WO2018075692A2 - Antibody constructs - Google Patents
Antibody constructs Download PDFInfo
- Publication number
- WO2018075692A2 WO2018075692A2 PCT/US2017/057268 US2017057268W WO2018075692A2 WO 2018075692 A2 WO2018075692 A2 WO 2018075692A2 US 2017057268 W US2017057268 W US 2017057268W WO 2018075692 A2 WO2018075692 A2 WO 2018075692A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- domain
- amino acid
- domains
- antigen
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/10—Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/24—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against cytokines, lymphokines or interferons
- C07K16/241—Tumor Necrosis Factors
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/51—Complete heavy chain or Fd fragment, i.e. VH + CH1
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/524—CH2 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/64—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising a combination of variable region and constant region components
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- Antibodies are an invaluable tool in the medical field.
- the importance of monoclonal antibodies, including their roles in scientific research and medical diagnostics, have been widely recognized for several decades.
- the full potential of antibodies, especially their successful use as therapeutic agents, has only more recently been
- An area of active research in the antibody therapeutic field is the design and use of multispecific antibodies, i.e. a single antibody engineered to recognize multiple targets. These antibodies offer the promise of greater therapeutic control. For example, a need exists to improve target specificity in order to reduce the off-target effects associated with many antibody therapies, particularly in the case of antibody based immunotherapies.
- multispecific antibodies offer new therapeutic strategies, such as synergistic targeting of multiple cell receptors, especially in an immunotherapy context.
- the architecture of these multivalent binding molecules drives high fidelity pairing of the cognate polypeptide chains that together form the antigen binding sites of monospecific, bispecific, trispecific, and tetraspecific constructs.
- the binding molecules are readily expressed using conventional antibody expression systems, including in vitro cell-free translation systems and mammalian transient transfection systems, and can be purified in a single-step with CHI affinity resins.
- High fidelity assembly, high level in vitro expression, and the ability to purify expression products in a single step make these constructs well-suited to high throughput screening of variable region libraries. These constructs also demonstrate long-term stability, making them well suited as multispecific therapeutic agents.
- binding molecules comprise a first and a second polypeptide chain, wherein: (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C- terminus, in a A-B-D-E orientation, and wherein domain A has a VL amino acid sequence, domain B has a CH3 amino acid sequence, domain D has a CH2 amino acid sequence, domain E has a constant region domain amino acid sequence; (b) the second polypeptide chain comprises a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a F-G orientation, and wherein domain F has a VH amino acid sequence and domain G has a CH3 amino acid sequence; and (c) the first and the second polypeptides are associated through an interaction between the A and the F domains and an interaction between the B and the G domains to form the
- the binding molecule further comprises a third and a fourth polypeptide chain, wherein: (a) the third polypeptide chain comprises a domain H, a domain I, a domain J, and a domain K, wherein the domains are arranged, from N-terminus to C- terminus, in a H-I-J-K orientation, and wherein domain H has a variable region domain amino acid sequence, domain I has a constant region domain amino acid sequence, domain J has a CH2 amino acid sequence, and K has a constant region domain amino acid sequence; (b) the fourth polypeptide chain comprises a domain L and a domain M, wherein the domains are arranged, from N-terminus to C-terminus, in a L-M orientation, and wherein domain L has a variable region domain amino acid sequence and domain M has a constant region amino acid sequence; (c) the third and the fourth polypeptides are associated through an interaction between the H and the L domains and an interaction between the I and the M domains; and (a)
- amino acid sequences of the B and the G domains are identical, wherein the sequence is an endogenous CH3 sequence.
- the amino acid sequences of the B and the G domains are different and separately comprise respectively orthogonal modifications in an endogenous CH3 sequence, wherein the B domain interacts with the G domain, and wherein neither the B domain nor the G domain significantly interacts with a CH3 domain lacking the orthogonal modification.
- the orthogonal modifications comprise mutations that generate engineered disulfide bridges between domain B and G.
- the mutations that generate engineered disulfide bridges are a S354C mutation in one of the B domain and G domain, and a 349C in the other domain.
- the orthogonal modifications comprise knob-in-hole mutations.
- the knob-in hole mutations are a T366W mutation in one of the B domain and G domain, and a T366S, L368A, and aY407V mutation in the other domain.
- the orthogonal modifications comprise charge-pair mutations.
- the charge-pair mutations are a T366K mutation in one of the B domain and G domain, and a L351D mutation in the other domain.
- the domain E has a CH3 amino acid sequence.
- the amino acid sequences of the E and K domains are identical, wherein the sequence is an endogenous CH3 sequence.
- the amino acid sequences of the E and K domains are different.
- the different sequences separately comprise respectively orthogonal modifications in an endogenous CH3 sequence, wherein the E domain interacts with the K domain, and wherein neither the E domain nor the K domain significantly interacts with a CH3 domain lacking the orthogonal modification.
- the orthogonal modifications comprise mutations that generate engineered disulfide bridges between domain E and K.
- the mutations that generate engineered disulfide bridges are a S354C mutation in one of the E domain and K domain, and a 349C in the other domain.
- the orthogonal modifications in the E and K domains comprise knob-in-hole mutations.
- knob-in hole mutations are a T366W mutation in one of the E domain or K domain and a T366S, L368A, and aY407V mutation in the other domain.
- the orthogonal modifications comprise charge-pair mutations.
- the charge-pair mutations are a T366K mutation in one of the E domain or K domain and a corresponding L351D mutation in the other domain.
- the amino acid sequences of the E domain and the K domain are endogenous sequences of two different antibody domains, the domains selected to have a specific interaction that promotes the specific association between the first and the third polypeptides.
- the two different amino acid sequences are a CHI sequence and a CL sequence.
- the domain I has a CL sequence and the domain M has a CHI sequence.
- domain H has a VL sequence and domain L has a VH sequence.
- domain H has a VL amino acid sequence
- domain I has a CL amino acid sequence
- domain K has a CH3 amino acid sequence
- domain L has a VH amino acid sequence
- domain M has a CHI amino acid sequence
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen
- the binding molecule further comprises a fifth polypeptide chain, wherein: (a) the first polypeptide chain further comprises a domain N and a domain O, wherein the domains are arranged, from N-terminus to C-terminus, in a N-O-A-B-D-E orientation, and wherein domain N has a VL amino acid sequence, domain O has a CH3 amino acid sequence; (b) the binding molecule further comprises a fifth polypeptide chain, comprising: a domain P and a domain Q, wherein the domains are arranged, from N-terminus to C-terminus, in a P-Q orientation, and wherein domain P has a VH amino acid sequence and domain Q has a CH3 amino acid sequence; and (c) the first and the fifth polypeptides are associated through an interaction between the N and the P domains and an interaction between the O and the Q domains to form the binding molecule.
- the amino acid sequences of domain N and domain A are identical, the amino acid sequences of domain H is different from domains N and A, the amino acid sequences of domain O and domain B are identical, the amino acid sequences of domain I is different from domains O and B, the amino acid sequences of domain P and domain F are identical, the amino acid sequences of domain L is different from domains P and F, the amino acid sequences of domain Q and domain G are identical, the amino acid sequences of domain M is different from domains Q and G; and (b) wherein the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the domain N and domain P form a third antigen binding site specific for the first antigen.
- the amino acid sequences of domain N, domain A, and domain H are different, the amino acid sequences of domain O, domain B, and domain I are different, the amino acid sequences of domain P, domain F, and domain L are different, and the amino acid sequences of domain Q, domain G, and domain M are different; and (b) the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the domain N and domain P form a third antigen binding site specific for a third antigen.
- the binding molecule further comprises a sixth polypeptide chain, wherein: (a) the third polypeptide chain further comprises a domain R and a domain S, wherein the domains are arranged, from N-terminus to C-terminus, in a R-S-H-I-J-K orientation, and wherein domain R has a VL amino acid sequence and domain S has a constant domain amino acid sequence; (b) the binding molecule further comprises a sixth polypeptide chain, comprising: a domain T and a domain U, wherein the domains are arranged, from N-terminus to C-terminus, in a T-U orientation, and wherein domain T has a VH amino acid sequence and domain U has a constant domain amino acid sequence; and (c) the third and the sixth polypeptides are associated through an interaction between the R and the T domains and an interaction between the S and the U domains to form the binding molecule.
- the amino acid sequences of domain R and domain A are identical, the amino acid sequences of domain H is different from domain R and A, the amino acid sequences of domain S and domain B are identical, the amino acid sequences of domain I is different from domain S and B, the amino acid sequences of domain T and domain F are identical, the amino acid sequences of domain L is different from domain T and F, the amino acid sequences of domain U and domain G are identical, the amino acid sequences of domain M is different from domain U and G and (b) the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the domain R and domain T form a third antigen binding site specific for the first antigen.
- the amino acid sequences of domain R and domain H are identical, the amino acid sequences of domain A is different from domain R and H, the amino acid sequences of domain S and domain I are identical, the amino acid sequences of domain B is different from domain S and I, the amino acid sequences of domain T and domain L are identical, the amino acid sequences of domain F is different from domain T and L, the amino acid sequences of domain U and domain M are identical, the amino acid sequences of domain G is different from domain U and M and (b) the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the domain R and domain T form a third antigen binding site specific for the second antigen.
- the amino acid sequences of domain R, domain A, and domain H are different, the amino acid sequences of domain S, domain B, and domain I are different, the amino acid sequences of domain T, domain F, and domain L are different, and the amino acid sequences of domain U, domain G, and domain M are different; and (b) the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the domain R and domain T form a third antigen binding site specific for a third antigen.
- the binding molecule further comprises a fifth and a sixth polypeptide chain, wherein: (a) the first polypeptide chain further comprises a domain N and a domain O, wherein the domains are arranged, from N-terminus to C-terminus, in a N-O-A- B-D-E orientation; (b) the third polypeptide chain further comprises a domain R and a domain S, wherein the domains are arranged, from N-terminus to C-terminus, in a R-S-H-I-J- K orientation; (c) the binding molecule further comprises a fifth and a sixth polypeptide chain, wherein: the fifth polypeptide chain comprises a domain P and a domain Q, wherein the domains are arranged, from N-terminus to C-terminus, in a P-Q orientation, and the sixth polypeptide chain comprises a domain T and a domain U, wherein the domains are arranged, from N-terminus to C-terminus, in a T-
- the amino acid sequences of domain N and domain A are identical, the amino acid sequences of domain H and domain R are identical, the amino acid sequences of domain O and domain B are identical, the amino acid sequences of domain I and domain S are identical, the amino acid sequences of domain P and domain F are identical, the amino acid sequences of domain L and domain T are identical, the amino acid sequences of domain Q and domain G are identical, the amino acid sequences of domain M and domain U are identical; and (b) wherein the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the domain N and domain P form a second antigen binding site specific for the first antigen, the interaction between the H domain and the L domain form a third antigen binding site specific for a second antigen, and the interaction between the R domain and the T domain form a fourth antigen binding site specific for the second antigen.
- the binding molecule claim 36, wherein: (a) the amino acid sequences of domain H and domain A are identical, the amino acid sequences of domain N and domain R are identical, the amino acid sequences of domain I and domain B are identical, the amino acid sequences of domain O and domain S are identical, the amino acid sequences of domain L and domain F are identical, the amino acid sequences of domain P and domain T are identical, the amino acid sequences of domain M and domain G are identical, the amino acid sequences of domain Q and domain U are identical; and (b) wherein the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the domain N and domain P form a second antigen binding site specific for a second antigen, the interaction between the H domain and the L domain form a third antigen binding site specific for the first antigen, and the interaction between the R domain and the T domain form a fourth antigen binding site specific for the second antigen.
- sequence that forms a junction between the A domain and the B domain is IKRTPREP or IKRTVREP.
- the sequence that forms a junction between the F domain and the G domain is SSASPREP.
- At least one CH3 amino acid sequence has a C-terminal tripeptide insertion connecting the CH3 amino acid sequence and a hinge amino acid sequence, wherein the tripeptide insertion is selected from the group consisting of PGK, KSC, and GEC.
- the sequences are human sequences.
- at least one CH3 amino acid sequence is an IgG sequence.
- the IgG sequences are IgGl sequences.
- at least one CH3 amino acid sequence has one or more isoallotype mutations.
- the isoallotype mutations are D356E and L358M.
- the CL amino acid sequence is a Ckappa sequence.
- a binding molecule comprising a first, second, third, and fourth polypeptide chain, wherein: (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a VL amino acid sequence, domain B has a CH3 amino acid sequence, domain D has a CH2 amino acid sequence, and domain E has a constant region domain amino acid sequence; (b) the second polypeptide chain comprises a domain F and a domain G, wherein the domains are arranged, from N- terminus to C-terminus, in a F-G orientation, and wherein domain F has a VH amino acid sequence and domain G has a CH3 amino acid sequence; (c) the third polypeptide chain comprises a domain H, a domain I, a domain J, and a domain K, wherein the domains are
- the domain E has a CH3 amino acid sequence
- domain H has a VL amino acid sequence
- domain I has a CL amino acid sequence
- domain K has a CH3 amino acid sequence
- domain L has a VH amino acid sequence
- domain M has a CHI amino acid sequence.
- compositions comprising any of the binding molecules disclosed or described herein, and a pharmaceutically acceptable carrier.
- Also disclosed herein is a method of treatment, comprising administering to a subject in need of treatment the pharmaceutical composition comprising any of the binding molecules disclosed or described herein and any of the pharmaceutically acceptable carriers disclosed or described herein.
- FIG. 1 shows an alignment of the CH3-CH3 IgGl dimer pair with CH1-C L .
- the quaternary structures align with an RMSD of -1.6 A 2 .
- FIG. 2 presents schematic architectures, with respective naming conventions, for various binding molecules (also called antibody constructs) described herein.
- FIG. 3 presents a higher resolution schematic of polypeptide chains and their domains, with respective naming conventions, for the bivalent lxl antibody constructs described herein.
- FIG. 4 shows the architecture of an exemplary bivalent, monospecific, construct.
- FIG. 5 shows data from a biolayer interferometry (BLI) experiment, described in Example 1, in which a bivalent monospecific binding molecule having the architecture illustrated in FIG. 4 [polypeptide 1 : VL-CH3(Knob)-CH2-CH3 / polypeptide 2: VH- CH3(Hole)] was assayed.
- the antigen binding site was specific for TNFa.
- the BLI response from binding molecule immobilization and TNFa binding to the immobilized construct demonstrates robust, specific, bivalent binding to the antigen.
- the data are consistent with a molecule having a high percentage of intended pairing of polypeptide 1 and polypeptide 2.
- FIG. 6 illustrates features of an exemplary bivalent lxl bispecific binding molecule, "BCl”.
- FIG. 7A shows size exclusion chromatography (SEC) analysis of "BCl", demonstrating that a single-step CHI affinity purification step (CaptureSelectTM CHI affinity resin) yields a single, monodisperse peak via gel filtration in which >98% is unaggregated bivalent protein.
- FIG. 7B shows comparative literature data of SEC analysis of a CrossMab bivalent antibody construct [data from Schaefer et al. (Proc Natl Acad Sci USA. 2011 Jul 5; 108(27): 11187-92)].
- FIG. 8A is a cation exchange chromatography elution profile of "BC1" following one-step purification using the Capture SelectTM CHI affinity resin, showing a single tight peak.
- FIG. 8B is a cation exchange chromatography elution profile of "BO” following purification using standard Protein A purification.
- FIG. 9 shows nonreducing SDS-PAGE gels of "BC1" at various stages of
- FIGS. 10A and 10B compare SDS-PAGE gels of "BC1" after single-step CHI- affinity purification under both non-reducing and reducing conditions (FIG. 10A) with SDS- PAGE gels of a CrossMab bispecific antibody under non-reducing and reducing conditions as published in the referenced literature (FIG. 10B).
- FIGS. 11A and 11B show mass spec analysis of "BC1", demonstrating two distinct heavy chains (FIG. 11 A) and two distinct light chains (FIG. 1 IB) under reducing conditions.
- FIG. 12 presents a mass spectrometry analysis of purified "BC1" under non-reducing conditions, confirming the absence of incomplete pairing after purification.
- FIG. 13 presents accelerated stability testing data demonstrating stability of "BC1" over 8 weeks at 40°C, compared to two IgG control antibodies.
- FIG. 14 illustrates features of an exemplary bivalent lxl bispecific binding molecule, "BC6", further described in Example 3.
- FIG. 15A presents size exclusion chromatography (SEC) analysis of "BC6" following one-step purification using the Capture SelectTM CHI affinity resin, demonstrating that the single step CHI affinity purification yields a single monodisperse peak and the absence of non-covalent aggregates.
- FIG. 15B shows a SDS-PAGE gel of "BC6" under non- reducing conditions.
- FIG. 16 illustrates features of an exemplary bivalent bispecific binding molecule, "BC28", further described in Example 4.
- FIG. 17 shows SDS-PAGE analysis under non-reducing conditions following single- step CHI affinity purification of "BC28", "BC29”, “BC30”, “BC31”, and "BC32".
- FIG. 18 shows SEC analysis of "BC28" and "BC30", each following one-step purification using the Capture SelectTM CHI affinity resin.
- FIG. 19 illustrates features of an exemplary bivalent bispecific binding molecule, "BC44", further described in Example 5.
- FIGS. 20A and 20B show size exclusion chromatography data of two bivalent binding molecules, "BCl 5" and “BCl 6", respectively, under accelerated stability testing conditions. "BCl 5" and “BCl 6" have different variable region-CH3 junctions.
- FIG. 21 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for the trivalent 2x1 antibody constructs described herein.
- FIG. 22 illustrates features of an exemplary trivalent 2x1 bispecific binding molecule
- FIG. 23 shows non-reducing SDS-PAGE of "BCl” and "BC 1-2x1" protein expressed using the ThermoFisher Expi293 transient transfection system, at various stages of purification.
- FIG. 24 compares the avidity of the bivalent lxl construct "BCl” to the avidity of the trivalent 2x1 construct "BCl -2x1" using an Octet (Pall ForteBio) biolayer interferometry analysis.
