Markers include, for example, genes encoding proteins that increase or decrease either resistance or sensitivity to antibiotics or other compounds, genes that encode enzymes whose activities are detectable by standard assays or fluorescent proteins, etc.
- As used herein, a coding sequence (e.g.. protein coding sequence, miRNA sequence, shRNA sequence) and regulatory sequences are said to be “operably” joined when they are covalently linked in such a way as to place the expression or transcription of the coding sequence under the influence or control of the regulatory sequences. If it is desired that the coding sequences be translated into a functional protein, two DNA sequences are said to be operably joined if induction of a promoter in the 5′ regulatory sequences results in the transcription of the coding sequence and if the nature of the linkage between the two DNA sequences does not (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the promoter region to direct the transcription of the coding sequences, or (3) interfere with the ability of the corresponding RNA transcript to be translated into a protein. Thus, a promoter region would be operably joined to a coding sequence if the promoter region were capable of effecting transcription of that DNA sequence such that the resulting transcript might be translated into the desired protein or polypeptide. It will be appreciated that a coding sequence may encode an miRNA. shRNA or siRNA.
- The precise nature of the regulatory sequences needed for gene expression may vary between species or cell types, but shall in general include, as necessary, 5′ non-transcribed and 5′ non-translated sequences involved with the initiation of transcription and translation, respectively, such as a TATA box, capping sequence, CAAT sequence, and the like. Such 5′ non-transcribed regulatory sequences will include a promoter region that includes a promoter sequence for transcriptional control of the operably joined gene. However, in some embodiments, a vector does not include a promoter sequence. Regulatory sequences may also include enhancer sequences, upstream activator sequences, internal ribosomal entry sites (IRES), and/or self-processing peptide sequences (e.g.. 2A peptide), as desired. The vectors of the disclosure may optionally include 5′ leader or signal sequences.
- In some embodiments, a virus vector for delivering a nucleic acid molecule is selected from the group consisting of adenoviruses, adeno-associated viruses, poxviruses including vaccinia viruses and attenuated poxviruses, Semliki Forest virus, Venezuelan equine encephalitis virus, retroviruses. Sindbis virus, and Ty virus-like particle. Examples of viruses and virus-like particles which have been used to deliver exogenous nucleic acids include: replication-defective adenoviruses, a modified retrovirus, a nonreplicating retrovirus, a replication defective Semliki Forest virus, canarypox virus and highly attenuated vaccinia virus derivative, non-replicative vaccinia virus, replicative vaccinia virus, Venzuelan equine encephalitis virus, Sindbis virus, lentiviral vectors and Ty virus-like particle.
- Another virus useful for certain applications is the adeno-associated vines. The adeno-associated virus is capable of infecting a wide range of cell types and species and can he engineered to be replication-deficient. It further has advantages, such as heat and lipid solvent stability, high transduction frequencies in cells of diverse lineages, including hematopoietic cells, and lack of superinfection inhibition thus allowing multiple series of transductions. The adeno-associated virus can integrate into human cellular DNA in a site-specific manner, thereby minimizing the possibility of insertional mutagenesis and variability of inserted gene expression. In addition, wild-type adeno-associated virus infections have been followed in tissue culture for greater than 100 passages in the absence of selective pressure, implying that the adeno-associated virus genomic integration is a relatively stable event. The adeno-associated virus can also function in an extrachromosomal fashion.
- Generally, a recombinant AAV vector (rAAV) comprises, at a minimum, a transgene coding sequence (e.g., a nucleic acid sequence encoding a gene editing protein, such as a Cas protein, or a gRNA) and its associated regulatory sequence flanked by two AAV inverted terminal repeat (ITR) sequences. Examples of regulatory sequences include promoters (e.g., constitutive promoters, inducible promoters, tissue-specific promoters), enhancer sequences, etc. In some embodiments, the ITR sequences are AAV1, AAV2, AAV5, AAV6. AAV7, AAV8. or AAV9 ITR sequences, or variants thereof.
- In some embodiments, an rAAV vector comprising a nucleic acid encoding all or part of a gene editing complex (e.g., a nucleic acid sequence encoding a gene editing protein, a gRNA, or both) is packaged into a recombinant AAV (rAAV). Typically, an AAV vector is packaged into viral particles by one or more AAV capsid proteins. The AAV capsid is an important element in determining these tissue-specific targeting capabilities. Thus, an rAAV having a capsid appropriate for the tissue being targeted can be selected. In some embodiments, the capsid protein has a serotype selected from AAV2, AAV3, AAV5, AAV6, AAV6.2, AAV7, AAV8, AAV9, AAVrh.8, AAVrh.10, AAVrh.39, and AAVrh.43. In some embodiments, the rAAV comprises a capsid protein that targets muscle cells.
- In general, other useful viral vectors are based on non-cytopathic eukaryotic viruses in which non-essential genes have been replaced with the gene of interest. Non-cytopathic viruses include certain retroviruses, the life cycle of which involves reverse transcription of genomic viral RNA into DNA with subsequent proviral integration into host cellular DNA. In general, the retroviruses are replication-deficient (e.g., capable of directing synthesis of the desired transcripts, but incapable of manufacturing an infectious particle). Such genetically altered retroviral expression vectors have general utility for the high-efficiency transduction of genes in vivo, Standard protocols for producing replication-deficient retroviruses (including the steps of incorporation of exogenous genetic material into a plasmid, transfection of a packaging cell lined with plasmid, production of recombinant retroviruses by the packaging cell line, collection of viral particles from tissue culture media, and infection of the target cells with viral particles) are provided in Kriegler, M., “Gene Transfer and Expression, A Laboratory Manual,” W.H. Freeman Co., New York (1990) and Murry, EJ. Ed. “Methods in Molecular Biology,” vol. 7, Humana Press, Inc., Clifton, New Jersey (1991). In some embodiments, gene editing complex (e.g.. a nucleic acid sequence encoding a gene editing protein, a gRNA. or both) is delivered to a cell (e.g. a cell of a subject) by a lentiviral vector.
- Various techniques may be employed for introducing nucleic acid molecules of the disclosure into cells, depending on whether the nucleic acid molecules are introduced in vitro or in vivo in a host. Such techniques include transfection of nucleic acid molecule-calcium phosphate precipitates, transfection of nucleic acid molecules associated with DEAE, transfection or infection with the foregoing viruses including the nucleic acid molecule of interest, liposome-mediated transfection, and the like. Other examples include: N-TER™ Nanoparticle Transfection System by Sigma-Aldrich, FectoFly™ transfection reagents for insect cells by Polyplus Transfection. Polyethylenimine “Max” by Polysciences. Inc.. Unique. Non-Viral Transfection Tool by Cosmo Bio Co., Ltd., Lipofectamine™ LTX Transfection Reagent by Invitrogen. SatisFection™ Transfection Reagent by Stratagene, Lipofectamine™ Transfection Reagent by Invitrogen, FuGENE® HD Transfection Reagent by Roche Applied Science, GMP compliant in vivo-jetPET™ transfection reagent by Polyplus Transfection, and Insect GeneJuice® Transfection Reagent by Novagen.
- The following plasmids were used in this example: pHAGE EF1.dCas9-VP64 (Addgene plasmid #50918), pHAGE EF1-dCas9-KRAB (Addgene plasmid#50919), pLKO.1-puro U6 sgRNA BfuAI stuffer (Addgene plasmid #50920), pHRdSV40-dCas9-10xGCN4-v4-P2A-BFP (Addgene plasmid #60903), and pHRdSV40-scFv-GCN4-sfGFP-VP64-GB1-NLS (Addgene plasmid #60904), pHR-scFv-GCN4-sfGFP-GB1-NLS-dWPRE (Addgene plasmid #60906).
- ChIP-grade antibodies used in this example include: α-KAP1(ab3831). α-HP1α (ab77256), α -HP1β (ab10811), α-histone H3 (ab1791). α-histone H3K27acetyl (ab4729), and α -RNA Polymerase II CTD phosphor S2 (ab5095).
- Other antibodies used for ChIP were α-HA high affinity (clone 3F10) and normal mouse IgG (sc-2025).
- An sgRNA design tool was used to identify high-scoring candidate sgRNAs to four target regions within and flanking the D4Z4 repeat array (
FIG. 2A ; Table 1). Predicted off-target matches were determined by BLASTing each sequence against the human genomic database (Table 1). High-scoring, non-overlapping candidates with the fewest CpGs and off target matches (four to five sgRNAs for each target region) were cloned individually into BfuAI sites in the pLKO.1-puro U6 sgRNA BfuAI stuffer plasmid and sequence-verified. - Myogenic cultures derived from biceps muscle of an FSHD1 patient (17Abic) were used in this example. Patient 17A has two permissive 4qA alleles (-5 repeat units on a contracted 4A161 allele: -26 repeat units on the non-contracted 4A-L161 allele; each 10q allele has ~37 repeat units). 17Abic myoblasts were grown in Ham’s F-10 medium supplemented with 20% FBS (Hyclone), 0.5% chick embryo extract, 1% antibiotics and antimycotics, and 1.2 mmol/l CaCl2. 293T packaging cells were grown in DMEM + 10% FBS +0.1% penicillin-streptavidin. At ~80% confluency. 293T cells were transfected with lentiviral packaging plasmid (pCMV-dR8.91), envelope plasmid (VSV-G), and sgRNA expression plasmid using the TransIT-LT1 transfection reagent (Mirus). Lentiviral supernatants were harvested at 11-hour intervals from 72-108 hours post-transfection. At ~70-80% confluency. 17Abic myoblasts were subjected to four serial infections. Briefly, lentiviral supernatants + 8 µg/ml polybrene were added to myoblasts and the plates were incubated for 15 minutes at 37° C., then wrapped well with parafilm before centrifuging for 30 minutes at 1,100 g (32° C.). Following centrifugation, the viral supernatants were replaced with growth medium and cells were allowed to recover for -8 hours prior to the next round of infection. Following the last round of infection, cells were switched to differentiation medium (DM) (DMEM/F- 12 medium (1:1, Hyclone) plus 2% horse serum (Lonza)) for --40-48 hours prior to harvesting.
- Total RNAs were extracted using TRIzol (Invitrogen) and purified using the RNeasy Mini kit (Qiagen) after on-column DNase I digestion. Total RNA (2 µg) was used for cDNA synthesis using Superscript III Reverse Transcriptase (Invitrogen), and 200 ng of cDNA were used for qPCR analysis. Oligonucleotide primer sequences are provided in Table 2.