- FIG. 25 illustrates salient features of a trivalent 2x1 construct, "TBI 11.”
- FIG. 26 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for the trivalent 1x2 antibody constructs described herein.
- FIG. 27 illustrates features of an exemplary trivalent 1x2 construct "CTLA4-4 x Nivo x CTLA4-4", further described in Example 10.
- FIG. 28 is a SDS-PAGE gel in which the lanes showing the trivalent 1x2 construct "CTLA4-4 x Nivo x CTLA4-4" construct under non-reducing ("-DTT”) and reducing ("+DTT”) conditions have been boxed.
- FIG. 29 shows a comparison of antigen binding between two antibodies: bivalent lxl construct "CTLA4-4 x OX40-8" and the trivalent 1x2 construct "CTLA4-4 x Nivo x CTLA4- 4."
- CTLA4-4 x OX40-8 binds to CTLA4 monovalently
- CTLA4-4 x Nivo x CTLA4-4" binds to CTLA4 bivalently.
- FIG. 30 illustrates features of an exemplary trivalent 1x2 trispecific construct, "BC28-lxlxla", further described in Example 11.
- FIG. 31 shows size exclusion chromatography of "BC28-lxlxla” following transient expression and single step CHI affinity resin purification, demonstrating a single well- defined peak.
- FIG. 32 shows SDS-PAGE results with bivalent and trivalent constructs, each after transient expression and one-step purification using the CaptureSelectTM CHI affinity resin, under non-reducing and reducing conditions, as further described in Example 12.
- FIGS. 33A-33C show Octet binding analyses to 3 antigens: PDl, Antigen "A", and CTLA4.
- FIG. 33A shows binding of "BCl” to PDl and Antigen "A”
- FIG. 33B shows binding of a bivalent bispecific construct "CTLA4-4 x OX40- 8" to CTLA4, Antigen "A", and PDl
- FIG. 33C shows binding of trivalent trispecific "BC28-lxlxla” to PDl, Antigen "A", and CTLA4.
- FIG. 34 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for certain tetravalent 2x2 constructs described herein.
- FIG. 35 illustrates certain salient features of the exemplary tetravalent 2x2 construct, "BC22-2x2" further described in Example 14.
- FIG. 36 is a non-reducing SDS-PAGE gel comparing the 2x2 tetravalent "BC22-2x2" construct to a 1x2 trivalent construct "BC12-lx2" and a 2x1 trivalent construct "BC21-2xl" at different stages of purification.
- FIG. 37 provides architecture for an exemplary tetravalent 2x2 construct.
- FIG. 38 presents a schematic of polypeptide chains and their domains, with respective naming conventions, for certain tetravalent constructs described herein.
- FIG. 39 provides exemplary architecture of a bispecific tetravalent construct.
- FIG. 40 provides exemplary architecture for a trispecific tetravalent construct utilizing a common light chain strategy.
- FIG. 41 shows bispecific antigen engagement by the tetravalent construct
- FIG. 42 provides flow cytometry analysis of B-Body binding to cell-surface antigen.
- Cross-hatched signal indicates cells without antigen; dotted signal indicates transiently transfected cells with surface antigen.
- FIG. 43 provides exemplary architecture of a trivalent construct.
- FIG. 44 provides exemplary architecture of a trivalent construct.
- FIG. 45 shows SDS-PAGE results with bivalent and trivalent constructs, each after transient expression and one-step purification using the CaptureSelectTM CHI affinity resin, under non-reducing and reducing conditions, as further described in Example 17.
- FIG. 46 shows differences in the thermal transitions for "BC24jv”, “BC26jv”, and
- antigen binding site is meant a region of a binding molecule that specifically recognizes or binds to a given antigen or epitope.
- B-Body means any of the binding molecule constructs described herein.
- the terms “treat” or “treatment” refer to both therapeutic treatment and prophylactic or preventative measures, wherein the object is to prevent or slow down (lessen) an undesired physiological change or disorder, such as the progression of multiple sclerosis, arthritis, or cancer.
- Beneficial or desired clinical results include, but are not limited to, alleviation of symptoms, diminishment of extent of disease, stabilized (i.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, and remission (whether partial or total), whether detectable or undetectable.
- Treatment can also mean prolonging survival as compared to expected survival if not receiving treatment.
- Those in need of treatment include those already with the condition or disorder as well as those prone to have the condition or disorder or those in which the condition or disorder is to be prevented.
- subject or “individual” or “animal” or “patient” or “mammal,” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired.
- Mammalian subjects include humans, domestic animals, farm animals, and zoo, sports, or pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows, and so on.
- sufficient amount means an amount sufficient to produce a desired effect, e.g., an amount sufficient to modulate protein aggregation in a cell.
- therapeutically effective amount is an amount that is effective to ameliorate a symptom of a disease.
- a therapeutically effective amount can be a
- prophylaxis can be considered therapy. 6.2. Other interpretational conventions
- antibody constant region residue numbering is according to the Eu index as described at
- endogenous sequence or “native sequence” is meant any sequence, including both nucleic acid and amino acid sequences, which originates from an organism, tissue, or cell and has not been artificially modified or mutated.
- Ranges provided herein are understood to be shorthand for all of the values within the range, inclusive of the recited endpoints.
- a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, and 50.
- binding molecules are provided.
- the binding molecules comprise a first and a second polypeptide chain, wherein: (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and wherein domain A has a VL amino acid sequence, domain B has a CH3 amino acid sequence, domain D has a CH2 amino acid sequence, and domain E has a constant region domain amino acid sequence; (b) the second polypeptide chain comprises a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a F-G orientation, and wherein domain F has a VH amino acid sequence and domain G has a CH3 amino acid sequence; and (c) the first and the second polypeptides are associated through an interaction between the A and the F domains and an interaction between the B
- the binding molecules further comprise a third and a fourth polypeptide chain, wherein: (a) the third polypeptide chain comprises a domain H, a domain I, a domain J, and a domain K, wherein the domains are arranged, from N-terminus to C-terminus, in a H-I-J-K orientation, and wherein domain H has a variable region domain amino acid sequence, domain I has a constant region domain amino acid sequence, domain J has a CH2 amino acid sequence, and K has a constant region domain amino acid sequence; (b) the fourth polypeptide chain comprises a domain L and a domain M, wherein the domains are arranged, from N-terminus to C-terminus, in a L-M orientation, and wherein domain L has a variable region domain amino acid sequence and domain M has a constant region domain amino acid sequence; (c) the third and the fourth polypeptides are associated through an interaction between the H and the L domains and an
- the first and third polypeptide chains are identical in sequence to one another, and the second and fourth polypeptide are identical in sequence to one another.
- association of the first and third polypeptide chains through interactions between domains E & K form a bivalent, monospecific, antibody construct, such as that exemplified in Example 1 below.
- first and third polypeptide chains are non-identical in sequence to one another, and the second and fourth polypeptide are non-identical in sequence to one another.
- association of the first and third polypeptide chains through interactions between domains E & K is capable of forming a bivalent, bispecific, antibody construct.
- domain A has a VL amino acid sequence.
- the VL amino acid sequences useful in the binding molecules described herein are antibody light chain variable domain sequences. In a typical arrangement in both natural antibodies and the antibody constructs described herein, a specific VL amino acid sequence associates with a specific VH amino acid sequence to form an antigen-binding site.
- the VL amino acid sequences are mammalian sequences, including human sequences, synthesized sequences, or combinations of human, non-human mammalian, mammalian, and/or synthesized sequences, as described in further detail below in Sections 6.3.1.1 and 6.3.1.2.
- VL amino acid sequences are mutated sequences of naturally occurring sequences.
- the VL amino acid sequences are lambda ( ⁇ ) light chain variable domain sequences.
- the VL amino acid sequences are kappa ( ⁇ ) light chain variable domain sequences.
- the VL amino acid sequences are kappa ( ⁇ ) light chain variable domain sequences.
- domain A is connected to the N-terminus of domain B.
- domain A has a VL amino acid sequence that is mutated at its C-terminus at the junction between domain A and domain B, as described in greater detail below in Section 6.3.19.1 and in Example 6.
- VL amino acid sequences comprise highly variable sequences termed
- CDRs complementarity determining regions
- the CDRs are mammalian sequences, including, but not limited to, mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the CDRs are human sequences.
- the CDRs are naturally occurring sequences.
- the CDRs are naturally occurring sequences that have been mutated to alter the binding affinity of the antigen -binding site for a particular antigen or epitope.
- the naturally occurring CDRs have been mutated in an in vivo host through affinity maturation and somatic hypermutation.
- the CDRs have been mutated in vitro through methods including, but not limited to, PCR-mutagenesis and chemical mutagenesis.
- the CDRs are synthesized sequences including, but not limited to, CDRs obtained from random sequence CDR libraries and rationally designed CDR libraries. 6.3.1.2. Framework Regions and CDR Grafting
- the VL amino acid sequences comprise "framework region” (FR) sequences.
- FRs are generally conserved sequence regions that act as a scaffold for interspersed CDRs (see Section 6.3.1.1.), typically in a FR 1 -CDR 1 -FR2-CDR2-FR3 -CDR3 -FR4 arrangement (from N-terminus to C-terminus).
- the FRs are mammalian sequences, including, but not limited to mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the FRs are human sequences.
- the FRs are naturally occurring sequences.
- the FRs are synthesized sequences including, but not limited, rationally designed sequences.
- the FRs and the CDRs are both from the same naturally occurring variable domain sequence.
- the FRs and the CDRs are from different variable domain sequences, wherein the CDRs are grafted onto the FR scaffold with the CDRs providing specificity for a particular antigen.
- the grafted CDRs are all derived from the same naturally occurring variable domain sequence.
- the grafted CDRs are derived from different variable domain sequences.
- the grafted CDRs are synthesized sequences including, but not limited to, CDRs obtained from random sequence CDR libraries and rationally designed CDR libraries.
- the grafted CDRs and the FRs are from the same species. In certain embodiments, the grafted CDRs and the FRs are from different species. In a preferred grafted CDR embodiment, an antibody is "humanized", wherein the grafted CDRs are non-human mammalian sequences including, but not limited to, mouse, rat, hamster, rabbit, camel, donkey, and goat sequences, and the FRs are human sequences.
- domain B has a CH3 amino acid sequence.
- CH3 amino acid sequences, as described herein, are sequences of the C-terminal domain of an antibody heavy chain.
- the CH3 sequences are mammalian sequences, including, but not limited to, mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences. In a preferred embodiment, the CH3 sequences are human sequences. In certain embodiments, the CH3 sequences are from an IgAl, IgA2, IgD, IgE, IgM, IgGl, IgG2, IgG3, IgG4 isotype or CH4 sequences from an IgE or IgM isotype. In a preferred embodiment, the CH3 sequences are from an IgGl isotype.
- the CH3 sequences are endogenous sequences.
- the CH3 sequence is UniProt accession number P01857 amino acids 224-330.
- a CH3 sequence is a segment of an endogenous CH3 sequence.
- a CH3 sequence has an endogenous CH3 sequence that lacks the N- terminal amino acids G224 and Q225.
- a CH3 sequence has an endogenous CH3 sequence that lacks the C-terminal amino acids P328, G329, and K330.
- a CH3 sequence has an endogenous CH3 sequence that lacks both the N-terminal amino acids G224 and Q225 and the C-terminal amino acids P328, G329, and K330.
- a binding molecule has multiple domains that have CH3 sequences, wherein a CH3 sequence can refer to both a full endogenous CH3 sequence as well as a CH3 sequence that lacks N-terminal amino acids, C-terminal amino acids, or both.
- the CH3 sequences are endogenous sequences that have one or more mutations.
- the mutations are one or more orthogonal mutations that are introduced into an endogenous CH3 sequence to guide specific pairing of specific CH3 sequences, as described in more detail below in Sections 6.3.14.1-6.3.14.3.
- the CH3 sequences are engineered to reduce immunogenicity of the antibody by replacing specific amino acids of one allotype with those of another allotype and referred to herein as isoallotype mutations, as described in more detail in Stickler et al. ⁇ Genes Immun. 2011 Apr; 12(3): 213-221), which is herein incorporated by reference for all that it teaches.
- specific amino acids of the Glml allotype are replaced.
- isoallotype mutations D356E and L358M are made in the CH3 sequence.
- domain B has a human IgGl CH3 amino acid sequence with the following mutational changes: P343 V; Y349C; and a tripeptide insertion, 445P, 446G, 447K.
- domain B has a human IgGl CH3 sequence with the following mutational changes: T366K; and a tripeptide insertion, 445K, 446S, 447C.
- domain B has a human IgGl CH3 sequence with the following mutational changes: Y349C and a tripeptide insertion, 445P, 446G, 447K.
- domain B has a human IgGl CH3 sequence with a 447C mutation incorporated into an otherwise endogenous CH3 sequence.
- the N-terminus of domain B is connected to the C-terminus of domain A.
- domain B has a CH3 amino acid sequence that is mutated at its N-terminus at the junction between domain A and domain B, as described in greater detail below in Section 6.3.19.1 and Example 6.
- domain B In the binding molecules, the C-terminus of domain B is connected to the N-terminus of domain D.
- domain B has a CH3 amino acid sequence that is extended at the C-terminus at the junction between domain B and domain D, as described in greater detail below in Section 6.3.19.3.
- domain D has a CH2 amino acid sequence.
- CH2 amino acid sequences as described herein, are CH2 amino acid sequences of the third domain of a native antibody heavy chain, with reference from the N-terminus to C-terminus.
- the CH2 sequences are mammalian sequences, including but not limited to mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the CH2 sequences are human sequences.
- the CH2 sequences are from a IgAl, IgA2, IgD, IgE, IgGl, IgG2, IgG3, IgG4, or IgM isotype.
- the CH2 sequences are from an IgGl isotype.
- the CH2 sequences are endogenous sequences.
- the sequence is UniProt accession number P01857 amino acids 111-223.
- the CH2 sequences have a N-terminal hinge region peptide that connects the N-terminal variable domain-constant domain segment to the CH2 domain, as discussed in more detail below in Section 6.3.19.3.
- domain D is connected to the C-terminus of domain B.
- domain B has a CH3 amino acid sequence that is extended at the C-terminus at the junction between domain D and domain B, as described in greater detail below in Section 6.3.19.3.
- domain D is connected to the N-terminus of domain E.
- domain D is connected to the N-terminus of domain E that has a CHI amino acid sequence or CL amino acid sequence, as described in further detail below in Section 6.3.19.5. 6.3.4.
- Domain E Constant Region
- domain E has a constant region domain amino acid sequence.
- Constant region domain amino acid sequences as described herein, are sequences of a constant region domain of an antibody.
- the constant region sequences are mammalian sequences, including, but not limited to, mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences. In a preferred embodiment, the constant region sequences are human sequences. In certain embodiments, the constant region sequences are from an antibody light chain. In particular embodiments, the constant region sequences are from a lambda or kappa light chain. In certain embodiments, the constant region sequences are from an antibody heavy chain. In particular embodiments, the constant region sequences are an antibody heavy chain sequence that is an IgAl, IgA2, IgD, IgE, IgGl, IgG2, IgG3, IgG4, or IgM isotype. In a preferred embodiment, the constant region sequences are from an IgGl isotype. In certain embodiments, the constant region sequence is a CH3 sequence. CH3 sequences are described in greater detail above in Section 6.3.2.
- the constant region sequence has been mutated to include one or more orthogonal mutations.
- domain E has a constant region sequence that is a CH3 sequence comprising knob-hole (synonymously, "knob-in- hole,” “KIH”) orthogonal mutations, as described in greater detail below in Section 6.3.14.2, and either a S354C or a Y349C mutation that forms an engineered disulfide bridge with a CH3 domain containing an orthogonal mutation, as described in in greater detail below in Section 6.3.14.1.
- the knob-hole orthogonal mutation is a T366W mutation.
- the constant region domain sequence is a CHI sequence.
- CHI sequences are described in greater detail below in Section 6.3.4.1. In certain embodiments,
- the N-terminus of the CHI domain is connected to the C-terminus of a CH2 domain, as described in greater detail below in 6.3.19.5.
- the constant region sequence is a CL sequence.
- CL sequences are described in greater detail below in Section 6.3.4.2.
- the N-terminus of the CL domain is connected to the C-terminus of a CH2 domain, as described in greater detail below in 6.3.19.5. 6.3.4.1.
- CHI Domains are described in greater detail below in Section 6.3.4.2.
- CHI amino acid sequences are sequences of the second domain of an antibody heavy chain, with reference from the N-terminus to C-terminus.
- the CHI sequences are endogenous sequences.
- the CHI sequences are mammalian sequences, including, but not limited to mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- the CHI sequences are human sequences.
- the CHI sequences are from an IgAl, IgA2, IgD, IgE, IgGl, IgG2, IgG3, IgG4, or IgM isotype. In a preferred
- the CHI sequences are from an IgGl isotype.
- the CHI sequence is UniProt accession number P01857 amino acids 1-98.
- CL amino acid sequences useful in the binding molecules described herein are antibody light chain constant domain sequences.
- the CL sequences are endogenous sequences.
- the CL sequences are mammalian sequences, including, but not limited to mouse, rat, hamster, rabbit, camel, donkey, goat, and human sequences.
- CL sequences are human sequences.
- the CL amino acid sequences are lambda ( ⁇ ) light chain constant domain sequences.
- the CL amino acid sequences are human lambda light chain constant domain sequences.
- the lambda ( ⁇ ) light chain sequence is UniProt accession number P0CG04.
- the CL amino acid sequences are kappa ( ⁇ ) light chain constant domain sequences.
- the CL amino acid sequences are human kappa ( ⁇ ) light chain constant domain sequences.
- the kappa light chain sequence is UniProt accession number P01834.
- domain F has a VH amino acid sequence.
- the VH amino acid sequences in the binding molecules described herein are antibody heavy chain variable domain sequences. In a typical antibody arrangement in both nature and in the binding molecules described herein, a specific VH amino acid sequence associates with a specific VL amino acid sequence to form an antigen-binding site.