- ChIP assays were performed with lentiviral-infected 17Abic differentiated myocytes using the Fast ChIP method. Cells were fixed in 1% formaldehyde in DMEM for 10 minutes and dounced 10x prior to sonication. Cells were sonicated for 12 rounds of 15-second pulses at 65% power output on a Branson Sonifier 450 (VWR Scientific) to shear the DNA to a ladder of -200-800 bp, and efficiency of shearing was verified by agarose gel electrophoresis. Chromatin was immunoprecipitated using 2 µg of specific antibodies or normal IgG. SYBR green quantitative PCR assays were performed for 40 cycles of: 94° C. for 15 seconds, 55° C. for 30 seconds, and 72° C. for 30 seconds. PCR products were analyzed on a 1.5% agarose gel to verify correct size of products and specificity of primer annealing. Oligonucleotide primer sequences are provided in Table 2.
- To search for potential FSHD therapeutic targets in vivo, the CRISPR/dCas9 system was used to test several candidate regions in or flanking the 4q35 D4Z4/DUX4 locus for the ability to modulate gene expression in the D4Z4 array. Polyadenylated DUX4-fl mRNA levels in FSHD1 myocytes were used as a read-out for gene expression which is specifically derived from the contracted 4q35 D4Z4 array. When targeted by small guide RNAs (sgRNAs), dCas9 transcriptional effector platforms are effective in modulating endogenous gene expression levels in mammalian cells. In this example, the SunTag system was used, which involves the dual activity of two constructs: (i) dCas9 fused to 10 copies of the GCN4 peptide and (ii) GCN4 antibody fused to the VP64 activator. The dCas9 fused directly to VP64 generally requires multiple, non-overlapping sgRNAs to achieve strong activation of gene expression. In contrast, the SunTag system allows recruitment of multiple VP64 domains to a single dCas9, resulting in robust gene activation with only a single sgRNA. Myogenic cells from an FSHD1 patient (17Abic), which express consistent and relatively high levels of DUX4-fl when terminally differentiated, were used in this example.
- Single guide RNAs (sgRNAs) targeting two candidate regions upstream of the D4Z4 repeat (
FIG. 2A ) were produced: the NDE (non-deleted element retained in FSHD patients) sequence and p13-E11, a region distinct in the genome that is used to identify D4Z4 arrays specific to chromosomes 4q35 and 10q26. Within D4Z4, sgRNAs targeting the promoter,exon 1, andexon 3 of DUX4 were produced. In addition to forming a macrosatellite repeat, each D4Z4 repeat unit also contains repetitive sequences, and part of theDUX4 exon 1 is duplicated in the NDE. which lies proximal to the array. Thus, three sgRNAs (#3-5) target both the NDE andDUX4 exon 1. In addition,sgRNA # 6targets DUX4 intron 2 as well as the DUX4 promoter. For each target region, four to five sgRNAs were tested for the ability to recruit dCas9-VP64-HA, as assessed by chromatin immunoprecipitation (ChIP) using HA antibodies. At least two sgRNAs for each region (p13-E11, DUX4 promoter,DUX4 exon 1/NDE, and DUX4 exon 3) demonstrated correct targeting of dCas9-VP64-HA (Table 1). - Primary myoblasts were transfected (infected) by four serial rounds of viral exposure with centrifugation. After the final round of infection, the cells were induced to differentiate and harvested 48 hours later for analysis of DUX4-fl expression by quantitative reverse transcriptase polymerase chain reaction (qRT-PCR). Expression of the SunTag system alone had no effect on DUX4-fl mRNA levels in FSHD myocytes (
FIG. 2B , lane 2). Likewise, recruitment of VP64 to the p13-E11 region or toexon 3 of DUX4 had little effect on DUX4-fl expression (FIG. 2B ,lanes 3. 4. and 11). In contrast to this, VP64 recruitment to the DUX4 promoter orexon 1/NDE yielded robust activation of DUX4-fl in FSHD mayocytes (FIG. 2B , lanes 5-10). Recruitment to the DUX4 promoter, directly upstream ofexon 1, strongly activated DUX4-fl. When guided by sgRNAs #3-5, the transcriptional effector is likely mediating its effects fromDUX4 exon 1, and for simplicity, we will refer to these sgRNAs as targetingDUX4 exon 1. Although targeting by single sgRNAs proved sufficient for transcriptional activation, the functional capacity of sgRNAs targeting the same region was variable (e.g., ~120-fold activation withsgRNA # 4 versus ~13-fold activation with sgRNA #5) (FIG. 2B ). It was observed that when dCas9 lacking a transcriptional effector domain was recruited toDUX4 exon 1. it did not activate DUX4-fl expression (FIG. 2B , lanes 12-13). - Reducing the aberrant expression of DUX4-fl in FSHD by returning the chromatin at the disease locus to a nonpathogenic, repressed state is a viable avenue of therapy. Whether DUX4-fl expression could be reduced in FSHD myocytes using a dCas9-KRAB repressor was examined. When guided by multiple sgRNAs, dCas9-KRAB has proven effective in reducing target gene expression in mammalian cells. Since dCas9-mediated recruitment of VP64 to the DUX4 promoter or
exon 1 strongly activated DUX4-fl expression, these regions were selected as candidates for therapeutic targeting with dCas9-KRAB. Four serial coinfections of FSHD myogenic cultures were carried out. Cells were infected with various combinations of lentiviral supernatants expressing either dCas9-KRAB or individual sgRNAs targeting the candidate regions. After the final round of infection, the cells were induced to differentiate and harvested ~40 hours laser for analysis of DUX4-fl expression by qRT-PCR. - Expression of the dCas9-KRAB repressor alone had little effect on DUX4-fl levels (
FIG. 3A , lane 2). Consistent with results observed using the SunTag activator system, targeting dCas9-KRAB to either the p13-E11 region orDUX4 exon 3 had no effect on DUX4-fl expression (FIG. 3A ,lanes 3, 8). In contrast to this, targeting dCas9-KRAB to the DUX4 promoter orexon 1 reduced expression of DUX4-fl to ~45% of endogenous levels in FSHD myocytes (FIG. 3A ,lanes 4, 6-7). Although dCas9 effectors often require targeting by multiple, non-overlapping sgRNAs to achieve significant transcriptional modulation, it was observed that in one case, a single sgRNA was effective in reducing DUX4 -fl expression (FIG. 3A , lane 4), and the combination of all six sgRNAs targeting these regions showed no enhanced effect (FIG. 3A , lane 7). - Previous studies have demonstrated that in some contexts, dCas9 can inhibit transcription through steric hindrance of target regions. To determine whether the repressive effects observed were due to an obstruction mechanism rather than KRAB-mediated repression, the effect of a dCas9 variant lacking an effector domain (e.g. KRAB) was tested. Recruitment of dCas9 alone to any of the target regions did not reduce levels of DUX4-fl (
FIG. 3A , lanes 9-13), demonstrating the importance of the KRAB domain for mediating DUX4-fl repression at the target regions. - In FSHD myogenic cultures, DUX4-FL expression is restricted to terminally differentiated myocytes. To rule out a nonspecific effect of dCas9-KRAB on muscle differentiation, levels of Myosin heavy chain (MyHC), a marker of terminal muscle differentiation, were assessed by qRT-PCR. Importantly, MyHC levels were equivalent in all cultures expressing dCas9-KRAB and sgRNAs (
FIG. 3B ), indicating that lower levels of DUX4-fl are not due to impairment of muscle differentiation. Expression levels of FRG1 and FRG2, two other FSHD candidate genes that lie proximal to the D4Z4 repeat, were also assayed. Although levels of FRG2 were variable, recruitment of the dCas9 repressor to any of the target regions did not reduce expression of either FRG1 or FRG2 mRNA (FIG. 3C ). - Expression of DUX4-FL in FSHD myocytes causes the aberrant upregulation of many downstream targets, including genes expressed in the germline and in early development. TRIM43, ZSCAN4, and MBD3L2 are downstream targets of DUX4-FL that were also found to be upregulated in the myogenic cultures used in this example. To determine whether dCas9-KRAB-mediated repression of DUX4-fl also results in repression of these DUX4-FL target genes, expression levels of TRIM43, ZSCAN4, and MBD3L2 were measured by qRT-PCR in the cells. It was observed that expression of these genes was not significantly altered by expressing the dCas9-KRAB repressor alone or by targeting the repressor to p13-E11 or to DUX4 exon 3 (
FIG. 4 .lanes 2. 3, and 8). However, as with DUX4-fl, targeting the KRAB repressor to the DUX4 promoter orexon 1 significantly reduced expression of all three DUX4-FL targets to ~35-60% of endogenous levels (FIG. 4 ,lanes 4, 6-7). Thus, targeting dCas9-KRAB to the promoter orexon 1 of DUX4 results in efficient repression of both DUX4-fl and its target genes in FSHD myocytes. - Next, the question of whether targeting a transcriptional effector to the DUX4 promoter or
exon 1 has any effect on the expression of several predicted off-target genes was addressed. Of the sgRNAs used in this example to decrease expression of DUX4-fl and its downstream targets, #3 and #6 have the fewest off-target matches in the human genome (Table 1). The expression levels of several genes at a range of distances from off-target matches tosgRNAs # 3 and #6 were examined in cells expressing the SunTag activator and either sgRNA. Since the binding specificity of an sgRNA is largely determined by the PAM-proximal sequence, genes in the vicinity of off-target matches to 9- or 12-bp seed sequences + NGG (PAM) were identified. ForsgRNA # 3, expression level of the histone demethylase Jumonji, which contains an off-target match (12-bp seed + PAM) inintron 7, was quantified. It was observed that expression of the untargeted SunTag system alone had a slight repressive effect