- VH amino acid sequences are mammalian sequences, including human sequences, synthesized sequences, or combinations of non-human mammalian, mammalian, and/or synthesized sequences, as described in further detail above in Sections 6.3.1.1 and 6.3.1.2. In various embodiments, VH amino acid sequences are mutated sequences of naturally occurring sequences.
- domain G has a CH3 amino acid sequence. CH3 sequences are described in greater detail above in Section 6.3.2.
- domain G has a human IgGl CH3 sequence with the following mutational changes: S354C; and a tripeptide insertion, 445P, 446G, 447K.
- domain G has a human IgGl CH3 sequence with the following mutational changes: S354C; and 445P, 446G, 447K tripeptide insertion.
- domain G has a human IgGl CH3 sequence with the following changes:
- domain H has a variable region domain amino acid sequence.
- Variable region domain amino acid sequences as described herein, are variable region domain amino acid sequences of an antibody including VL and VH antibody domain sequences. VL and VH sequences are described in greater detail above in Sections 6.3.1. and 6.3.5., respectively.
- domain H has a VL antibody domain sequence.
- domain I has a constant region domain amino acid sequence. Constant region domain amino acid sequences are described in greater detail above in Section 6.3.4. In a preferred embodiment, domain I has a constant region sequence that is a CL from a kappa light chain, as discussed in more detail in Section 6.3.4.2.
- domain J has a CH2 amino acid sequence.
- CH2 amino acid sequences are described in greater detail above in Section 6.3.3.
- the CH2 amino acid sequence has a N-terminal hinge region that connects domain J to domain I, as described in more detail below in Section 6.3.19.4.
- domain J is connected to the N-terminus of domain K.
- domain J is connected to the N-terminus of domain K that has a CHI amino acid sequence or CL amino acid sequence, as described in further detail below in Section 6.3.19.5. 6.3.10.
- Domain K Constant Region
- domain K has a constant region domain amino acid sequence. Constant region domain amino acid sequences are described in greater detail above in Section 6.3.4.
- domain K has a constant region sequence that is a CH3 sequence comprising knob-hole orthogonal mutations, as described in greater detail below in Section 6.3.14.2; isoallotype mutations, as described in more detail above in 6.3.2.; and either a S354C or a Y349C mutation that forms an engineered disulfide bridge with a CH3 domain containing an orthogonal mutation, as described in in greater detail below in Section 6.3.14.1.
- the knob-hole orthogonal mutations combined with isoallotype mutations are the following mutational changes: D356E, L358M, T366S, L368A, and Y407V.
- domain L has a variable region domain amino acid sequence.
- Variable region domain amino acid sequences as described herein, are variable region domain amino acid sequences of an antibody including VL and VH antibody domain sequences. VL and VH sequences are described in greater detail above in Sections 6.3. Land 6.3.5., respectively.
- domain L has a VH antibody domain sequence.
- domain M has a constant region domain amino acid sequence. Constant region domain amino acid sequences are described in greater detail above in Section 6.3.4. In a preferred embodiment, domain M has a constant region sequence that is a CHI from an IgGl isotype, as discussed in more detail in Section 6.3.4.1.
- a Domain A VL amino acid sequence and a Domain F VH amino acid sequence are associated and form an antigen binding site (ABS).
- the A:F antigen binding site (ABS) is capable of specifically binding an epitope of an antigen. Antigen binding by an ABS is described in greater detail below in Section 6.3.13.1.
- the ABS formed by domains A and F is identical in sequence to one or more other ABSs within the binding molecule and therefore has the same recognition specificity as the one or more other sequence-identical ABSs within the binding molecule.
- the A:F ABS is non-identical in sequence to one or more other ABSs within the binding molecule.
- the A:F ABS has a recognition specificity different from that of one or more other sequence-non-identical ABSs in the binding molecule.
- the A:F ABS recognizes a different antigen from that recognized by at least one other sequence-non-identical ABS in the binding molecule.
- the A:F ABS recognizes a different epitope of an antigen that is also recognized by at least one other sequence-non-identical ABS in the binding molecule.
- the ABS formed by domains A and F recognizes an epitope of antigen, wherein one or more other ABSs within the binding molecule recognizes the same antigen but not the same epitope.
- ABS and the binding molecule comprising such ABS, is said to "recognize” the epitope (or more generally, the antigen) to which the ABS specifically binds, and the epitope (or more generally, the antigen) is said to be the "recognition specificity” or "binding specificity” of the ABS.
- ABS is said to bind to its specific antigen or epitope with a particular affinity.
- affinity refers to the strength of interaction of non-covalent intermolecular forces between one molecule and another.
- the affinity i.e. the strength of the interaction, can be expressed as a dissociation equilibrium constant (K D ), wherein a lower K D value refers to a stronger interaction between molecules.
- KD values of antibody constructs are measured by methods well known in the art including, but not limited to, bio-layer interferometry (e.g. Octet/FORTEBIO ® ), surface plasmon resonance (SPR) technology (e.g. Biacore ® ), and cell binding assays.
- affinities are dissociation equilibrium constants measured by bio-layer interferometry using Octet/FORTEBIO ® .
- Specific binding refers to an affinity between an ABS and its cognate antigen or epitope in which the K D value is below 10 "6 M, 10 "7 M, 10 "8 M, 10 "9 M, or 10- 10 M.
- ABSs in a binding molecule as described herein defines the "valency" of the binding molecule.
- a binding molecule having a single ABS is “monovalent”.
- a binding molecule having a plurality of ABSs is said to be
- ABSs multivalent binding molecule having two ABSs
- a multivalent binding molecule having three ABSs is “trivalent.”
- a multivalent binding molecule having four ABSs is “tetravalent.” [0146] In various multivalent embodiments, all of the plurality of ABSs have the same recognition specificity. As schematized in FIG. 2, such a binding molecule is a
- binding molecules are multivalent and “multispecific”. In multivalent embodiments in which the ABSs collectively have two recognition specificities, the binding molecule is “bispecific.” In multivalent embodiments in which the ABSs collectively have three recognition specificities, the binding molecule is "trispecific.”
- the binding molecule is "multiparatopic.”
- Multivalent embodiments in which the ABSs collectively recognize two epitopes on the same antigen are "biparatopic.”
- multivalency of the binding molecule improves the avidity of the binding molecule for a specific target.
- “avidity” refers to the overall strength of interaction between two or more molecules, e.g. a multivalent binding molecule for a specific target, wherein the avidity is the cumulative strength of interaction provided by the affinities of multiple ABSs. Avidity can be measured by the same methods as those used to determine affinity, as described above.
- the avidity of a binding molecule for a specific target is such that the interaction is a specific binding interaction, wherein the avidity between two molecules has a KD value below 10 "6 M, 10 "7 M, 10 "8 M, 10 "9 M, or 10 "10 M.
- the avidity of a binding molecule for a specific target has a KD value such that the interaction is a specific binding interaction, wherein the one or more affinities of individual ABSs do not have has a KD value that qualifies as specifically binding their respective antigens or epitopes on their own.
- the avidity is the cumulative strength of interaction provided by the affinities of multiple ABSs for separate antigens on a shared specific target or complex, such as separate antigens found on an individual cell.
- the avidity is the cumulative strength of interaction provided by the affinities of multiple ABSs for separate epitopes on a shared individual antigen.
- a domain B CH3 amino acid sequence and a domain G CH3 amino acid sequence are associated. CH3 sequences are described in greater detail above in Section 6.3.2. [0150] In various embodiments, the amino acid sequences of the B and the G domains are identical. In certain of these embodiments, the sequence is an endogenous CH3 sequence.
- amino acid sequences of the B and the G domains are different, and separately comprise respectively orthogonal modifications in an
- orthogonal modifications or synonymously “orthogonal mutations” as described herein are one or more engineered mutations in an amino acid sequence of an antibody domain that increase the affinity of binding of a first domain having orthogonal modification for a second domain having a complementary orthogonal modification.
- the orthogonal modifications decrease the affinity of a domain having the orthogonal modifications for a domain lacking the complementary orthogonal modifications.
- orthogonal modifications are mutations in an endogenous antibody domain sequence.
- orthogonal modifications are modifications of the N-terminus or C-terminus of an endogenous antibody domain sequence including, but not limited to, amino acid additions or deletions.
- orthogonal modifications include, but are not limited to, engineered disulfide bridges, knob-in-hole mutations, and charge-pair mutations, as described in greater detail below in Sections 6.3.14.1-6.3.14.3.
- orthogonal modifications include a combination of orthogonal modifications selected from, but not limited to, engineered disulfide bridges, knob-in-hole mutations, and charge-pair mutations.
- the orthogonal modifications can be combined with amino acid substitutions that reduce immunogenicity, such as isoallotype mutations, as described in greater detail above in Section 6.3.2.
- the orthogonal modifications comprise mutations that generate engineered disulfide bridges between a first and a second domain.
- engineered disulfide bridges are mutations that provide non-endogenous cysteine amino acids in two or more domains such that a non-native disulfide bond forms when the two or more domains associate.
- Engineered disulfide bridges are described in greater detail in Merchant et al. ⁇ Nature Biotech (1998) 16:677-681), the entirety of which is hereby incorporated by reference for all it teaches.
- engineered disulfide bridges improve orthogonal association between specific domains.
- the mutations that generate engineered disulfide bridges are a K392C mutation in one of a first or second CH3 domains, and a D399C in the other CH3 domain.
- the mutations that generate engineered disulfide bridges are a S354C mutation in one of a first or second CH3 domains, and a Y349C in the other CH3 domain.
- the mutations that generate engineered disulfide bridges are a 447C mutation in both the first and second CH3 domains that are provided by extension of the C-terminus of a CH3 domain incorporating a KSC tripeptide sequence.
- orthogonal modifications comprise knob-hole
- knob-hole mutations are mutations that change the steric features of a first domain's surface such that the first domain will preferentially associate with a second domain having complementary steric mutations relative to association with domains without the complementary steric mutations. Knob-hole mutations are described in greater detail in U.S. Pat. No. 5,821,333 and U.S. Pat. No.
- knob-hole mutations are combined with engineered disulfide bridges, as described in greater detail in Merchant et al. ⁇ Nature Biotech (1998) 16:677-681)), incorporated herein by reference in its entirety.
- knob-hole mutations, isoallotype mutations, and engineered disulfide mutations are combined.
- the knob-in-hole mutations are a T366Y mutation in a first domain, and a Y407T mutation in a second domain.
- the knob-in-hole mutations are a F405A in a first domain, and a T394W in a second domain.
- the knob-in-hole mutations are a T366Y mutation and a F405A in a first domain, and a T394W and a Y407T in a second domain.
- the knob- in-hole mutations are a T366W mutation in a first domain, and a Y407A in a second domain.
- the combined knob-in-hole mutations and engineered disulfide mutations are a S354C and T366W mutations in a first domain, and a Y349C, T366S, L368A, and aY407V mutation in a second domain.
- the combined knob-in-hole mutations, isoallotype mutations, and engineered disulfide mutations are a S354C and T366W mutations in a first domain, and a Y349C, D356E, L358M, T366S, L368A, and aY407V mutation in a second domain. 6.3.14.3. Orthogonal Charge-pair Mutations
- orthogonal modifications are charge-pair mutations.
- charge-pair mutations are mutations that affect the charge of an amino acid in a domain's surface such that the domain will preferentially associate with a second domain having complementary charge-pair mutations relative to association with domains without the complementary charge-pair mutations.
- charge-pair mutations improve orthogonal association between specific domains. Charge-pair mutations are described in greater detail in U.S. Pat. No. 8,592,562, U.S. Pat. No. 9,248,182, and U.S. Pat. No. 9,358,286, each of which is incorporated by reference herein for all they teach.
- charge-pair mutations improve stability between specific domains.
- the charge-pair mutations are a T366K mutation in a first domain, and a L351D mutation in the other domain.
- the E domain has a CH3 amino acid sequence.
- the K domain has a CH3 amino acid sequence.
- amino acid sequences of the E and K domains are identical, wherein the sequence is an endogenous CH3 sequence.
- the sequences of the E and K domains are different.
- the different sequences separately comprise respectively orthogonal modifications in an endogenous CH3 sequence, wherein the E domain interacts with the K domain, and wherein neither the E domain nor the K domain significantly interacts with a CH3 domain lacking the orthogonal modification.
- the orthogonal modifications include, but are not limited to, engineered disulfide bridges, knob-in-hole mutations, and charge-pair mutations, as described in greater detail above in sections 6.3.14.1-6.3.14.3.
- orthogonal modifications include a combination of orthogonal modifications selected from, but not limited to, engineered disulfide bridges, knob-in-hole mutations, and charge-pair mutations.
- the orthogonal modifications can be combined with amino acid substitutions that reduce immunogenicity, such as isoallotype mutations.
- the amino acid sequences of the E domain and the K domain are endogenous sequences of two different antibody domains, the domains selected to have a specific interaction that promotes the specific association between the first and the third polypeptides.
- the two different amino acid sequences are a CHI sequence and a CL sequence.
- CHI sequences and CL sequences are described in greater detail above in Sections 6.3.4.1 and 6.3.4.2, respectively.
- Use of CHI and CL sequences at the C-terminus of a heavy chain to promote specific heavy chain association is described in U.S. Pat. No. 8,242,247, the entirety of which is hereby incorporated by reference for all it teaches.
- the CHI sequence and the CL sequences are both endogenous sequences.
- the CHI sequence and the CL sequences separately comprise respectively orthogonal modifications in endogenous CHI and CL sequences.
- the orthogonal modifications in endogenous CHI and CL sequences are an engineered disulfide bridge selected from engineered cysteines at position 138 of the CHI sequence and position 116 of the CL sequence, at position 128 of the CHI sequence and position 119 of the CL sequence, or at position 129 of the CHI sequence and position 210 of the CL sequence, as numbered and discussed in more detail in U.S. Pat. No. 8,053,562 and U.S. Pat. No. 9,527,927, each incorporated herein by reference in its entirety.
- the engineered cysteines are at position 128 of the CHI sequence and position 118 of the CL Kappa sequence, as numbered by the Eu index.
- domain I has a CL sequence and domain M has a CHI sequence.
- domain H has a VL sequence and domain L has a VH sequence.
- domain H has a VL amino acid sequence
- domain I has a CL amino acid sequence
- domain L has a VH amino acid sequence
- domain M has a CHI amino acid sequence.
- domain H has a VL amino acid sequence
- domain I has a CL amino acid sequence
- domain L has a VH amino acid sequence
- domain M has a CHI amino acid sequence
- domain K has a CH3 amino acid sequence.
- the amino acid sequences of the I domain and the M domain separately comprise respectively orthogonal modifications in an endogenous sequence, wherein the I domain interacts with the M domain, and wherein neither the I domain nor the M domain significantly interacts with a domain lacking the orthogonal modification.
- the orthogonal mutations in the I domain are in a CL sequence and the orthogonal mutations in the M domain are in CHI sequence. Orthogonal mutations are described in more detail above in Sections 6.3.14.1-6.3.14.3.
- the orthogonal mutations in the CL sequence and the CHI sequence are charge-pair mutations.
- the charge-pair mutations are a Fl 18S, Fl 18A or Fl 18V mutation in the CL sequence with a corresponding A141L in the CHI sequence, or a T129R mutation in the CL sequence with a corresponding K147D in the CHI sequence, as numbered by the Eu index and described in greater detail in Bonisch et al.
- the charge-pair mutations are a N138K mutation in the CL sequence with a corresponding G166D in the CHI sequence, or a N138D mutation in the CL sequence with a corresponding G166K in the CHI sequence, as numbered by the Eu index.
- the orthogonal mutations in the CL sequence and the CHI sequence generate an engineered disulfide bridge.
- the mutations that provide non-endogenous cysteine amino acids are a Fl 18C mutation in the CL sequence with a corresponding A141C in the CHI sequence, or a Fl 18C mutation in the CL sequence with a corresponding L128C in the CHI sequence, or a S162C mutations in the CL sequence with a corresponding P171C mutation in the CHI sequence, as numbered by the Eu index.
- the amino acid sequences of the H domain and the L domain separately comprise respectively orthogonal modifications in an endogenous sequence, wherein the H domain interacts with the L domain, and wherein neither the H domain nor the L domain significantly interacts with a domain lacking the orthogonal modification.
- the orthogonal mutations in the H domain are in a VL sequence and the orthogonal mutations in the L domain are in VH sequence.
- the orthogonal mutations are charge-pair mutations at the VH/VL interface.
- the charge-pair mutations at the VH/VL interface are a Q39E in VH with a corresponding Q38K in VL, or a Q39K in VH with a corresponding Q38E in VL, as described in greater detail in Igawa et al. (Protein Eng. Des. Sel, 2010, vol. 23, 667-677), herein incorporated by reference for all it teaches.
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for the first antigen.
- the binding molecules have three antigen binding sites and are therefore termed "trivalent.”
- the binding molecules further comprise a fifth polypeptide chain, wherein (a) the first polypeptide chain further comprises a domain N and a domain O, wherein the domains are arranged, from N-terminus to C-terminus, in a N-O-A-B-D-E orientation, and wherein domain N has a VL amino acid sequence, domain O has a CH3 amino acid sequence; (b) the binding molecule further comprises a fifth polypeptide chain, comprising: a domain P and a domain Q, wherein the domains are arranged, from N-terminus to C-terminus, in a P-Q orientation, and wherein domain P has a VH amino acid sequence and domain Q has a CH3 amino acid sequence; and (c) the first and the fifth polypeptides are associated through an interaction between the N and the P domains and an interaction between the O and the Q domains to form the binding molecule.
- these trivalent embodiments are termed
- the binding molecules further comprise a sixth polypeptide chain, wherein (a) the third polypeptide chain further comprises a domain R and a domain S, wherein the domains are arranged, from N- terminus to C-terminus, in a R-S-H-I-J-K orientation, and wherein domain R has a VL amino acid sequence and domain S has a constant domain amino acid sequence; (b) the binding molecule further comprises a sixth polypeptide chain, comprising: a domain T and a domain U, wherein the domains are arranged, from N-terminus to C-terminus, in a T-U orientation, and wherein domain T has a VH amino acid sequence and domain U has a constant domain amino acid sequence; and (c) the third and the sixth polypeptides are associated through an interaction between the R and the T domains and an interaction between the S and the U domains to form the binding molecule.