on levels of Jumonji (FIG. 5 lane 2). However, targeting the activator withsgRNA # 3 did not alter these levels (FIG. 5 , lane 3). ForsgRNA # 6, expression levels of the transcription factor KLF14 and the E3 ubiquitin ligase UBR4, which lie 28 and 76kb downstream of off-target matches (9bp seed + PAM), were quantified. Neither gene showed altered expression in response to targeting the SunTag activator with this sgRNA (FIG. 5 , lane 4). These results are in stark contrast to the robust targeted activation of DUX4-ƒl (∼30-fold and ∼130-fold activation usingsgRNAs # 3 and 16, respectively:FIG. 2B ), and are consistent with the reports demonstrating limited off-target effects using dCas9 transcriptional effectors. - To determine whether changes in the D4Z4 chromatin structure could be detected, FSHD myogenic cultures were infected with lentiviral supernatants expressing dCas9-KRAB and sgRNAs targeting the DUX4 promoter or
exon 1, and cells were induced to differentiate, then fixed and harvested ~40 hours later for analysis by ChIP. Recruitment of the dCas9 repressor to the DUX4 promoter resulted in a trend toward increased levels of the KAPI/TRIM28 corepressor, which is recruited by the KRAB domain, as well as HP1α and HP1β, which are recruited by KAPI to heterochromatin (FIGS. 6A-6C , sgRNAs #6-8). These repressive changes were detectable across DUX4 as well as in the proximal p13-E11 region: levels of enrichment of ~2-3-fold were observed. Changes in overall levels of the repressive histone marks H3K9me3 and H3K27me3 were undetectable across the D4Z4 repeats, and targeting dCas9-KRAB to the DUX4 promoter resulted in only a slight decrease in the activating H3K27ac mark acrossDUX4 exon 1.intron 1, and p13-E11 (FIG. 6D , sgRNAs #6-8). - Recruitment of the dCas9 repressor to
DUX4 exon 1 increased levels of KAPI atDUX4 intron 1. but had little observable effect on levels of HPI or H3K27 acetylation across the gene (FIGS. 6A-6D . sgRNAs #3-5). By contrast, repressive changes (enrichment of KAPI and HP1α, and slightly reduced levels of H3K27 acetylation) were more readily detected at p13-E11, likely as a result of recruitment to the NDE (FIGS. 6A-6D . sgRNAs #3-5). There was also a trend toward slightly lower levels of elongating RNA Pol II at bothexon 1 of DUX4 and p13-E11 (FIG. 6E , sgRNAs #3-5). The observed results are consistent with a model in which recruitment of dCas9-KRAB to the DUX4 promoter andexon 1 increases chromatin repression at the contracted 4q locus, resulting in decreased expression of the pathogenic DUX4-ƒl transcript. - Repression of DUX4-ƒl in vivo was examined in a mouse model of FSHD. Mice were injected intramuscularly (IM) into Tibialis anterior (TA) muscle with AAV-dCas9KRAB and GFP-labeled DUX4 sgRNA. Relative expression level of DUX4-fl mRNA was measured and normalized to GAPDH.
FIG. 7 shows data indicating that recruitment of dCas9-KRAB by DUX4 sgRNA represses DUX4-fl expression in vivo. A 30% reduction in DUX4-fl expression level was observed in mice injected with DUX4 sgRNA and dCas9KRAB compared to control mice injected with dCas9KRAB alone. - AAV-compatible, catalytically active SpCas9was recruited to the FSHD locus in primary human myogenic cells by using
sgRNA targeting exon 3 of the DUX4 gene. Targeting of the Cas9 nuclease toexon 3 of DUX4 resulted in reduction of DUX4 expression as quantified by relative mRNA expression (FIG. 8 ). Decreased expression of DUX4 also resulted in reduced relative expression of DUX4 target genes, such as TRIM43 and ZSCAN4, but not the muscle-specific genes MyoG or MyoD (FIG. 8 ). -
TABLE 1 sgRNA sequences targeting the D4Z4/DUX4 region sgRNA (SEQ ID NO:) Target *19-nt sequence + PAM (NGG) Score** Enrich^ OT(12)# OT(19)## 1 P13-E11 TACCACAGACAGCCAACTGGGG 0.61 6.9 18 0 2 P13-E11 TTCACCCAGAACAGTAACTGGG 0.60 1.6 27 0 3 DUX4 E1 CACCCGGGCAAAAGCCGGGAGG 0.61 2.5 8 1 (Y) 4 DUX4 E1 CTGGAAGCACCCCTCAGCG AGG 0.85 2.4 9 3(14/18/Y) 5 DUX4 E1 CTGGAGGAGCTTTAGGACGCG G 0.65 2.2 14 6 (14/18/20/22/Y) 6 DUX4 prom CTCGCTCTGGTCTTCTACG TGG 0.72 2.0 4 0 7 DUX4 prom CCGTCCGTGAAATTCCGGC CGG 0.76 1.7 10 1 (20) 8 DUX4 prom TCGGACAGCACCCTCCCCGCG G 0.79 2.6 19 3 (3/14/Y) 9 DUX4 E3 CTCCCTTGCACGTCAGCCG GGG 0.84 3.4 7 2(14/18) 10 DUX4 E3 GAATTTCACGGAAGAACAAGGG 0.76 1.8 5 0 11 DUX4 E3 ATCTTCTATAGGATCCACAGGG 0.88 2.0 9 0 CpGs are underlined **sgRNA Designer score. ^Relative enrichment of dCas9-VP64-HA (Addgene plusmid #50918) at each target region measured by chromatin immunoprecipitation (ChIP) using HA antibodies normalized to mouse IgG. #Number of off-target ( non-Ch 4/10) matches to 12-nt seed sequence + NGG in human genomic database.“Number of off-target ( non-Ch 4/10) matches to 19-nt sequence + NGG in human genomic database (chromosomes in parentheses). - All off-target matches except those underlined are in D4Z4 homologous repeat sequences.
-
TABLE 2 Primer sequences Primer Name Sequence (5′-3′) SEQ ID NO: DUX4-fl- F GCTCTGCTGGAGGAGCTTTAGGA 12 DUX4-fl- R GCAGGTCTGCWGGTACCTGG 13 MyHC1-F TGGAGGCCAGGGTTCGTGAA 14 MyHC1-R ATTGTTCCTCCGCTTCTTCAGC 15 FRG1-F TCTACAGAGACGTAGGCTGTCA 16 FRG1-R CTTGAGCACGAGCTTGGTAG 17 FRG2-F GGGAAAACTGCAGGAAAA 18 FRG2-R CTGGACAGTTCCCTGCTGTGT 19 TRIM43- F ACCCATCACTGGACTGGTGT 20 TRIM43-R CACATCCTCAAAGAGCCTGA 21 ZSCAN4-F TGGAAATCAAGTGGCAAAAA 22 ZSCAN4- R CTGCATGTGGACGTGGAC 23 MBD3L2-F GCGTTCACCTCITITCCAAG 24 MBD3L2-R GCCATGTGGATTTCTCGTTT 25 Jumonji-F AAGAAAAAGCCTCGAAAGTG 26 Jumonji-R AGAGCACACTCCAGACAGAA 27 KLF14-F TGCAACGTGTATATCATCCT 28 KLF14-R ACACCAGAGTCCTTTGAGAC 29 UBR4-F GGAGTCTGTGGCAACTGTGGAGAGAATG 30 UBR4-R CCGGTCTTCTTCATTCTCAATGGGATCCACT 31 OT-F* GAATGTGGACACGGTAAAGA 32 OT-R** TAGGTTTGACTGOCAATGAC 33 p13-E11-F TGGGCATTTTCTCATTAGCC 34 p13-E11-R CTGGAGCAGAGATGACCACA 35 DUX4-exon1-F GACACCCTCGGACAGCAC 36 DUX4-exon1-R GTACGGGTTCCGCTCAAAG 37 DUX4-intron1-F CTCAGCGAGGAAGAATACCG 38 DUX4-intron1-R AGTCTCTCACCGGGCCTAGA 39 DUX4-exon3-F CTGACGTGCAAGGGAGCT 40 DUX4-exon3-R CAGGTITGCXTAGACAGCG 41 *OT-F: (intergenic region on Ch. 8, ref NC_018919.2) **OT-R: (intergenic region on Ch. 8, ref NC_018919.2) - SaCas9 Protein (SEQ ID NO: 42)
-
MAPKKKRKVGIHGVPAAKRNYILGLDIGITSVGYGIIDYETRDVIDAGVR LFKEANVENNEGRRSKRGARRLKRRRRHRIQRVKKLLFDYNLLTDHSELS GINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELST KEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLL KVQKAYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLM GHCTYFPEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQII ENVFKQKKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKD ITARKEIIENAELLDQIAKILTIYQSSEDIQEELTNLNSELTQEEIEQIS NLKGYTGTHNLSLKAINLILDELWHTNDNQIAIFNRLKLVPKKVDLSQQK EIPTTLVDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAREKNS KDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKC LYSLEAIPLEDLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEENSKKG NRTPFQYLSSSDSKISYETFKKHILNLAKGKGRISKTKKEYLLEERDINR FSVQKDFINRNLVDTRYATRGLMNLLRSYFRVNNLDVKVKSINGGFTSFL RRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFE EKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRELI NDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDP QTYQKLKLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYG NKLNAHLDITDDYPNSRNKVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVI KKENYYEVNSKCYEEAKKLKKISNQAEFIASFYNNDLIKINGELYRVIGV NNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTIASKTQSIKKYSTDI LGNLYEVKSKKHPQIIKKGKRPAATKKAGQAK - Sa-dCas9-KRAB (SEQ ID NO: 43)
-
MAPKKKRKVGIHGVPAAKRNYILGLAIGITSVGYGIIDYETRDVIDAGVR LFKEANVENNEGRRSKRGARRLKRRRRHRIQRVKKLLFDYNLLTDHSELS GINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELST KEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLL KVQKAYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLM GHCTYFPEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQII ENVFKQKKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKD ITARKEIIENAELLDQIAKILTIYQSSEDIQEELTNLNSELTQEEIEQIS NLKGYTGTHNLSLKAINLILDELWHTNDNQIAIFNRLKLVPKKVDLSQQK EIPTTLVDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAREKNS KDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKC LYSLEAIPLEDLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEEASKKG NRTPFQYLSSSDSKISYETFKKHILNLAKGKGRISKTKKEYLLEERDINR FSVQKDFINRNLVDTRYATRGLMNLLRSYFRVNNLDVKVKSINGGFTSFL RRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFE EKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRELI NDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDP QTYQKLKLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYG NKLNAHLDITDDYPNSRNKVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVI KKENYYEVNSKCYEEAKKLKKISNQAEFIASFYNNDLIKINGELYRVIGV NNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTIASKTQSIKKYSTDI LGNYEVKSKKHPQIIKKGKRPAATKKAGQAKKKKGSDAKSLTAWSRTLVT FKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLTKPDVILRLEKG EEP - Sp-dCas9-KRAB (SEQ ID NO: 44)
-
MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGA LLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR LEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKAD LRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENP INASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTP NFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAI LLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEI FFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLR KQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPY YVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDK NLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVD LLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKI IKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQ LKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDD SLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKV MGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHP VENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDD SIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNL TKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLI REVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKK YPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEI TLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEV QTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVE KGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPK YSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPE DNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADADANLDKVLSAYNKHR DKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLI HQSITGLYETRIDLSQLGGDGTGGPKKKRKVYPYDVPDYAGYPYDVPDYA GSYPYDVPDYAGSMDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQI VYRNVMLENYKNLVSLGYQLTKPDVILRLEKGEEP - Sa-dCas9 (SEQ ID NO: 45)
-
MAPKKKRKVGIHGVPAAKRNYILGLAIGITSVGYGIIDYETRDVIDAGVR LFKEANVENNEGRRSKRGARRLKRRRRHRIQRVKKLLFDYNLLTDHSELS GINPYEARVKGLSQKLSEEEFSAALLHLAKRRGVHNVNEVEEDTGNELST KEQISRNSKALEEKYVAELQLERLKKDGEVRGSINRFKTSDYVKEAKQLL KVQKAYHQLDQSFIDTYIDLLETRRTYYEGPGEGSPFGWKDIKEWYEMLM GHCTYFPEELRSVKYAYNADLYNALNDLNNLVITRDENEKLEYYEKFQII ENVFKQKKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEFTNLKVYHDIKD ITARKEIIENAELLDQIAKILTIYQSSEDIQEELTNLNSELTQEEIEQIS NLKGYTGTHNLSLKAINLILDELWHTNDNQIAIFNRLKLVPKKVDLSQQK EIPTTLVDDFILSPVVKRSFIQSIKVINAIIKKYGLPNDIIIELAREKNS KDAQKMINEMQKRNRQTNERIEEIIRTTGKENAKYLIEKIKLHDMQEGKC LYSLEAIPLEDLLNNPFNYEVDHIIPRSVSFDNSFNNKVLVKQEEASKKG NRTPFQYLSSSDSKISYETFKKHILNLAKGKGRISKTKKEYLLEERDINR FSVQKDFINRNLVDTRYATRGLMNLLRSYFRVNNLDVKVKSINGGFTSFL RRKWKFKKERNKGYKHHAEDALIIANADFIFKEWKKLDKAKKVMENQMFE EKQAESMPEIETEQEYKEIFITPHQIKHIKDFKDYKYSHRVDKKPNRELI NDTLYSTRKDDKGNTLIVNNLNGLYDKDNDKLKKLINKSPEKLLMYHHDP QTYQKLKLIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYG NKLNAHLDITDDYPNSRNKVVKLSLKPYRFDVYLDNGVYKFVTVKNLDVI KKENYYEVNSKCYEEAKKLKKISNQAEFIASFYNNDLIKINGELYRVIGV NNDLLNRIEVNMIDITYREYLENMNDKRPPRIIKTIASKTQSIKKYSTDI LGNLYEVKSKKHPQIIKKG
Claims (23)
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US18/065,255 US20230250407A1 (en) | 2016-09-23 | 2022-12-13 | Silencing of dux4 by recombinant gene editing complexes |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201662398801P | 2016-09-23 | 2016-09-23 | |
PCT/US2017/052919 WO2018057863A1 (en) | 2016-09-23 | 2017-09-22 | Silencing of dux4 by recombinant gene editing complexes |
US201916334826A | 2019-03-20 | 2019-03-20 | |
US18/065,255 US20230250407A1 (en) | 2016-09-23 | 2022-12-13 | Silencing of dux4 by recombinant gene editing complexes |
Related Parent Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2017/052919 Continuation WO2018057863A1 (en) | 2016-09-23 | 2017-09-22 | Silencing of dux4 by recombinant gene editing complexes |
US16/334,826 Continuation US11566237B2 (en) | 2016-09-23 | 2017-09-22 | Silencing of DUX4 by recombinant gene editing complexes |
Publications (1)
Publication Number | Publication Date |
---|---|
US20230250407A1 true US20230250407A1 (en) | 2023-08-10 |
Family
ID=61691092
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/334,826 Active 2038-09-07 US11566237B2 (en) | 2016-09-23 | 2017-09-22 | Silencing of DUX4 by recombinant gene editing complexes |
US18/065,255 Pending US20230250407A1 (en) | 2016-09-23 | 2022-12-13 | Silencing of dux4 by recombinant gene editing complexes |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/334,826 Active 2038-09-07 US11566237B2 (en) | 2016-09-23 | 2017-09-22 | Silencing of DUX4 by recombinant gene editing complexes |
Country Status (4)
Country | Link |
---|---|
US (2) | US11566237B2 (en) |
EP (1) | EP3515506B1 (en) |
CA (1) | CA3074723A1 (en) |
WO (1) | WO2018057863A1 (en) |
Families Citing this family (8)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP7231226B2 (en) * | 2016-11-07 | 2023-03-01 | ユニバーシティ オブ マサチューセッツ | Therapeutic targets for facioscapulohumeral muscular dystrophy |
WO2019051290A1 (en) * | 2017-09-07 | 2019-03-14 | The Children's Medical Center Corporation | Compositions and methods for treating facioscapulohumeral dystrophy |
WO2020142479A1 (en) * | 2018-12-31 | 2020-07-09 | Research Institute At Nationwide Children's Hospital | Dux4 rna silencing using rna targeting crispr-cas13b |
WO2021211325A1 (en) * | 2020-04-17 | 2021-10-21 | Board Of Regents Of The Nevada System Of Higher Education, On Behalf Of The University Of Nevada, Reno | Crispr-inhibition for facioscapulohumeral muscular dystrophy |
WO2022045366A1 (en) * | 2020-08-31 | 2022-03-03 | Modalis Therapeutics Corporation | Method for treating facioscapulohumeral muscular dystrophy (fshd) by targeting dux4 gene |