- these tripeptide chain comprising: a domain T and a domain U, wherein the domains are arranged, from
- the domain O is connected to domain A through a peptide linker.
- the domain S is connected to domain H through a peptide linker.
- the peptide linker connecting either domain O to domain A or connecting domain S to domain H is a 6 amino acid GSGSGS peptide sequence, as described in more detail in Section 6.3.19.6. 6.3.17.1. Trivalent 2x1 Bispecific Constructs [2(A-A)xl(B)]
- the amino acid sequences of domain N and domain A are identical, the amino acid sequences of domain H is different from domains N and A, the amino acid sequences of domain O and domain B are identical, the amino acid sequences of domain I is different from domains O and B, the amino acid sequences of domain P and domain F are identical, the amino acid sequences of domain L is different from domains P and F, the amino acid sequences of domain Q and domain G are identical, the amino acid sequences of domain M is different from domains Q and G; and the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the domain N and domain P form a third antigen binding site specific for the first antigen.
- the amino acid sequences of domain N and domain H are identical, the amino acid sequences of domain A is different from domains N and H, the amino acid sequences of domain O and domain I are identical, the amino acid sequences of domain B is different from domains O and I, the amino acid sequences of domain P and domain L are identical, the amino acid sequences of domain F is different from domains P and L, the amino acid sequences of domain Q and domain M are identical, the amino acid sequences of domain G is different from domains Q and M; and the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the domain N and domain P form a third antigen binding site specific for the second antigen.
- the amino acid sequences of domain N, domain A, and domain H are different, the amino acid sequences of domain O, domain B, and domain I are different, the amino acid sequences of domain P, domain F, and domain L are different, and the amino acid sequences of domain Q, domain G, and domain M are different; and the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the domain N and domain P form a third antigen binding site specific for a third antigen.
- domain O has a constant region sequence that is a CL from a kappa light chain and domain Q has a constant region sequence that is a CHI from an IgGl isotype, as discussed in more detail in Sections 6.3.4.1 and 6.3.4.2.
- domain Q has a constant region sequence that is a CHI from an IgGl isotype, as discussed in more detail in Sections 6.3.4.1 and 6.3.4.2.
- domain O and domain Q have CH3 sequences such that they specifically associate with each other, as discussed in more detail above in Section 6.3.14.
- the amino acid sequences of domain N, domain A, and domain H are identical
- the amino acid sequences of domain O and domain B are identical
- the amino acid sequences of domain P, domain F, and domain L are identical
- the amino acid sequences of domain Q and domain G are identical
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for the first antigen
- the domain N and domain P form a third antigen binding site specific for the first antigen.
- the amino acid sequences of domain N, domain A, and domain H are identical, the amino acid sequences of domain O, domain B, and domain I are identical, the amino acid sequences of domain P, domain F, and domain L are identical, and the amino acid sequences of domain Q, domain G, and domain Mare identical; and the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for the first antigen, and the domain N and domain P form a third antigen binding site specific for the first antigen.
- the amino acid sequences of domain R and domain A are identical
- the amino acid sequences of domain H is different from domain R and A
- the amino acid sequences of domain S and domain B are identical
- the amino acid sequences of domain I is different from domain S and B
- the amino acid sequences of domain T and domain F are identical
- the amino acid sequences of domain L is different from domain T and F
- the amino acid sequences of domain U and domain G are identical
- the amino acid sequences of domain M is different from domain U and G and the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen
- the domain R and domain T form a third antigen binding site specific for the first antigen.
- the amino acid sequences of domain R and domain H are identical, the amino acid sequences of domain A is different from domain R and H, the amino acid sequences of domain S and domain I are identical, the amino acid sequences of domain B is different from domain S and I, the amino acid sequences of domain T and domain L are identical, the amino acid sequences of domain F is different from domain T and L, the amino acid sequences of domain U and domain M are identical, the amino acid sequences of domain G is different from domain U and M and the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the domain R and domain T form a third antigen binding site specific for the second antigen.
- the amino acid sequences of domain R, domain A, and domain H are different, the amino acid sequences of domain S, domain B, and domain I are different, the amino acid sequences of domain T, domain F, and domain L are different, and the amino acid sequences of domain U, domain G, and domain M are different; and the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen, and the domain R and domain T form a third antigen binding site specific for a third antigen.
- domain S has a constant region sequence that is a CL from a kappa light chain and domain U has a constant region sequence that is a CHI from an IgGl isotype, as discussed in more detail in Sections 6.3.4.1 and 6.3.4.2.
- domain U has a constant region sequence that is a CHI from an IgGl isotype, as discussed in more detail in Sections 6.3.4.1 and 6.3.4.2.
- domain S and domain U have CH3 sequences such that they specifically associate with each other, as discussed in more detail above in Section 6.3.14.
- the amino acid sequences of domain R, domain A, and domain H are identical
- the amino acid sequences of domain S and domain B are identical
- the amino acid sequences of domain T, domain F, and domain L are identical
- the amino acid sequences of domain U and domain G are identical
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for the first antigen
- the domain R and domain T form a third antigen binding site specific for the first antigen.
- the binding molecules have 4 antigen binding sites and are therefore termed "tetravalent.”
- the binding molecules further comprise a fifth and a sixth polypeptide chain, wherein (a) the first polypeptide chain further comprises a domain N and a domain O, wherein the domains are arranged, from N- terminus to C-terminus, in a N-O-A-B-D-E orientation; (b) the third polypeptide chain further comprises a domain R and a domain S, wherein the domains are arranged, from N-terminus to C-terminus, in a R-S-H-I-J-K orientation; (c) the binding molecule further comprises a fifth and a sixth polypeptide chain, wherein the fifth polypeptide chain comprises a domain P and a domain Q, wherein the domains are arranged, from N-terminus to C-terminus, in a P-Q orientation, and the sixth polypeptide chain comprises a domain T and a domain U, wherein the domains are arranged, from N-terminus to C
- the domain O is connected to domain A through a peptide linker and the domain S is connected to domain H through a peptide linker.
- the peptide linker connecting domain O to domain A and connecting domain S to domain H is a 6 amino acid GSGSGS peptide sequence, as described in more detail in Section 6.3.19.6.
- the amino acid sequences of domain N and domain A are identical, the amino acid sequences of domain H and domain R are identical, the amino acid sequences of domain O and domain B are identical, the amino acid sequences of domain I and domain S are identical, the amino acid sequences of domain P and domain F are identical, the amino acid sequences of domain L and domain T are identical, the amino acid sequences of domain Q and domain G are identical, the amino acid sequences of domain M and domain U are identical; and wherein the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the domain N and domain P form a second antigen binding site specific for the first antigen, the interaction between the H domain and the L domain form a third antigen binding site specific for a second antigen, and the interaction between the R domain and the T domain form a fourth antigen binding site specific for the second antigen.
- the amino acid sequences of domain H and domain A are identical, the amino acid sequences of domain N and domain R are identical, the amino acid sequences of domain I and domain B are identical, the amino acid sequences of domain O and domain S are identical, the amino acid sequences of domain L and domain F are identical, the amino acid sequences of domain P and domain T are identical, the amino acid sequences of domain M and domain G are identical, the amino acid sequences of domain Q and domain U are identical; and wherein the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the domain N and domain P form a second antigen binding site specific for a second antigen, the interaction between the H domain and the L domain form a third antigen binding site specific for the first antigen, and the interaction between the R domain and the T domain form a fourth antigen binding site specific for the second antigen.
- the amino acid sequences of domain N, domain A, domain H and domain R are identical, the amino acid sequences of domain O and domain B are identical, the amino acid sequences of domain I and domain S are identical, the amino acid sequences of domain P, domain F, domain L, and domain T are identical, the amino acid sequences of domain Q and domain G are identical, the amino acid sequences of domain M and domain U are identical; and wherein the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the domain N and domain P form a second antigen binding site specific for the first antigen, the interaction between the H domain and the L domain form a third antigen binding site specific for the first antigen, and the interaction between the R domain and the T domain form a fourth antigen binding site specific for the first antigen.
- the amino acid sequences of domain N, domain A, domain H and domain R are identical, the amino acid sequences of domain I and domain B are identical, the amino acid sequences of domain O and domain S are identical, the amino acid sequences of domain P, domain F, domain L, and domain T are identical, the amino acid sequences of domain M and domain G are identical, the amino acid sequences of domain Q and domain U are identical; and wherein the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen, the domain N and domain P form a second antigen binding site specific for the first antigen, the interaction between the H domain and the L domain form a third antigen binding site specific for the first antigen, and the interaction between the R domain and the T domain form a fourth antigen binding site specific for the first antigen.
- the amino acid sequence that forms a junction between the C-terminus of a VL domain and the N-terminus of a CH3 domain is an engineered sequence.
- one or more amino acids are deleted or added in the C- terminus of the VL domain.
- the junction connecting the C-terminus of a VL domain and the N-terminus of a CH3 domain is one of the sequences described in Table 2 below in Section 6.12.6.
- Al 11 is deleted in the C- terminus of the VL domain.
- one or more amino acids are deleted or added in the N-terminus of the CH3 domain.
- P343 is deleted in the N-terminus of the CH3 domain.
- P343 and R344 are deleted in the N-terminus of the CH3 domain.
- one or more amino acids are deleted or added to both the C-terminus of the VL domain and the N-terminus of the CH3 domain.
- Al 11 is deleted in the C-terminus of the VL domain and P343 is deleted in the N-terminus of the CH3 domain.
- Al 11 and VI 10 are deleted in the C-terminus of the VL domain.
- Al 11 and VI 10 are deleted in the C-terminus of the VL domain and the N-terminus of the CH3 domain has a P343 V mutation.
- the amino acid sequence that forms a junction between the C-terminus of a VH domain and the N-terminus of a CH3 domain is an engineered sequence.
- one or more amino acids are deleted or added in the C- terminus of the VH domain.
- the junction connecting the C-terminus of a VH domain and the N-terminus of the CH3 domain is one of the sequences described in Table 3 below in Section 6.12.6.
- K177 and Gi l 8 are deleted in the C-terminus of the VH domain.
- one or more amino acids are deleted or added in the N-terminus of the CH3 domain.
- P343 is deleted in the N-terminus of the CH3 domain.
- P343 and R344 are deleted in the N-terminus of the CH3 domain.
- P343, R344, and E345 are deleted in the N-terminus of the CH3 domain.
- one or more amino acids are deleted or added to both the C-terminus of the VH domain and the N- terminus of the CH3 domain.
- T166, K177, and Gl 18 are deleted in the C-terminus of the VH domain.
- the N-terminus of the CH2 domain has a "hinge” region amino acid sequence.
- hinge regions are sequences of an antibody heavy chain that link the N-terminal variable domain-constant domain segment of an antibody and a CH2 domain of an antibody.
- the hinge region typically provides both flexibility between the N-terminal variable domain-constant domain segment and CH2 domain, as well as amino acid sequence motifs that form disulfide bridges between heavy chains (e.g. the first and the third polypeptide chains).
- the hinge region amino acid sequence is SEQ ID NO: 56.
- a CH3 amino acid sequence is extended at the C- terminus at the junction between the C-terminus of the CH3 domain and the N-terminus of a CH2 domain.
- a CH3 amino acid sequence is extended at the C- terminus at the junction between the C-terminus of the CH3 domain and a hinge region, which in turn is connected to the N-terminus of a CH2 domain.
- the CH3 amino acid sequence is extended by inserting a PGK tripeptide sequence followed by the DKTHT motif of an IgGl hinge region.
- the extension at the C-terminus of the CH3 domain incorporates amino acid sequences that can form a disulfide bond with orthogonal C-terminal extension of another CH3 domain.
- the extension at the C- terminus of the CH3 domain incorporates a KSC tripeptide sequence that is followed by the DKTHT motif of an IgGl hinge region that forms a disulfide bond with orthogonal C- terminal extension of another CH3 domain that incorporates a GEC motif of a kappa light chain.
- a CL amino acid sequence is connected through its C- terminus to a hinge region, which in turn is connected to the N-terminus of a CH2 domain.
- Hinge region sequences are described in more detail above in Section 6.3.19.3.
- the hinge region amino acid sequence is SEQ ID NO:56.
- a CH2 amino acid sequence is connected through its C- terminus to the N-terminus of a constant region domain. Constant regions are described in more detail above in Section 6.3.4.
- the CH2 sequence is connected to a CH3 sequence via its endogenous sequence.
- the CH2 sequence is connected to a CHI or CL sequence. Examples discussing connecting a CH2 sequence to a CHI or CL sequence are described in more detail in U.S. Pat. No. 8,242,247, which is hereby incorporated in its entirety.
- heavy chains of antibodies are extended at their N-terminus to include additional domains that provide additional ABSs.
- the C-terminus of the constant region domain amino acid sequence of a domain O and/or a domain S is connected to the N-terminus of the variable region domain amino acid sequence of a domain A and/or a domain H, respectively.
- the constant region domain is a CH3 amino acid sequence and the variable region domain is a VL amino acid sequence.
- the constant region domain is a CL amino acid sequence and the variable region domain is a VL amino acid sequence.
- the constant region domain is connected to the variable region domain through a peptide linker.
- the peptide linker is a 6 amino acid GSGSGS peptide sequence.
- light chains of antibodies are extended at their N-terminus to include additional variable domain- constant domain segments of an antibody.
- the constant region domain is a CHI amino acid sequence and the variable region domain is a VH amino acid sequence.
- bivalent binding molecules are provided.
- the binding molecules comprise a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a VL amino acid sequence, domain B has a CH3 amino acid sequence, domain D has a CH2 amino acid sequence, and domain E has a constant region domain amino acid sequence; (b) the second polypeptide chain comprises a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a F-G orientation, and wherein domain F has a VH amino acid sequence and domain G has a CH3 amino acid sequence; (c) the third polypeptide chain comprises a domain H, a domain I, a domain J, and a domain K, wherein
- domain E has a CH3 amino acid sequence
- domain H has a VL amino acid sequence
- domain I has a CL amino acid sequence
- domain K has a CH3 amino acid sequence
- domain L has a VH amino acid sequence
- domain M has a CHI amino acid sequence.
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for a second antigen
- the binding molecule is a bispecific bivalent binding molecule.
- the interaction between the A domain and the F domain form a first antigen binding site specific for a first antigen
- the interaction between the H domain and the L domain form a second antigen binding site specific for the first antigen
- the binding molecule is a monospecific bivalent binding molecule.
- the binding molecule has a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a first VL amino acid sequence, domain B has a human IgGl CH3 amino acid sequence with a T366K mutation and a C-terminal extension incorporating a KSC tripeptide sequence that is followed by the DKTHT motif of an IgGl hinge region, domain D has a human IgGl CH2 amino acid sequence, and domain E has human IgGl CH3 amino acid with a S354C and T366W mutation; (b) the second polypeptide chain has a domain F and a domain G, wherein the domains are arranged, from N-terminus, in a A-B-D-E orientation, and domain A has a first
- the first polypeptide chain has the sequence SEQ ID NO: 8
- the second polypeptide chain has the sequence SEQ ID NO: 9
- the third polypeptide chain has the sequence SEQ ID NO: 10
- the fourth polypeptide chain has the sequence SEQ ID NO: l l .
- the binding molecule has a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a first VL amino acid sequence, domain B has a human IgGl CH3 amino acid sequence with a C-terminal extension incorporating a KSC tripeptide sequence that is followed by the DKTHT motif of an IgGl hinge region, domain D has a human IgGl CH2 amino acid sequence, and domain E has human IgGl CH3 amino acid with a S354C and a T366W mutation; (b) the second polypeptide chain has a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus
- domain A and domain F form a first antigen binding site specific for a first antigen
- domain H and domain L form a second antigen binding site specific for a second antigen.
- the binding molecule has a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a first VL amino acid sequence, domain B has a human IgGl CH3 amino acid sequence with a Y349C mutation and a C-terminal extension incorporating a PGK tripeptide sequence that is followed by the DKTHT motif of an IgGl hinge region, domain D has a human IgGl CH2 amino acid sequence, and domain E has a human IgGl CH3 amino acid with a S354C and a T366W mutation; (b) the second polypeptide chain has a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D
- the first polypeptide chain has the sequence SEQ ID NO:24
- the second polypeptide chain has the sequence SEQ ID NO:25
- the third polypeptide chain has the sequence SEQ ID NO: 10
- the fourth polypeptide chain has the sequence SEQ ID NCv l l .
- the binding molecule has a first, second, third, and fourth polypeptide chain, wherein (a) the first polypeptide chain comprises a domain A, a domain B, a domain D, and a domain E, wherein the domains are arranged, from N-terminus to C-terminus, in a A-B-D-E orientation, and domain A has a first VL amino acid sequence, domain B has a human IgGl CH3 amino acid sequence with a Y349C mutation, a P343 V mutation, and a C-terminal extension
- domain D has a human IgGl CH2 amino acid sequence
- domain E has human IgGl CH3 amino acid with a S354C mutation and a T366W mutation
- the second polypeptide chain has a domain F and a domain G, wherein the domains are arranged, from N-terminus to C-terminus, in a F-G orientation, and wherein domain F has a first VH amino acid sequence and domain G has a human IgGl CH3 amino acid sequence with a S354C mutation and a C-terminal extension incorporating a PGK tripeptide sequence
- the third polypeptide chain has a domain H, a domain I, a domain J, and a domain K, wherein the domains are arranged, from N-terminus to C-terminus, in a H-I-J-K orientation, and wherein domain H has a second VL
- the first polypeptide chain has the sequence SEQ ID NO:32
- the second polypeptide chain has the sequence SEQ ID NO:25
- the third polypeptide chain has the sequence SEQ ID NO: 10
- the fourth polypeptide chain has the sequence SEQ ID NCv l l .
- the binding molecules further comprise a sixth polypeptide chain, wherein (a) the third polypeptide chain further comprises a domain R and a domain S, wherein the domains are arranged, from N- terminus to C-terminus, in a R-S-H-I-J-K orientation, and wherein domain R has the first VL amino acid sequence and domain S has a human IgGl CH3 amino acid sequence with a Y349C mutation and a C-terminal extension incorporating a PGK tripeptide sequence that is followed by GSGSGS linker peptide connecting domain S to domain H; (b) the binding molecule further comprises a sixth polypeptide chain, comprising: a domain T and a domain U, wherein the domains are arranged, from N-terminus to C-terminus, in a T-U orientation, and wherein domain T has the first VH amino acid sequence and domain U has a human IgGl CH
- the first polypeptide chain has the sequence SEQ ID NO:24
- the second polypeptide chain has the sequence SEQ ID NO:25
- the third polypeptide chain has the sequence SEQ ID NO: 37
- the fourth polypeptide chain has the sequence SEQ ID NO: 11
- the sixth polypeptide chain has the sequence SEQ ID NO:25. 6.5.2.
- Trivalent 1x2 Trispecific B-Body "BC28-lxlxla"
- the binding molecules further comprise a sixth polypeptide chain, wherein (a) the third polypeptide chain further comprises a domain R and a domain S, wherein the domains are arranged, from N-terminus to C-terminus, in a R-S-H-I-J-K orientation, and wherein domain R has a third VL amino acid sequence and domain S has a human IgGl CH3 amino acid sequence with a T366K mutation and a C-terminal extension incorporating a KSC tripeptide sequence that is followed by GSGSGS linker peptide connecting domain S to domain H; (b) the binding molecule further comprises a sixth polypeptide chain, comprising: a domain T and a domain U, wherein the domains are arranged, from N-terminus to C- terminus, in a T-U orientation, and wherein domain T has a third VH amino acid sequence and domain U has a human IgGl CH3 amino acid sequence with a L351D mutation and a C- terminal extension
- the first polypeptide chain has the sequence SEQ ID NO:24
- the second polypeptide chain has the sequence SEQ ID NO:25
- the third polypeptide chain has the sequence SEQ ID NO:45
- the fourth polypeptide chain has the sequence SEQ ID NO: 11
- the sixth polypeptide chain has the sequence SEQ ID NO: 53.
- the antigen binding sites of the binding molecules described herein may be chosen to specifically bind a wide variety of molecular targets.
- an antigen binding site or sites may specifically bind E-Cad, CLDN7, FGFR2b, N-Cad, Cad-11, FGFR2c, ERBB2, ERBB3, FGFR1, FOLR1, IGF-Ira, GLP1R, PDGFRa, PDGFRb, EPHB6, ABCG2, CXCR4, CXCR7, Integrin-avb3, SPARC, VCAM, ICAM, Annexin, ROR1, ROR2, TNFa, CD137, angiopoietin 2, angiopoietin 3, BAFF, beta amyloid, C5, CA-125, CD147, CD125, CD147, CD152, CD19, CD20, CD22, CD23, CD24, CD25, CD274, CD28, CD3, CD30, CD33, CD37, CD4, CD40, CD44, CD44v4, CD
- the antibody may for example bind two of these targets.
- the Fc portion of the heavy chain of an antibody may be used to target Fc receptor-expressing cells such as the use of the Fc portion of an IgE antibody to target mast cells and basophils.
- An antigen binding site or sites may be chosen that specifically binds the TNF family of receptors including, but not limited to, TNFRl (also known as CD 120a and TNFRSF l A), TNFR2 (also known as CD120b and TNFRSF1B), TNFRSF3 (also known as LTpR), TNFRSF4 (also known as OX40 and CD 134), TNFRSF5 (also known as CD40), TNFRSF6 (also known as FAS and CD95), TNFRSF6B (also known as DCR3), TNFRSF7 (also known as CD27), TNFRSF8 (also known as CD30), TNFRSF9 (also known as 4-1BB),
- TNFRl also known as CD 120a and TNFRSF l A
- TNFR2 also known as CD120b and TNFRSF1B
- TNFRSF3 also known as LTpR
- TNFRSF4 also known as OX40 and CD 134
- TNFRSF5
- TNFRSF l OA also known as TRAILR1, DR4, and CD26
- TNFRSFl OB also known as TRAILR2, DR5, and CD262
- TNFRSFIOC also known as TRAILR3, DCR1, CD263
- TNFRSF l 0D also known as TRAILR4, DCR2, and CD264
- TNFRSFl 1 A also known as RANK and CD265
- TNFRSF l IB also known as OPG
- TNFRSF 12A also known as FN14, TWEAKR, and CD266
- TNFRSFl 3B also known as TACI and CD267
- TNFRSF l 3C also known as BAFFR, BR3, and CD268
- TNFRSF l 4 also known as HVEM and CD270
- TNFRSF l 6 also known as NGFR, p75NTR, and CD271
- TNFRSF l 7 also known as BCMA and CD
- An antigen binding site or sites may be chosen that specifically binds immune- oncology targets including, but not limited to, checkpoint inhibitor targets such as PD1, PDL1, CTLA-4, PDL2, B7-H3, B7-H4, BTLA, TFM3, GAL9, LAG3, VISTA, KIR, 2B4, BY55, and CGEN-15049.
- an antigen binding site or sites may be chosen that specifically target tumor-associated cells.
- the antigen binding site or sites specifically target tumor associated immune cells.
- the antigen binding site or sites specifically target tumor associated regulatory T cells (Tregs).
- a binding molecule has antigen binding sites specific for antigens selected from one or more of CD25, OX40, CTLA-4, and NRPl such that the binding molecule specifically targets tumor associated regulatory T cells.
- a binding molecule has antigen binding sites that specifically bind CD25 and OX40, CD25 and CTLA-4, CD25 and NRPl, OX40 and CTLA-4, OX40 and NRPl, or CTLA-4 and NRPl such that the binding molecule specifically targets tumor associated regulatory T cells.
- a bispecific bivalent binding molecule has antigen binding sites that specifically bind CD25 and OX40, CD25 and CTLA-4, CD25 and NRPl, OX40 and
- CTLA-4, OX40 and NRPl, or CTLA-4 and NRPl such that the binding molecule specifically targets tumor associated regulatory T cells.
- the specific targeting of the tumor associated regulatory T cells results in depletion (e.g. killing) of the regulatory T cells.
- the depletion of the regulatory T cells is mediated by an antibody-drug conjugate (ADC) modification, such as an antibody conjugated to a toxin, as discussed in more detail below in Section 6.7.1.
- ADC antibody-drug conjugate
- a binding molecule has antigen binding sites selected from one or more of CD3, RORl, and ROR2.
- a bispecific bivalent has antigen binding sites that specifically bind CD3 and RORl .
- a bispecific bivalent has antigen binding sites that specifically bind CD3 and ROR2.
- a trispecific trivalent has antigen binding sites that specifically bind CD3, RORl, and ROR2.
- the binding molecule has additional modifications.
- the binding molecule is conjugated to a therapeutic agent (i.e. drug) to form a binding molecule-drug conjugate.
- therapeutic agents include, but are not limited to, chemotherapeutic agents, imaging agents (e.g. radioisotopes), immune modulators (e.g. cytokines, chemokines, or checkpoint inhibitors), and toxins (e.g. cytotoxic agents).
- the therapeutic agents are attached to the binding molecule through a linker peptide, as discussed in more detail below in Section 6.7.3.
- the binding molecule has modifications that comprise one or more additional binding moieties.
- the binding moieties are antibody fragments or antibody formats including, but not limited to, full-length antibodies, Fab fragments, Fvs, scFvs, tandem scFvs, Diabodies, scDiabodies, DARTs, tandAbs, minibodies, camelid VHH, and other antibody fragments or formats known to those skilled in the art. Exemplary antibody and antibody fragment formats are described in detail in Brinkmann et al. (MABS, 2017, Vol. 9, No. 2, 182-212), herein incorporated by reference for all that it teaches.
- the one or more additional binding moieties are attached to the C-terminus of the first or third polypeptide chain. In particular embodiments, the one or more additional binding moieties are attached to the C-terminus of both the first and third polypeptide chain. In particular embodiments, the one or more additional binding moieties are attached to the C-terminus of both the first and third polypeptide chains. In certain embodiments, individual portions of the one or more additional binding moieties are separately attached to the C-terminus of the first and third polypeptide chains such that the portions form the functional binding moiety.
- the one or more additional binding moieties are attached to the N-terminus of any of the polypeptide chains (e.g. the first, second, third, fourth, fifth, or sixth polypeptide chains).
- individual portions of the additional binding moieties are separately attached to the N-terminus of different polypeptide chains such that the portions form the functional binding moiety.
- the one or more additional binding moieties are specific for a different antigen or epitope of the ABSs within the binding molecule.
- the one or more additional binding moieties are specific for the same antigen or epitope of the ABSs within the binding molecule. In certain embodiments, wherein the modification is two or more additional binding moieties, the additional binding moieties are specific for the same antigen or epitope. In certain embodiments, wherein the modification is two or more additional binding moieties, the additional binding moieties are specific for different antigens or epitopes.
- the one or more additional binding moieties are attached to the binding molecule using in vitro methods including, but not limited to, reactive chemistry and affinity tagging systems, as discussed in more detail below in Section 6.7.3.
- the one or more additional binding moieties are attached to the binding molecule through Fc-mediated binding (e.g. Protein A/G).
- the one or more additional binding moieties are attached to the binding molecule using recombinant DNA techniques, such as encoding the nucleotide sequence of the fusion product between the binding molecule and the additional binding moieties on the same expression vector (e.g. plasmid).
- the binding molecule has modifications that comprise functional groups or chemically reactive groups that can be used in downstream processes, such as linking to additional moieties (e.g. drug conjugates and additional binding moieties, as discussed in more detail above in Sections 6.7.1. and 6.7.2.) and downstream purification processes.
- the modifications are chemically reactive groups including, but not limited to, reactive thiols (e.g. maleimide based reactive groups), reactive amines (e.g. N-hydroxysuccinimide based reactive groups), "click chemistry” groups (e.g. reactive alkyne groups), and aldehydes bearing formylglycine (FGly).
- the modifications are functional groups including, but not limited to, affinity peptide sequences (e.g. HA, HIS, FLAG, GST, MBP, and Strep systems etc.).
- the functional groups or chemically reactive groups have a cleavable peptide sequence.
- the cleavable peptide is cleaved by means including, but not limited to, photocleavage, chemical cleavage, protease cleavage, reducing conditions, and pH conditions.
- protease cleavage is carried out by intracellular proteases.
- protease cleavage is carried out by extracellular or membrane associated proteases.
- ADC therapies adopting protease cleavage are described in more detail in Choi et al. (Theranostics, 2012; 2(2): 156-178.), the entirety of which is hereby incorporated by reference for all it teaches.
- compositions that comprise a binding molecule as described herein and a pharmaceutically acceptable carrier or diluent.
- the pharmaceutical composition is sterile.
- the pharmaceutical composition comprises the binding molecule at a concentration of 0.1 mg/ml - 100 mg/ml. In specific embodiments, the pharmaceutical composition comprises the binding molecule at a concentration of 0.5 mg/ml, 1 mg/ml, 1.5 mg/ml, 2 mg/ml, 2.5 mg/ml, 5 mg/ml, 7.5 mg/ml, or 10 mg/ml. In some embodiments, the pharmaceutical composition comprises the binding molecule at a concentration of more than 10 mg/ml.
- the binding molecule is present at a concentration of 20 mg/ml, 25 mg/ml, 30 mg/ml, 35 mg/ml, 40 mg/ml, 45 mg/ml, or even 50 mg/ml or higher. In particular embodiments, the binding molecule is present at a concentration of more than 50 mg/ml.
- the pharmaceutical compositions are described in more detail in U.S. Pat No. 8,961,964, U.S. Pat No. 8,945,865, U.S. Pat No. 8,420,081, U.S. Pat No. 6,685,940, U.S. Pat No. 6,171,586, U.S. Pat No. 8,821,865, U.S. Pat No. 9,216,219, US application 10/813,483, WO 2014/066468, WO 2011/104381, and WO 2016/180941, each of which is incorporated herein in its entirety. 6.9. Methods of Manufacturing
- binding molecules described herein can readily be manufactured by expression using standard cell free translation, transient transfection, and stable transfection approaches currently used for antibody manufacture.
- Therm oFisher can be used for production of the binding molecules using protocols and reagents from ThermoFisher, such as ExpiFectamine, or other reagents known to those skilled in the art, such as polyethylenimine as described in detail in Fang et al. ⁇ Biological Procedures Online, 2017, 19: 11), herein incorporated by reference for all it teaches.
- the expressed proteins can be readily purified using a CHI affinity resin, such as the CaptureSelect CHI resin and provided protocol from ThermoFisher. Further purification can be effected using ion exchange chromatography as is routinely used in the art.
- a CHI affinity resin such as the CaptureSelect CHI resin and provided protocol from ThermoFisher. Further purification can be effected using ion exchange chromatography as is routinely used in the art.
- methods of treatment comprising administering a binding molecule as described herein to a patient in an amount effective to treat the patient.
- an antibody of the present disclosure may be used to treat a cancer.
- the cancer may be a cancer from the bladder, blood, bone, bone marrow, brain, breast, colon, esophagus, gastrointestine, gum, head, kidney, liver, lung, nasopharynx, neck, ovary, prostate, skin, stomach, testis, tongue, or uterus.
- the cancer may be a neoplasm, malignant; carcinoma; carcinoma, undifferentiated; giant and spindle cell carcinoma; small cell carcinoma; papillary carcinoma; squamous cell carcinoma;
- lymphoepithelial carcinoma basal cell carcinoma; pilomatrix carcinoma; transitional cell carcinoma; papillary transitional cell carcinoma; adenocarcinoma; gastrinoma, malignant; cholangiocarcinoma; hepatocellular carcinoma; combined hepatocellular carcinoma and cholangiocarcinoma; trabecular adenocarcinoma; adenoid cystic carcinoma; adenocarcinoma in adenomatous polyp; adenocarcinoma, familial polyposis coli; solid carcinoma; carcinoid tumor, malignant; branchiolo-alveolar adenocarcinoma; papillary adenocarcinoma;
- chromophobe carcinoma acidophil carcinoma; oxyphilic adenocarcinoma; basophil carcinoma; clear cell adenocarcinoma; granular cell carcinoma; follicular adenocarcinoma; papillary and follicular adenocarcinoma; nonencapsulating sclerosing carcinoma; adrenal cortical carcinoma; endometroid carcinoma; skin appendage carcinoma; apocrine
- adenocarcinoma sebaceous adenocarcinoma; ceruminous adenocarcinoma; mucoepidermoid carcinoma; cystadenocarcinoma; papillary cystadenocarcinoma; papillary serous cystadenocarcinoma; mucinous cystadenocarcinoma; mucinous adenocarcinoma; signet ring cell carcinoma; infiltrating duct carcinoma; medullary carcinoma; lobular carcinoma;
- inflammatory carcinoma paget's disease, mammary; acinar cell carcinoma; adenosquamous carcinoma; adenocarcinoma w/squamous metaplasia; thymoma, malignant; ovarian stromal tumor, malignant; thecoma, malignant; granulosa cell tumor, malignant; androblastoma, malignant; Sertoli cell carcinoma; leydig cell tumor, malignant; lipid cell tumor, malignant; paraganglioma, malignant; extra-mammary paraganglioma, malignant; pheochromocytoma; glomangiosarcoma; malignant melanoma; amelanotic melanoma; superficial spreading melanoma; malig melanoma in giant pigmented nevus; epithelioid cell melanoma; blue nevus, malignant; sarcoma; fibrosarcoma; fibrous histiocytoma
- choriocarcinoma mesonephroma, malignant; hemangiosarcoma; hemangioendothelioma, malignant; kaposi's sarcoma; hemangiopericytoma, malignant; lymphangiosarcoma;
- osteosarcoma juxtacortical osteosarcoma; chondrosarcoma; chondroblastoma, malignant; mesenchymal chondrosarcoma; giant cell tumor of bone; ewing's sarcoma; odontogenic tumor, malignant; ameloblastic odontosarcoma; ameloblastoma, malignant; ameloblastic fibrosarcoma; pinealoma, malignant; chordoma; glioma, malignant; ependymoma;
- astrocytoma protoplasmic astrocytoma; fibrillary astrocytoma; astroblastoma; glioblastoma; oligodendroglioma; oligodendroblastoma; primitive neuroectodermal; cerebellar sarcoma; ganglioneuroblastoma; neuroblastoma; retinoblastoma; olfactory neurogenic tumor;
- meningioma malignant
- neurofibrosarcoma neurilemmoma
- malignant granular cell tumor, malignant; malignant lymphoma; hodgkin's disease; hodgkin's; paragranuloma; malignant lymphoma, small lymphocytic; malignant lymphoma, large cell, diffuse; malignant lymphoma, follicular; mycosis fungoides; other specified non-hodgkin's lymphomas;
- malignant histiocytosis multiple myeloma; mast cell sarcoma; immunoproliferative small intestinal disease; leukemia; lymphoid leukemia; plasma cell leukemia; erythroleukemia; lymphosarcoma cell leukemia; myeloid leukemia; basophilic leukemia; eosinophilic leukemia; monocytic leukemia; mast cell leukemia; megakaryoblastic leukemia; myeloid sarcoma; and hairy cell leukemia.
- An antibody of the present disclosure may be administered to a subject per se or in the form of a pharmaceutical composition for the treatment of, e.g., cancer, autoimmunity, transplantation rejection, post-traumatic immune responses, graft-versus-host disease, ischemia, stroke, and infectious diseases, for example by targeting viral antigens, such as gpl20 of HIV.
- a pharmaceutical composition for the treatment of, e.g., cancer, autoimmunity, transplantation rejection, post-traumatic immune responses, graft-versus-host disease, ischemia, stroke, and infectious diseases, for example by targeting viral antigens, such as gpl20 of HIV.
- a domain-exchanged antibody comprising a heavy chain (HC) composed of VH-CH3, and a light chain (LC) comprising VL-CH3-CH2-CH3, wherein the VH-CH3 of the HC is dimerising with the VL-CH3 of the LC thereby forming a first domain-exchanged LC/HC dimer comprising a CH3LC/CH3HC domain pair.
- HC heavy chain
- LC light chain
- the light chain further comprises a second LC/HC dimer, wherein the light chain is further defined as VL-CH3 -CH2-CH3 - VX 1 - CHX and wherein the light chain is further dimerising with VX2-CHX2.
- VX1 is a second VH region and wherein VX2 is a second VL region.
- VX1 is a second VL region and wherein VX2 is a second VH region.
- the antibody comprises two light chains, wherein the first light chain is further defined as VL-CH3-CH2-CH3-VH1-CH1, and the second light chain is further defined as VL-CH3 -CH2-CH3 - VL 1 -CL, wherein the VH1- CH1 is dimerising with the VLl-CL. 11.
- the antibody of any of items 1-3 wherein the antibody comprises two light chains, wherein the first light chain is further defined as VL-CH3-CH2-CH3-VH1-CH3, and the second light chain is further defined as VL-CH3 -CH2-CH3 - VL 1 -CH3 , wherein the VH1- CH3 is dimerising with the VL1-CH3.
- VLl-CH3 is further defined as VL1- CH3(Knob), and wherein the VH1-CH3 is further defined as VHl-CH3(Hole).
- the heavy chain further comprises a second LC/HC dimer, wherein the heavy chain is further defined as VX1-CHX-VH-CH3 and wherein the heavy chain is further dimerising with VX2-CHX2.
- VX1 is a second VH region and wherein VX2 is a second VL region.
- VX1 is a second VL region and wherein VX2 is a second VH region.
- first LC/HC dimer comprises a first binding site recognizing a first epitope
- second LC/HC dimer comprises a second binding site recognizing a second epitope that is different from the first epitope or originates from a different antigen, wherein either the first LC/HC dimer or the second LC/HC dimer is domain-exchanged.
- the antibody of item 19 wherein the antibody is a bispecific antibody that comprises two first LC/HC dimers and a single second LC/HC dimer.
- the antibody of item 19 wherein the antibody is a bispecific antibody that comprises two first LC/HC dimers and two second LC/HC dimers.
- the first LC/HC dimer is characterized by a CH3(Knob)/ CH3(Hole) dimer, CH3Hc/CH3Hc dimer, or comprises an engineered CH3 domain capable to produce a cognate pair of the CH3LC/CH3HC domains; and wherein the light chain is further dimerized with an Fc chain comprising CH2-CH3, thereby forming the Fc region.
- engineered CH3 domain comprises the amino acid sequence of CH3 of human IgGl or a functional variant thereof with at least 80% sequence identity to CH3 of human IgGl, which engineered CH3 domain comprises one or more of the following: a) one or more knob or hole mutations, preferably any of T366Y/Y407T, F405A/T394'W, T366Y:F405A/T394'W:Y407T, T366W/Y407'A and
- an artificial linking sequence with a length of 5 to 20 amino acids, preferably 8 to 15 amino acids.
- an effector-function competent antibody comprising a Fc gamma receptor binding site and/or a CI q binding site located in any of the CH2 and/or CH3 domains;
- an effector-negative antibody comprising a Fc region deficient in binding to an Fc gamma receptor and/or CI q;
- c) comprises a pH-dependent FcRn binding site located in any of the CH2 and/or CH3 domains.
- the antibody of item 30 wherein the antibody is a bispecific antibody that specifically recognizes a second target, wherein the first target is TNF-a, CD3, CD16, CD47, or PD-1, and wherein the second target is EGFR, ROR1 or HER2, HER3, Lag-3.
- a bivalent monospecific B-Body recognizing TNFa was constructed with the following architecture (VL(Certolizumab)-CH3(Knob)-CH2-CH3/VH(Certolizumab)- CH3(Hole)) using standard molecular biology procedures.
- VL(Certolizumab)-CH3(Knob)-CH2-CH3/VH(Certolizumab)- CH3(Hole) using standard molecular biology procedures.
- the full-length construct was expressed in an E. coli cell free protein synthesis expression system for -18 hours at 26 °C with gentle agitation. Following expression, the cell-free extract was centrifuged to pellet insoluble material and the supernatant was diluted 2x with lOx Kinetic Buffer (Forte Bio) and used as analyte for biolayer interferon! etry.
- Biotinylated TNFa was immobilized on a streptavidin sensor to give a wave shift response of -1.5 nm. After establishing a baseline with lOx kinetic buffer, the sensor was dipped into the antibody construct analyte solution. The construct gave a response of -3 nm, comparable to the traditional IgG format of certolizumab, demonstrating the ability of the bivalent monospecific construct to assemble into a functional, full-length antibody. Results are shown in FIG. 5.
- sequences are provided respectively in SEQ ID NO:3 (1st polypeptide chain), SEQ ID NO:4 (2nd polypeptide chain), SEQ ID NO:5 (3rd polypeptide chain), SEQ ID NO:6 (4th polypeptide chain).
- BC1 bivalent bispecific construct
- Antigen A a second antigen
- the A domain (SEQ ID NO: 12) and F domain (SEQ ID NO: 16) form an antigen binding site (A:F) specific for "Antigen A”.
- the H domain has the VH sequence from nivolumab and the L domain has the VL sequence from nivolumab; H and L associate to form an antigen binding site (H:L) specific for human PD1.
- the B domain (SEQ ID NO: 13) has the sequence of human IgGl CH3 with several mutations: T366K, 445K, 446S, and 447C insertion.
- T366K mutation is a charge pair cognate of the L351D residue in Domain G.
- the "447C" residue on domain B comes from the C-terminal KSC tripeptide insertion.
- Domain D (SEQ ID NO: 14) has the sequence of human IgGl CH2
- Domain E (SEQ ID NO: 15) has the sequence of human IgGl CH3 with the mutations T366W and S354C.
- the 366W is the "knob” mutation.
- the 354C introduces a cysteine that is able to form a disulfide bond with the cognate 349C mutation in Domain K.
- Domain G (SEQ ID NO: 17) has the sequence of human IgGl CH3 with the following mutations: L351D, and 445G, 446E, 447C tripeptide insertion.
- L351D mutation introduces a charge pair cognate to the Domain B T366K mutation.
- the "447C" residue on domain G comes from the C-terminal GEC tripeptide insertion.
- Domain I (SEQ ID NO: 19) has the sequence of human C kappa light chain (CK)
- Domain J (SEQ ID NO: 20] has the sequence of human IgGl CH2 domain, and is identical to the sequence of domain D.
- Domain K [SEQ ID NO: 21] has the sequence of human IgGl CH3 with the following changes: Y349C, D356E, L358M, T366S, L368A, Y407V.
- the 349C mutation introduces a cysteine that is able to form a disulfide bond with the cognate 354C mutation in Domain E.
- the 356E and L358M introduce isoallotype amino acids that reduce
- the 366S, 368A, and 407V are "hole" mutations.
- Domain M [SEQ ID NO: 23] has the sequence of the human IgGl CHI region.
- BC1 could readily be expressed at high levels using mammalian expression at concentrations greater than 100 ⁇ g/ml.
- bivalent bispecific "BO” protein could easily be purified in a single step using a CHI -specific CaptureSelectTM affinity resin from ThermoFisher.
- FIG. 7A SEC analysis demonstrates that a single-step CHI affinity purification step yields a single, monodisperse peak via gel filtration in which >98% is monomer.
- FIG. 7B shows comparative literature data of SEC analysis of a CrossMab bivalent antibody construct.
- FIG. 8A is a cation exchange chromatography elution profile of "BC1" following one-step purification using the CaptureSelectTM CHI affinity resin, showing a single tight peak.
- FIG. 8B is a cation exchange chromatography elution profile of "BO” following purification using standard Protein A purification, showing additional elution peaks consistent with the co-purification of incomplete assembly products.
- FIG. 9 shows SDS-PAGE gels under non-reducing conditions.
- single-step purification of "BO" with CHI affinity resin provides a nearly homogeneous single band, with lane 4 showing minimal additional purification with a subsequent cation exchange polishing step.
- FIG. 10 compares SDS-PAGE gels of "BO” after single-step CHI -affinity purification, under both non-reducing and reducing conditions (Panel A) with SDS-PAGE gels of a CrossMab bispecific antibody under non-reducing and reducing conditions as published in the referenced literature (Panel B).
- FIG. 11 shows mass spec analysis of "BO", demonstrating two distinct heavy chains (FIG. 11 A) and two distinct light chains (FIG. 1 IB) under reducing conditions.
- the mass spectrometry data in FIG. 12 confirms the absence of incomplete pairing after purification.
- Accelerated stability testing was performed to evaluate the long-term stability of the "BC1" B-Body design.
- the purified B-Body was concentrated to 8.6 mg/ml in PBS buffer and incubated at 40°C.
- the structural integrity was measured weekly using analytical size exclusion chromatography (SEC) with a Shodex KW-803 column.
- the structural integrity was determined by measuring the percentage of intact monomer (% Monomer) in relation to the formation of aggregates. Data are shown in FIG. 13.
- the IgG Control 1 is a positive control with good stability properties.
- IgG Control 2 is a negative control that is known to aggregate under the incubation conditions.
- the "BC1" B-Body has been incubated for 8 weeks without any loss of structural integrity as determined by the analytical SEC.
- Table 1 compares "BO” to CrossMab in key developability characteristics:
- BC6 bivalent bispecific B-Body
- FIG. 15A shows SEC analysis of "BC6" following one-step purification using the Capture SelectTM CHI affinity resin.
- the data demonstrate that the single step CHI affinity purification yields a single monodisperse peak, similar to what we observed with "BO”, demonstrating that the disulfide bonds between polypeptide chains 1 and 2 and between polypeptide chains 3 and 4 are intact.
- the chromatogram also shows the absence of non-covalent aggregates.
- FIG. 15B shows a SDS-PAGE gel under non-reducing conditions, with lane 1 loaded with a first lot of "BC6" after a single-step CHI affinity purification, lane 2 loaded with a second lot of "BC6" after a single-step CHI affinity purification. Lanes 3 and 4 demonstrate further purification can be achieved with ion exchange chromatography subsequent to CHI affinity purification.
- Polypeptide chain 1 "BC28" chain 1 (SEQ ID NO:24)
- Polypeptide chain 2 "BC28” chain 2 (SEQ ID NO:25)
- Polypeptide chain 3 "BC1" chain 3 (SEQ ID NO: 10)
- Polypeptide chain 4 "BC1" chain 4 (SEQ ID NO: 11)
- the "BC28" A:F antigen binding site is specific for "Antigen A”.
- the "BC28” H:L antigen binding site is specific for PD1 (nivolumab sequences).
- "BC28" domain B has the following changes as compared to wild type CH3 : Y349C; 445P, 446G, 447K insertion.
- "BC28” domain E has the following changes as compared to wild type CH3 : S354C, K366W.
- "BC28” domain G has the following changes as compared to wild type: S354C; 445P, 446G, 447K insertion.
- BC28 thus has an engineered cysteine at residue 349C of Domain B and engineered cysteine at residue 354C of domain G ("349C-354C").
- BC29 has engineered cysteines at residue 351C of Domain B and 351C of Domain G ("351C-351C”).
- BC30 has an engineered cysteine at residue 354C of Domain B and 349C of Domain G ("354C-349C”).
- BC31 has an engineered cysteine at residue 394C and engineered cysteine at 394C of Domain G ("394C-394C”).
- BC32 has engineered cysteines at residue 407C of Domain B and 407C of Domain G ("407C-407C").
- FIG. 17 shows SDS-PAGE analysis under non-reducing conditions following one- step purification using the CaptureSelectTM CHI affinity resin.
- Lanes 1 and 3 show high levels of expression and substantial homogeneity of intact "BC28" (lane 1) and "BC30" (lane 3).
- Lane 2 shows oligomerization of BC29.
- Lanes 4 and 5 show poor expression of BC31 and BC32, respectively, and insufficient linkage in BC32.
- Another construct, BC9 which had cysteines introduced at residue 392 in domain B and 399 in Domain G (“392C-399C"), a disulfide pairing reported by Genentech, demonstrated oligomerization on SDS PAGE (data not shown).
- FIG. 18 shows SEC analysis of "BC28” and "BC30" following one-step purification using the CaptureSelectTM CHI affinity resin.
- BC28 can readily be purified using a single step purification using Protein A resin (results not shown).
- FIG. 19 shows the general architecture of the bivalent bispecific lxl B-Body
- BC44 our currently preferred bivalent bispecific lxl construct.
- first polypeptide chain (SEQ ID NO:32)
- Domain B CH3 (P343 V; Y349C; 445P, 446G, 447K insertion)
- Domain E CH2
- FIG. 20 shows size exclusion chromatography of "BC 15" and "BC16” samples at the indicated week of an accelerated stability testing protocol at 40° C. "BC 15" remained stable; “BC 16” proved to be unstable over time. 6.12.7.
- Example 7 Trivalent 2x1 Bispecific B-Body construct ("BCl-2xl)
- FIG. 23 shows non-reducing SDS-PAGE of protein expressed using the
- ThermoFisher Expi293 transient transfection system ThermoFisher Expi293 transient transfection system.
- Lane 1 shows the eluate of the trivalent 2x1 "BC1-2X1" protein following one-step purification using the Capture SelectTM CHI affinity resin.
- Lane 2 shows the lower molecular weight, faster migrating, bivalent "BCl” protein following one-step purification using the Capture SelectTM CHI affinity resin.
- Lanes 3-5 demonstrate purification of "BCl-2xl” using protein A.
- Lanes 6 and 7 show purification of "BCl-2xl” using CHI affinity resin.
- FIG. 24 compares the avidity of the bivalent "BCl” construct to the avidity of the tnvalent 2x1 "BCl-2xl” construct using an Octet (Pall ForteBio) analysis. Biotinylated antigen "A” is immobilized on the surface, and the antibody constructs are passed over the surface for binding analysis.
- TBI 11 trivalent 2x1 trispecific molecule
- TBI 11 has the following architecture ("Ada" indicates a V region from
- the A:F antigen binding site is specific for "Antigen A”, as is the H:L binding antigen binding site.
- the R:T antigen binding site is specific for PD.
- the specificity of this construct is thus Antigen "A” x (PD1 -Antigen "A”). 6.12.10.
- Example 10 Trivalent 1x2 bispecific construct ("CTLA4-4 x Nivo x CTLA4-4")
- FIG. 28 is a SDS-PAGE gel in which the lanes showing the "CTLA4-4 x Nivo x CTLA4-4" construct under non-reducing and reducing conditions have been boxed.
- FIG. 29 compares antigen binding of two antibodies: "CTLA4-4 x OX40-8” and “CTLA4-4 x Nivo x CTLA4-4".
- CTLA4-4 x OX40-8 binds to CTLA4 monovalently; while “CTLA4-4 x Nivo x CTLA4-4" bind to CTLA4 bivalently.
- Antigen binding site A:F was specific for "Antigen A”
- Antigen binding site H:L was specific for PD1 (nivolumab sequence)
- Antigen binding site R:T was specific for CTLA4.
- FIG. 31 shows size exclusion chromatography with "BC28-lxlxla” following transient expression and one-step purification using the CaptureSelectTM CHI affinity resin, demonstrating a single well-defined peak.
- FIG. 32 shows a SDS-PAGE gel with various constructs, each after transient expression and one-step purification using the CaptureSelectTM CHI affinity resin, under non-reducing and reducing conditions.
- Lanes 1 (nonreducing conditions) and 2 (reducing conditions, + DTT) are the bivalent lxl bispecific construct "BC1".
- Lanes 3 (nonreducing) and 4 (reducing) are the trivalent bispecific 2x1 construct "BCl-2xl” (see Example 7).
- the SDS-PAGE gel demonstrates the complete assembly of each construct, with the predominant band in the non-reducing gel appearing at the expected molecular weight for each construct.
- FIG. 33 shows Octet binding analyses to 3 antigens: PD1, Antigen "A”, and CTLA-4. In each instance, the antigen is immobilized and the B-Body is the analyte.
- lxl bispecifics "BO” and “CTLA4-4 x OX40-8” were also compared to demonstrate lxl B- Bodies bind specifically only to antigens for which the antigen binding sites were selected.
- FIG. 33A shows binding of "BO” to PD1 and to Antigen "A”, but not CTLA4.
- FIG. 33B shows binding of a bivalent bispecific lxl construct "CTLA4-4 x OX40-8" to CTLA4, but not to Antigen "A” or PD1.
- FIG. 33C shows the binding of the trivalent trispecific 1x2 construct, "BC28-lxlxla” to PD1, Antigen "A”, and CTLA4.
- FIG. 35 shows the overall architecture of a 2x2 tetravalent bispecific construct "BC22 -2x2".
- the 2x2 tetravalent bispecific was constructed with "BC1" scaffold by duplicating each variable domain-constant domain segment. Domain nomenclature is schematized in FIG. 34.
- FIG. 36 is a SDS-PAGE gel.
- Lanes 7-9 show the "BC22-2x2" tetravalent construct respectively following one-step purification using the Capture SelectTM CHI affinity resin ("CHI eluate"), and after an additional ion exchange chromatography purification (lane 8, "pk 1 after IEX”; lane 9, “pk 2 after IEX”).
- Lanes 1-3 are the trivalent 2x1 construct "BC21- 2x1" after CHI affinity purification (lane 1) and, in lanes 2 and 3, subsequent ion exchange chromatography.
- Lanes 4-6 are the 1x2 trivalent construct "BC 12-1x2".
- FIG. 37 shows the overall architecture of a 2x2 tetravalent construct.
- FIGS. 39 and 40 schematize tetravalent constructs having alternative architectures. Domain nomenclature is presented in FIG. 38.
- Domain X CH1 (IgGl) 3 rd polypeptide chain (identical to first polypeptide chain)
- Expi-293 cells were either mock transfected or transiently transfected with Antigen "B” using the Expi-293 Transfection Kit (Life Technologies). Forty-eight hours after transfection, the Expi-293 cells were harvested and fixed in 4% paraformaldehyde for 15 minutes at room temperature. The cells were washed twice in PBS. 200,000 Antigen B or Mock transfected Expi-293 cells were placed in a V-bottom 96 well plate in 100 uL of PBS. The cells were incubated with the "B-Body-IgG 2x2" at a concentration of 3 ug/mL for 1.5 hours at room temperature.
- the cells were centrifuged at 300xG for 7 minutes, washed in PBS, and incubated with 100 ⁇ ⁇ of FITC labeled goat-anti human secondary antibody at a concentration of 8 ⁇ g/mL for 1 hour at room temperature.
- the cells were centrifuged at 300xG for 7 minutes, washed in PBS, and cell binding was confirmed by flow cytometry using a Guava easyCyte. Results are shown in FIG. 42.
- FIG. 45 shows a SDS-PAGE gel with various constructs, each after transient expression and one-step purification using the Capture SelectTM CHI affinity resin, under non-reducing and reducing conditions.
- Lanes 1 (nonreducing conditions) and 2 (reducing conditions, + DTT) are the bivalent lxl bispecific construct "BO”.
- Lanes 3 (nonreducing) and 4 (reducing) are the bivalent lxl bispecific construct "BC28" (see Example 4).
- Lanes 5 (nonreducing) and 6 (reducing) are the bivalent lxl bispecific construct "BC44" (see Example 5).
- Lanes 7 (nonreducing) and 8 (reducing) are the trivalent 1x2 bispecific "BC28-lx2" construct (see Example 9).
- Lanes 9 (nonreducing) and 10 (reducing) are the trivalent 1x2 trispecific "BC28-lxlxla” construct described in Example 11.
- the SDS-PAGE gel demonstrates the complete assembly of each construct, with the predominant band in the non-reducing gel appearing at the expected molecular weight for each construct.
- VL -VEIKRTPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKDKTHTCPP CPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK ISKAKGQPREPQVYTLP PCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSPGK
- VL -VEIKRTPREPQVYTLPPCRDELTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKT TPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKDirflTCPP CPAPELLGGPSWLFPPKPKDTmiSRTPEVTCVVVDVSHEDPEVKFlSn ⁇ f-fVDGVEVHNAKTK PREEQYNSTYRWSVLTVLHQD Ii GKEYKCKVSNKALPAPIEKTISKAKGQPPgPgyyrLP
- VL ⁇ VEIKRTVAAPSVFI FPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECDirgrCPP CPAPELLGGPSWLFPPKPKDTmiSRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRWSVLTVLHQD IiNGKEYKCKVSNKALPAPIEKTISKAKGQPPgPgycrLP
- chain 2 [ SEQ ID NO : 53 ]
- IKRTPREP [SEQ ID NO: 57]
- IKRTVREP [SEQ ID NO: 58]
- IKRTREP [SEQ ID NO:59]
- IKRTVPREP [SEQ ID NO: 60]
- IKRTVAEP [SEQ ID NO: 61]
- IKRTVAPREP [SEQ ID NO: 62]
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Oncology (AREA)
- Cardiology (AREA)
- Heart & Thoracic Surgery (AREA)
- Communicable Diseases (AREA)
- Transplantation (AREA)
- Urology & Nephrology (AREA)
- Vascular Medicine (AREA)
- Hematology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
Priority Applications (19)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020197013738A KR102617264B1 (ko) | 2016-10-19 | 2017-10-18 | 항체 구조물 |
| DK17804323.8T DK3529269T3 (da) | 2016-10-19 | 2017-10-18 | Antistof-konstruktioner |
| CN202410343134.7A CN118359705A (zh) | 2016-10-19 | 2017-10-18 | 抗体构建体 |
| CN201780078920.7A CN110177805B (zh) | 2016-10-19 | 2017-10-18 | 抗体构建体 |
| EP17804323.8A EP3529269B1 (en) | 2016-10-19 | 2017-10-18 | Antibody constructs |
| EP25218239.9A EP4729535A2 (en) | 2016-10-19 | 2017-10-18 | Antibody constructs |
| NZ752832A NZ752832B2 (en) | 2017-10-18 | Antibody constructs | |
| JP2019520869A JP7261158B2 (ja) | 2016-10-19 | 2017-10-18 | 抗体構築物 |
| MX2019004690A MX421186B (es) | 2016-10-19 | 2017-10-18 | Constructos de anticuerpos. |
| CA3041254A CA3041254A1 (en) | 2016-10-19 | 2017-10-18 | Antibody constructs |
| ES17804323T ES3063689T3 (en) | 2016-10-19 | 2017-10-18 | Antibody constructs |
| LTEPPCT/US2017/057268T LT3529269T (lt) | 2016-10-19 | 2017-10-18 | Antikūnų konstruktai |
| AU2017345454A AU2017345454B2 (en) | 2016-10-19 | 2017-10-18 | Antibody constructs |
| IL266143A IL266143B1 (en) | 2016-10-19 | 2017-10-18 | Antibody structures |
| CN202410332902.9A CN118359704A (zh) | 2016-10-19 | 2017-10-18 | 抗体构建体 |
| KR1020237043908A KR20240000650A (ko) | 2016-10-19 | 2017-10-18 | 항체 구조물 |
| FIEP17804323.8T FI3529269T3 (fi) | 2016-10-19 | 2017-10-18 | Vasta-ainerakenteita |
| KR1020257008855A KR20250044934A (ko) | 2016-10-19 | 2017-10-18 | 항체 구조물 |
| JP2022162426A JP7591015B2 (ja) | 2016-10-19 | 2022-10-07 | 抗体構築物 |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662410054P | 2016-10-19 | 2016-10-19 | |
| US62/410,054 | 2016-10-19 | ||
| US201762549894P | 2017-08-24 | 2017-08-24 | |
| US62/549,894 | 2017-08-24 | ||
| US201762555498P | 2017-09-07 | 2017-09-07 | |
| US62/555,498 | 2017-09-07 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2018075692A2 true WO2018075692A2 (en) | 2018-04-26 |
| WO2018075692A3 WO2018075692A3 (en) | 2019-04-04 |
Family
ID=60452719
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2017/057268 Ceased WO2018075692A2 (en) | 2016-10-19 | 2017-10-18 | Antibody constructs |
Country Status (15)
| Country | Link |
|---|---|
| US (2) | US20180118811A1 (enExample) |
| EP (2) | EP3529269B1 (enExample) |
| JP (2) | JP7261158B2 (enExample) |
| KR (3) | KR20250044934A (enExample) |
| CN (3) | CN110177805B (enExample) |
| AU (1) | AU2017345454B2 (enExample) |
| CA (1) | CA3041254A1 (enExample) |
| DK (1) | DK3529269T3 (enExample) |
| ES (1) | ES3063689T3 (enExample) |
| FI (1) | FI3529269T3 (enExample) |
| IL (1) | IL266143B1 (enExample) |
| LT (1) | LT3529269T (enExample) |
| MX (1) | MX421186B (enExample) |
| PT (1) | PT3529269T (enExample) |
| WO (1) | WO2018075692A2 (enExample) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020028269A3 (en) * | 2018-07-30 | 2020-03-19 | Invenra Inc. | Multispecific treg binding molecules |
| US20210380700A1 (en) * | 2018-07-06 | 2021-12-09 | Abmax Biopharmaceuticals | De-adcc/cdc functions of antibodies and their applications |
| EP3781204A4 (en) * | 2018-04-17 | 2022-03-30 | Invenra, Inc. | BINDING MOLECULES |
| JP2023507033A (ja) * | 2019-12-20 | 2023-02-20 | キソジ・バイオテクノロジー・インコーポレイテッド | ポリペプチド、タンパク質複合体及びそれを作製する方法 |
| US11952424B2 (en) | 2018-03-30 | 2024-04-09 | Merus N.V. | Multivalent antibody |
| US11965030B2 (en) | 2018-12-24 | 2024-04-23 | Sanofi | Multispecific binding proteins with mutant fab domains |
| US12084496B2 (en) | 2018-04-18 | 2024-09-10 | Exelixis, Inc. | Anti-ROR antibody constructs |
| WO2025129132A1 (en) * | 2023-12-14 | 2025-06-19 | Invenra Inc. | Multispecific binding agents that target ctla4 and/or cd25 and uses thereof |
Families Citing this family (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| PE20171324A1 (es) | 2014-11-26 | 2017-09-11 | Xencor Inc | Anticuerpos heterodimericos que se unen a cd3 y a antigenos tumorales |
| CA3007030A1 (en) | 2015-12-07 | 2017-06-15 | Xencor, Inc. | Heterodimeric antibodies that bind cd3 and psma |
| JP7010854B2 (ja) | 2016-06-14 | 2022-01-26 | ゼンコア インコーポレイテッド | 二重特異性チェックポイント阻害剤抗体 |
| CN110177805B (zh) * | 2016-10-19 | 2024-04-02 | 英温拉公司 | 抗体构建体 |
| WO2019183406A1 (en) * | 2018-03-21 | 2019-09-26 | Invenra Inc. | Multispecific antibody purification with ch1 resin |
| JP7596263B2 (ja) * | 2018-10-10 | 2024-12-09 | ザイムワークス ビーシー インコーポレイテッド | 4-1bb及び腫瘍関連抗原に結合する抗体構築物ならびにその使用 |
| AU2021224883A1 (en) * | 2020-02-20 | 2022-09-29 | Invenra Inc. | Bispecific GD2 and B7H2 binding molecules and methods of use |
| CA3207821A1 (en) * | 2020-12-10 | 2022-06-16 | Invenra Inc. | Orthogonal mutations for heterodimerization |
| WO2023245021A2 (en) * | 2022-06-14 | 2023-12-21 | Invenra Inc. | Multispecific binding agents that target cd25 and/or ctla4 and uses thereof |
| TW202506726A (zh) * | 2023-04-07 | 2025-02-16 | 美商麥迪紐有限責任公司 | 雙特異性工程化抗體 |
Citations (49)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
| US5821333A (en) | 1995-03-01 | 1998-10-13 | Genetech, Inc. | Method for making heteromultimeric polypeptides |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| US6685940B2 (en) | 1995-07-27 | 2004-02-03 | Genentech, Inc. | Protein formulation |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| WO2005077090A2 (en) | 2004-02-05 | 2005-08-25 | Seattle Genetics, Inc. | Improved methods of producing antibody conjugates |
| WO2005082023A2 (en) | 2004-02-23 | 2005-09-09 | Genentech, Inc. | Heterocyclic self-immolative linkers and conjugates |
| WO2006065533A2 (en) | 2004-11-29 | 2006-06-22 | Seattle Genetics, Inc. | Engineered antibodies and immunoconjugates |
| WO2007030642A2 (en) | 2005-09-07 | 2007-03-15 | Medimmune, Inc. | Toxin conjugated eph receptor antibodies |
| WO2007103288A2 (en) | 2006-03-02 | 2007-09-13 | Seattle Genetics, Inc. | Engineered antibody drug conjugates |
| WO2009073445A2 (en) | 2007-11-28 | 2009-06-11 | Mersana Therapeutics, Inc. | Biocompatible biodegradable fumagillin analog conjugates |
| WO2010068759A1 (en) | 2008-12-10 | 2010-06-17 | Mersana Therapeutics, Inc. | Pharmaceutical formulations of biodegradable biocompatible camptothecin-polymer conjugates |
| US7745394B2 (en) | 2003-11-06 | 2010-06-29 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| WO2010138719A1 (en) | 2009-05-28 | 2010-12-02 | Mersana Therapeutics, Inc. | Polyal drug conjugates comprising variable rate-releasing linkers |
| WO2011104381A2 (en) | 2010-02-26 | 2011-09-01 | Novo Nordisk A/S | Stable antibody containing compositions |
| US8053562B2 (en) | 2005-07-19 | 2011-11-08 | Ucb Pharma S.A. | Modified antibody fragments |
| US8163888B2 (en) | 2003-10-10 | 2012-04-24 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates and methods of making said conjugates |
| US8242247B2 (en) | 2007-12-21 | 2012-08-14 | Hoffmann-La Roche Inc. | Bivalent, bispecific antibodies |
| WO2012171020A1 (en) | 2011-06-10 | 2012-12-13 | Mersana Therapeutics, Inc. | Protein-polymer-drug conjugates |
| US8337856B2 (en) | 2000-03-16 | 2012-12-25 | Immunogen, Inc. | Methods of treatment using anti-ERBB antibody-maytansinoid conjugates |
| US8420081B2 (en) | 2007-11-30 | 2013-04-16 | Abbvie, Inc. | Antibody formulations and methods of making same |
| WO2013173337A2 (en) | 2012-05-15 | 2013-11-21 | Seattle Genetics, Inc. | Self-stabilizing linker conjugates |
| US8592562B2 (en) | 2008-01-07 | 2013-11-26 | Amgen Inc. | Method for making antibody Fc-heterodimeric molecules using electrostatic steering effects |
| US8624003B2 (en) | 2009-06-03 | 2014-01-07 | Immunogen, Inc. | Methods for preparation of antibody-maytansinoid conjugates |
| WO2014008375A1 (en) | 2012-07-05 | 2014-01-09 | Mersana Therapeutics, Inc. | Terminally modified polymers and conjugates thereof |
| WO2014066468A1 (en) | 2012-10-25 | 2014-05-01 | Medimmune, Llc | Stable, low viscosity antibody formulation |
| WO2014093394A1 (en) | 2012-12-10 | 2014-06-19 | Mersana Therapeutics, Inc. | Protein-polymer-drug conjugates |
| WO2014093640A1 (en) | 2012-12-12 | 2014-06-19 | Mersana Therapeutics,Inc. | Hydroxy-polmer-drug-protein conjugates |
| US8821865B2 (en) | 2010-11-11 | 2014-09-02 | Abbvie Biotechnology Ltd. | High concentration anti-TNFα antibody liquid formulations |
| WO2014160360A1 (en) | 2013-03-14 | 2014-10-02 | Mersana Therapeutics Inc. | Tubulysin compounds and conjugates thereof |
| US8945865B2 (en) | 2011-03-10 | 2015-02-03 | Eisai R&D Management Co., Ltd. | Method for screening for compound capable of enhancing or inhibiting OATP1B1 transport activity, and method for determining expression level of OATP1B1 |
| US8961964B2 (en) | 2003-04-04 | 2015-02-24 | Genentech, Inc. | High concentration antibody and protein formulations |
| WO2015054659A1 (en) | 2013-10-11 | 2015-04-16 | Mersana Therapeutics, Inc. | Protein-polymer-drug conjugates |
| WO2015057699A2 (en) | 2013-10-15 | 2015-04-23 | Seattle Genetics, Inc. | Pegylated drug-linkers for improved ligand-drug conjugate pharmacokinetics |
| WO2015095755A1 (en) | 2013-12-19 | 2015-06-25 | Seattle Genetics, Inc. | Methylene carbamate linkers for use with targeted-drug conjugates |
| WO2015123679A1 (en) | 2014-02-17 | 2015-08-20 | Seattle Genetics, Inc. | Hydrophilic antibody-drug conjugates |
| WO2015157286A1 (en) | 2014-04-07 | 2015-10-15 | Seattle Genetics, Inc. | Stable formulations for anti-cd19 antibodies and antibody-drug conjugates |
| US9216219B2 (en) | 2012-06-12 | 2015-12-22 | Novartis Ag | Anti-BAFFR antibody formulation |
| WO2015195925A1 (en) | 2014-06-18 | 2015-12-23 | Mersana Therapeutics, Inc. | Protein-polymer-drug conjugates and methods of using same |
| US9248182B2 (en) | 2012-04-20 | 2016-02-02 | Merus B.V. | Methods and means for the production of Ig-like molecules |
| WO2016087650A1 (en) | 2014-12-05 | 2016-06-09 | Merck Patent Gmbh | Domain-exchanged antibody |
| WO2016180941A1 (en) | 2015-05-13 | 2016-11-17 | Sanofi | Liquid compositions for anti-cd19 antibody-drug conjugates |
| US9527927B2 (en) | 2011-12-20 | 2016-12-27 | Medimmune, Llc | Modified polypeptides for bispecific antibody scaffolds |
| WO2017015495A1 (en) | 2015-07-21 | 2017-01-26 | Immunogen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| WO2017136623A1 (en) | 2016-02-05 | 2017-08-10 | Immunogen, Inc. | Efficient process for preparing cell-binding agent-cytotoxic agent conjugates |
| WO2017160754A1 (en) | 2016-03-15 | 2017-09-21 | Mersana Therapeutics,Inc. | Napi2b-targeted antibody-drug conjugates and methods of use thereof |
| WO2017165851A1 (en) | 2016-03-25 | 2017-09-28 | Seattle Genetics, Inc. | Process for the preparation of pegylated drug-linkers and intermediates thereof |
Family Cites Families (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB8905551D0 (en) * | 1989-03-10 | 1989-04-19 | Unilever Plc | Detergent compositions |
| TWI452136B (zh) * | 2010-11-17 | 2014-09-11 | 中外製藥股份有限公司 | A multiple specific antigen-binding molecule that replaces the function of Factor VIII in blood coagulation |
| US8790651B2 (en) * | 2011-07-21 | 2014-07-29 | Zoetis Llc | Interleukin-31 monoclonal antibody |
| CA2843158A1 (en) * | 2011-08-26 | 2013-03-07 | Merrimack Pharmaceuticals, Inc. | Tandem fc bispecific antibodies |
| UA117289C2 (uk) * | 2014-04-02 | 2018-07-10 | Ф. Хоффманн-Ля Рош Аг | Мультиспецифічне антитіло |
| TWI551060B (zh) * | 2014-09-24 | 2016-09-21 | 衡宇科技股份有限公司 | Bch解碼方法及其解碼器 |
| GB2544086B (en) | 2015-11-05 | 2021-04-28 | Povey David | Drip catcher for a stemmed drinking vessel |
| EP3241531A1 (en) * | 2016-05-04 | 2017-11-08 | noonee AG | Leg unit for a wearable sitting posture assisting device |
| CN110177805B (zh) * | 2016-10-19 | 2024-04-02 | 英温拉公司 | 抗体构建体 |
| US20210163594A1 (en) * | 2018-04-17 | 2021-06-03 | Invenra Inc. | Binding molecules |
| CN112384243A (zh) * | 2018-04-17 | 2021-02-19 | 英温拉公司 | 三价三特异性抗体构建体 |
| SG11202010235QA (en) * | 2018-04-18 | 2020-11-27 | Exelixis Inc | Anti-ror antibody constructs |
| WO2020028269A2 (en) * | 2018-07-30 | 2020-02-06 | Invenra Inc. | Multispecific treg binding molecules |
| WO2021145946A1 (en) * | 2020-01-13 | 2021-07-22 | Invenra Inc. | Multispecific treg binding molecules |
-
2017
- 2017-10-18 CN CN201780078920.7A patent/CN110177805B/zh active Active
- 2017-10-18 WO PCT/US2017/057268 patent/WO2018075692A2/en not_active Ceased
- 2017-10-18 FI FIEP17804323.8T patent/FI3529269T3/fi active
- 2017-10-18 MX MX2019004690A patent/MX421186B/es unknown
- 2017-10-18 IL IL266143A patent/IL266143B1/en unknown
- 2017-10-18 AU AU2017345454A patent/AU2017345454B2/en active Active
- 2017-10-18 JP JP2019520869A patent/JP7261158B2/ja active Active
- 2017-10-18 LT LTEPPCT/US2017/057268T patent/LT3529269T/lt unknown
- 2017-10-18 CN CN202410332902.9A patent/CN118359704A/zh active Pending
- 2017-10-18 EP EP17804323.8A patent/EP3529269B1/en active Active
- 2017-10-18 EP EP25218239.9A patent/EP4729535A2/en active Pending
- 2017-10-18 KR KR1020257008855A patent/KR20250044934A/ko active Pending
- 2017-10-18 CA CA3041254A patent/CA3041254A1/en active Pending
- 2017-10-18 PT PT178043238T patent/PT3529269T/pt unknown
- 2017-10-18 CN CN202410343134.7A patent/CN118359705A/zh active Pending
- 2017-10-18 ES ES17804323T patent/ES3063689T3/es active Active
- 2017-10-18 DK DK17804323.8T patent/DK3529269T3/da active
- 2017-10-18 KR KR1020237043908A patent/KR20240000650A/ko active Pending
- 2017-10-18 US US15/787,640 patent/US20180118811A1/en not_active Abandoned
- 2017-10-18 KR KR1020197013738A patent/KR102617264B1/ko active Active
-
2022
- 2022-10-07 JP JP2022162426A patent/JP7591015B2/ja active Active
- 2022-11-15 US US18/055,720 patent/US20240043502A1/en not_active Abandoned
Patent Citations (54)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| US6407213B1 (en) | 1991-06-14 | 2002-06-18 | Genentech, Inc. | Method for making humanized antibodies |
| US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
| US8216805B2 (en) | 1995-03-01 | 2012-07-10 | Genentech, Inc. | Knobs and holes heteromeric polypeptides |
| US5821333A (en) | 1995-03-01 | 1998-10-13 | Genetech, Inc. | Method for making heteromultimeric polypeptides |
| US6685940B2 (en) | 1995-07-27 | 2004-02-03 | Genentech, Inc. | Protein formulation |
| US6171586B1 (en) | 1997-06-13 | 2001-01-09 | Genentech, Inc. | Antibody formulation |
| US8337856B2 (en) | 2000-03-16 | 2012-12-25 | Immunogen, Inc. | Methods of treatment using anti-ERBB antibody-maytansinoid conjugates |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US7829531B2 (en) | 2002-07-31 | 2010-11-09 | Seattle Genetics Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US8961964B2 (en) | 2003-04-04 | 2015-02-24 | Genentech, Inc. | High concentration antibody and protein formulations |
| US8163888B2 (en) | 2003-10-10 | 2012-04-24 | Immunogen, Inc. | Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates and methods of making said conjugates |
| US7745394B2 (en) | 2003-11-06 | 2010-06-29 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| WO2005077090A2 (en) | 2004-02-05 | 2005-08-25 | Seattle Genetics, Inc. | Improved methods of producing antibody conjugates |
| WO2005082023A2 (en) | 2004-02-23 | 2005-09-09 | Genentech, Inc. | Heterocyclic self-immolative linkers and conjugates |
| WO2006065533A2 (en) | 2004-11-29 | 2006-06-22 | Seattle Genetics, Inc. | Engineered antibodies and immunoconjugates |
| US8053562B2 (en) | 2005-07-19 | 2011-11-08 | Ucb Pharma S.A. | Modified antibody fragments |
| WO2007030642A2 (en) | 2005-09-07 | 2007-03-15 | Medimmune, Inc. | Toxin conjugated eph receptor antibodies |
| WO2007103288A2 (en) | 2006-03-02 | 2007-09-13 | Seattle Genetics, Inc. | Engineered antibody drug conjugates |
| WO2009073445A2 (en) | 2007-11-28 | 2009-06-11 | Mersana Therapeutics, Inc. | Biocompatible biodegradable fumagillin analog conjugates |
| US8420081B2 (en) | 2007-11-30 | 2013-04-16 | Abbvie, Inc. | Antibody formulations and methods of making same |
| US8242247B2 (en) | 2007-12-21 | 2012-08-14 | Hoffmann-La Roche Inc. | Bivalent, bispecific antibodies |
| US8592562B2 (en) | 2008-01-07 | 2013-11-26 | Amgen Inc. | Method for making antibody Fc-heterodimeric molecules using electrostatic steering effects |
| WO2010068759A1 (en) | 2008-12-10 | 2010-06-17 | Mersana Therapeutics, Inc. | Pharmaceutical formulations of biodegradable biocompatible camptothecin-polymer conjugates |
| WO2010138719A1 (en) | 2009-05-28 | 2010-12-02 | Mersana Therapeutics, Inc. | Polyal drug conjugates comprising variable rate-releasing linkers |
| US8624003B2 (en) | 2009-06-03 | 2014-01-07 | Immunogen, Inc. | Methods for preparation of antibody-maytansinoid conjugates |
| WO2011104381A2 (en) | 2010-02-26 | 2011-09-01 | Novo Nordisk A/S | Stable antibody containing compositions |
| US8821865B2 (en) | 2010-11-11 | 2014-09-02 | Abbvie Biotechnology Ltd. | High concentration anti-TNFα antibody liquid formulations |
| US8945865B2 (en) | 2011-03-10 | 2015-02-03 | Eisai R&D Management Co., Ltd. | Method for screening for compound capable of enhancing or inhibiting OATP1B1 transport activity, and method for determining expression level of OATP1B1 |
| WO2012171020A1 (en) | 2011-06-10 | 2012-12-13 | Mersana Therapeutics, Inc. | Protein-polymer-drug conjugates |
| US9527927B2 (en) | 2011-12-20 | 2016-12-27 | Medimmune, Llc | Modified polypeptides for bispecific antibody scaffolds |
| US9358286B2 (en) | 2012-04-20 | 2016-06-07 | Merus B.V. | Methods and means for the production of IG-like molecules |
| US9248182B2 (en) | 2012-04-20 | 2016-02-02 | Merus B.V. | Methods and means for the production of Ig-like molecules |
| WO2013173337A2 (en) | 2012-05-15 | 2013-11-21 | Seattle Genetics, Inc. | Self-stabilizing linker conjugates |
| US9216219B2 (en) | 2012-06-12 | 2015-12-22 | Novartis Ag | Anti-BAFFR antibody formulation |
| WO2014008375A1 (en) | 2012-07-05 | 2014-01-09 | Mersana Therapeutics, Inc. | Terminally modified polymers and conjugates thereof |
| WO2014066468A1 (en) | 2012-10-25 | 2014-05-01 | Medimmune, Llc | Stable, low viscosity antibody formulation |
| WO2014093394A1 (en) | 2012-12-10 | 2014-06-19 | Mersana Therapeutics, Inc. | Protein-polymer-drug conjugates |
| WO2014093640A1 (en) | 2012-12-12 | 2014-06-19 | Mersana Therapeutics,Inc. | Hydroxy-polmer-drug-protein conjugates |
| WO2014160360A1 (en) | 2013-03-14 | 2014-10-02 | Mersana Therapeutics Inc. | Tubulysin compounds and conjugates thereof |
| WO2015054659A1 (en) | 2013-10-11 | 2015-04-16 | Mersana Therapeutics, Inc. | Protein-polymer-drug conjugates |
| WO2015057699A2 (en) | 2013-10-15 | 2015-04-23 | Seattle Genetics, Inc. | Pegylated drug-linkers for improved ligand-drug conjugate pharmacokinetics |
| WO2015095755A1 (en) | 2013-12-19 | 2015-06-25 | Seattle Genetics, Inc. | Methylene carbamate linkers for use with targeted-drug conjugates |
| WO2015123679A1 (en) | 2014-02-17 | 2015-08-20 | Seattle Genetics, Inc. | Hydrophilic antibody-drug conjugates |
| WO2015157286A1 (en) | 2014-04-07 | 2015-10-15 | Seattle Genetics, Inc. | Stable formulations for anti-cd19 antibodies and antibody-drug conjugates |
| WO2015195925A1 (en) | 2014-06-18 | 2015-12-23 | Mersana Therapeutics, Inc. | Protein-polymer-drug conjugates and methods of using same |
| WO2016087650A1 (en) | 2014-12-05 | 2016-06-09 | Merck Patent Gmbh | Domain-exchanged antibody |
| WO2016180941A1 (en) | 2015-05-13 | 2016-11-17 | Sanofi | Liquid compositions for anti-cd19 antibody-drug conjugates |
| WO2017015495A1 (en) | 2015-07-21 | 2017-01-26 | Immunogen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| WO2017015502A1 (en) | 2015-07-21 | 2017-01-26 | Immunogen, Inc | Methods of preparing cytotoxic benzodiazepine derivatives |
| WO2017015496A1 (en) | 2015-07-21 | 2017-01-26 | Immunogen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| WO2017136623A1 (en) | 2016-02-05 | 2017-08-10 | Immunogen, Inc. | Efficient process for preparing cell-binding agent-cytotoxic agent conjugates |
| WO2017160754A1 (en) | 2016-03-15 | 2017-09-21 | Mersana Therapeutics,Inc. | Napi2b-targeted antibody-drug conjugates and methods of use thereof |
| WO2017165851A1 (en) | 2016-03-25 | 2017-09-28 | Seattle Genetics, Inc. | Process for the preparation of pegylated drug-linkers and intermediates thereof |
Non-Patent Citations (28)
| Title |
|---|
| AGARWAL ET AL., BIOCONJUGATE CHEM., vol. 24, 2013, pages 846 - 851 |
| AGARWAL ET AL., PROC NATL ACAD SCI USA., vol. 110, 2013, pages 46 - 51 |
| BARFIELD ET AL., DRUG DEV. AND D., vol. 14, 2014, pages 34 - 41 |
| BONISCH ET AL., PROTEIN ENGINEERING, DESIGN & SELECTION, 2017, pages 1 - 12 |
| BRINKMANN ET AL., MABS, vol. 9, no. 2, 2017, pages 182 - 212 |
| CARRICO ET AL., NAT CHEM BIOL, vol. 3, 2007, pages 321 - 2 |
| CHOI ET AL., THERANOSTICS, vol. 2, no. 2, 2012, pages 156 - 178 |
| DATABASE UniProt [O] Database accession no. P01834 |
| DATABASE UniProt [O] Database accession no. P01857 |
| DATABASE UniProt [O] Database accession no. POCG04 |
| DIAMANTIS ET AL., BRITISH JOURNAL OF CANCER, vol. 114, 2016, pages 362 - 367 |
| DRAKE ET AL., BIOCONJUGATE CHEM., vol. 25, 2014, pages 1331 - 41 |
| DRAKE ET AL., CURR OPIN CHEM BIOL., vol. 28, 2015, pages 174 - 80 |
| EDELMAN ET AL., PROC. NATL. ACAD. USA, vol. 63, 1969, pages 78 - 85 |
| FANG ET AL., BIOLOGICAL PROCEDURES ONLINE, vol. 19, 2017, pages 11 |
| HUDAK ET AL., ANGEW CHEM INT ED ENGL., 2012, pages 4161 - 5 |
| IGAWA ET AL., PROTEIN ENG. DES. SEL., vol. 23, 2010, pages 667 - 677 |
| LAMBERT ET AL., ADV THER, vol. 34, 2017, pages 1015 |
| LIANG ET AL., JAM CHEM SOC., vol. 136, 2014, pages 10850 - 3 |
| MERCHANT ET AL., NATURE BIOTECH, vol. 16, 1998, pages 677 - 681 |
| NIESEN ET AL., NATURE PROTOCOLS, vol. 2, 2007, pages 2212 - 2221 |
| RABUKA ET AL., CURR OPIN CHEM BIOL., vol. 14, 2011, pages 790 - 6 |
| RABUKA ET AL., NAT PROTOC., vol. 7, 2012, pages 1052 - 67 |
| SCHAEFER ET AL., PROC NATL ACAD SCI USA., vol. 108, no. 27, 5 July 2011 (2011-07-05), pages 11187 - 92 |
| STICKLER ET AL., GENES IMMUN., vol. 12, no. 3, April 2011 (2011-04-01), pages 213 - 221 |
| STORZ, MABS., vol. 7, no. 6, pages 989 - 1009 |
| WE ET AL., PROC NATL ACAD SCI USA, vol. 106, 2009, pages 3000 - 5 |
| YORK ET AL., BMC BIOTECHNOLOGY, vol. 16, no. 1, 2016, pages 23 |
Cited By (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11952424B2 (en) | 2018-03-30 | 2024-04-09 | Merus N.V. | Multivalent antibody |
| EP3781204A4 (en) * | 2018-04-17 | 2022-03-30 | Invenra, Inc. | BINDING MOLECULES |
| US12084496B2 (en) | 2018-04-18 | 2024-09-10 | Exelixis, Inc. | Anti-ROR antibody constructs |
| US20210380700A1 (en) * | 2018-07-06 | 2021-12-09 | Abmax Biopharmaceuticals | De-adcc/cdc functions of antibodies and their applications |
| WO2020028269A3 (en) * | 2018-07-30 | 2020-03-19 | Invenra Inc. | Multispecific treg binding molecules |
| EP3830129A4 (en) * | 2018-07-30 | 2022-05-04 | Invenra, Inc. | MULTISPECIFIC TREG BINDING MOLECULES |
| US11965030B2 (en) | 2018-12-24 | 2024-04-23 | Sanofi | Multispecific binding proteins with mutant fab domains |
| JP2023507033A (ja) * | 2019-12-20 | 2023-02-20 | キソジ・バイオテクノロジー・インコーポレイテッド | ポリペプチド、タンパク質複合体及びそれを作製する方法 |
| WO2025129132A1 (en) * | 2023-12-14 | 2025-06-19 | Invenra Inc. | Multispecific binding agents that target ctla4 and/or cd25 and uses thereof |
Also Published As
| Publication number | Publication date |
|---|---|
| MX421186B (es) | 2025-02-10 |
| AU2017345454B2 (en) | 2024-10-31 |
| CN110177805B (zh) | 2024-04-02 |
| CA3041254A1 (en) | 2018-04-26 |
| KR20240000650A (ko) | 2024-01-02 |
| CN118359705A (zh) | 2024-07-19 |
| IL266143A (en) | 2019-06-30 |
| IL266143B1 (en) | 2026-04-01 |
| MX2019004690A (es) | 2019-09-27 |
| KR102617264B1 (ko) | 2023-12-29 |
| JP2022176374A (ja) | 2022-11-25 |
| AU2017345454A1 (en) | 2019-05-30 |
| KR20250044934A (ko) | 2025-04-01 |
| EP3529269A2 (en) | 2019-08-28 |
| LT3529269T (lt) | 2026-03-25 |
| EP4729535A2 (en) | 2026-04-22 |
| ES3063689T3 (en) | 2026-04-20 |
| JP7261158B2 (ja) | 2023-04-19 |
| WO2018075692A3 (en) | 2019-04-04 |
| EP3529269B1 (en) | 2025-11-26 |
| FI3529269T3 (fi) | 2026-02-24 |
| CN110177805A (zh) | 2019-08-27 |
| KR20190092380A (ko) | 2019-08-07 |
| JP7591015B2 (ja) | 2024-11-27 |
| US20240043502A1 (en) | 2024-02-08 |
| PT3529269T (pt) | 2026-03-03 |
| DK3529269T3 (da) | 2026-02-23 |
| NZ752832A (en) | 2025-06-27 |
| US20180118811A1 (en) | 2018-05-03 |
| JP2019534277A (ja) | 2019-11-28 |
| CN118359704A (zh) | 2024-07-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20240043502A1 (en) | Antibody constructs | |
| US20250026861A1 (en) | Trivalent trispecific antibody constructs | |
| US20240392002A1 (en) | Anti-ror antibody constructs | |
| US20210163594A1 (en) | Binding molecules | |
| US20220213225A1 (en) | Multispecific treg binding molecules | |
| US20220153844A1 (en) | Multispecific treg binding molecules | |
| WO2019183406A1 (en) | Multispecific antibody purification with ch1 resin | |
| AU2026202585A1 (en) | Anti-ror antibody constructs |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| ENP | Entry into the national phase |
Ref document number: 3041254 Country of ref document: CA Ref document number: 2019520869 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112019008076 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20197013738 Country of ref document: KR Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2017804323 Country of ref document: EP Effective date: 20190520 |
|
| ENP | Entry into the national phase |
Ref document number: 2017345454 Country of ref document: AU Date of ref document: 20171018 Kind code of ref document: A |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17804323 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 112019008076 Country of ref document: BR Kind code of ref document: A2 Effective date: 20190418 |
|
| WWG | Wipo information: grant in national office |
Ref document number: MX/A/2019/004690 Country of ref document: MX |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 1020257008855 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020257008855 Country of ref document: KR |
|
| WWG | Wipo information: grant in national office |
Ref document number: 752832 Country of ref document: NZ |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2017804323 Country of ref document: EP |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 326918 Country of ref document: IL |