IL301187A (en) | 2020-09-11 | 2023-05-01 | Arrowhead Pharmaceuticals Inc | RNAi AGENTS FOR INHIBITING EXPRESSION OF DUX4, COMPOSITIONS THEREOF, AND METHODS OF USE |
CN113337506B (en) * | 2021-06-21 | 2023-01-03 | 珠海乐维再生医学科技有限公司 | CRISPR-mediated exosome for inhibiting scar formation as well as preparation method and application thereof |
WO2023018705A1 (en) | 2021-08-10 | 2023-02-16 | University Of Massachusetts | Compositions and methods for sirna treatment of muscular dystrophy |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20190127713A1 (en) * | 2016-04-13 | 2019-05-02 | Duke University | Crispr/cas9-based repressors for silencing gene targets in vivo and methods of use |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10865445B2 (en) * | 2010-08-18 | 2020-12-15 | Fred Hutchinson Cancer Research Center | Methods for alleviating facioscapulohumeral dystrophy (FSHD) by N siRNA molecule inhibiting the expression of DUX4-FL |
ES2648169T3 (en) * | 2011-07-25 | 2017-12-28 | Nationwide Children's Hospital, Inc. | Recombinant virus products and methods for inhibition of DUX4 expression |
PL3019619T3 (en) * | 2013-07-11 | 2022-01-10 | Modernatx, Inc. | Compositions comprising synthetic polynucleotides encoding crispr related proteins and synthetic sgrnas and methods of use |
-
2017
- 2017-09-22 US US16/334,826 patent/US11566237B2/en active Active
- 2017-09-22 CA CA3074723A patent/CA3074723A1/en active Pending
- 2017-09-22 WO PCT/US2017/052919 patent/WO2018057863A1/en unknown
- 2017-09-22 EP EP17853972.2A patent/EP3515506B1/en active Active
-
2022
- 2022-12-13 US US18/065,255 patent/US20230250407A1/en active Pending
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20190127713A1 (en) * | 2016-04-13 | 2019-05-02 | Duke University | Crispr/cas9-based repressors for silencing gene targets in vivo and methods of use |
Non-Patent Citations (1)
Title |
---|
Himeda et al. "CRISPR/dCas9-mediated transcriptional inhibition ameliorates the epigenetic dysregulation at D4Z4 and represses DUX4-fl in FSH muscular dystrophy." Molecular Therapy 24.3 (2016): 527-535 (Year: 2016) * |
Also Published As
Publication number | Publication date |
---|---|
CA3074723A1 (en) | 2018-03-29 |
EP3515506A1 (en) | 2019-07-31 |
EP3515506A4 (en) | 2020-04-29 |
US20200017842A1 (en) | 2020-01-16 |
EP3515506B1 (en) | 2023-09-13 |
US11566237B2 (en) | 2023-01-31 |
WO2018057863A1 (en) | 2018-03-29 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230250407A1 (en) | Silencing of dux4 by recombinant gene editing complexes | |
AU2017219605B2 (en) | Excision of retroviral nucleic acid sequences | |
CN106061510B (en) | Delivery, use and therapeutic applications of CRISPR-CAS systems and compositions for genome editing | |
US20170349894A1 (en) | Escorted and functionalized guides for crispr-cas systems | |
CN115175991A (en) | Engineered muscle targeting compositions | |
JP2019506156A (en) | Methods and compositions for RNA-induced treatment of HIV infection | |
US11963975B2 (en) | Therapeutic targets for facioscapulohumeral muscular dystrophy | |
EP4135778A1 (en) | Crispr-inhibition for facioscapulohumeral muscular dystrophy | |
US20240042025A1 (en) | Biallelic knockout of b2m | |
US20230383275A1 (en) | Sgrna targeting aqp1 rna, and vector and use thereof | |
JP2023527464A (en) | Biallelic k-gene knockout of SARM1 | |
US20240175035A1 (en) | Compositions and methods for treating hypercholesterolemia | |
WO2024064683A2 (en) | Biallelic knockout of ciita | |
WO2024064623A2 (en) | Biallelic knockout of cish | |
WO2024064613A2 (en) | Biallelic knockout of hla-e | |
WO2024064607A2 (en) | Biallelic knockout of tet2 | |
WO2024064606A2 (en) | Biallelic knockout of ctla4 | |
WO2024064633A2 (en) | Biallelic knockout of pdcd1 | |
WO2024064637A2 (en) | Biallelic knockout of faslg | |
WO2024097900A1 (en) | Compositions and methods for transcription factor 4 (tcf4) repeat expansion excision | |
WO2024020484A2 (en) | Biallelic knockout of angptl3 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: NATIONAL INSTITUTES OF HEALTH (NIH), U.S. DEPT. OF HEALTH AND HUMAN SERVICES (DHHS), U.S. GOVERNMENT, MARYLAND Free format text: CONFIRMATORY LICENSE;ASSIGNOR:UNIVERSITY OF MASSACHUSETTS CHAN MEDICAL SCHOOL;REEL/FRAME:062321/0748 Effective date: 20230104 |
|
AS | Assignment |
Owner name: UNIVERSITY OF MASSACHUSETTS, MASSACHUSETTS Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:JONES, PETER L.;HIMEDA, CHARIS L.;JONES, TAKAKO;REEL/FRAME:062970/0390 Effective date: 20171019 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: RESPONSE TO NON-FINAL OFFICE ACTION ENTERED AND FORWARDED TO EXAMINER |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |